


| Basic Information | |
|---|---|
| Family ID | F065228 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRDAATRAMMLEETAKILLYCKQFGGELTLIPNEWVERLAPLASFL |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.56 % |
| % of genes near scaffold ends (potentially truncated) | 96.09 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.844 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.781 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.438 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01243 | Putative_PNPOx | 14.84 |
| PF01048 | PNP_UDP_1 | 10.94 |
| PF01925 | TauE | 9.38 |
| PF02627 | CMD | 3.12 |
| PF00293 | NUDIX | 3.12 |
| PF00072 | Response_reg | 2.34 |
| PF03104 | DNA_pol_B_exo1 | 2.34 |
| PF00596 | Aldolase_II | 2.34 |
| PF02518 | HATPase_c | 2.34 |
| PF00106 | adh_short | 1.56 |
| PF00534 | Glycos_transf_1 | 1.56 |
| PF12680 | SnoaL_2 | 1.56 |
| PF00294 | PfkB | 0.78 |
| PF13561 | adh_short_C2 | 0.78 |
| PF13432 | TPR_16 | 0.78 |
| PF05524 | PEP-utilisers_N | 0.78 |
| PF13410 | GST_C_2 | 0.78 |
| PF00107 | ADH_zinc_N | 0.78 |
| PF04879 | Molybdop_Fe4S4 | 0.78 |
| PF13646 | HEAT_2 | 0.78 |
| PF09335 | SNARE_assoc | 0.78 |
| PF08713 | DNA_alkylation | 0.78 |
| PF00355 | Rieske | 0.78 |
| PF02811 | PHP | 0.78 |
| PF00296 | Bac_luciferase | 0.78 |
| PF02452 | PemK_toxin | 0.78 |
| PF03007 | WES_acyltransf | 0.78 |
| PF09604 | Potass_KdpF | 0.78 |
| PF14791 | DNA_pol_B_thumb | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF02401 | LYTB | 0.78 |
| PF03109 | ABC1 | 0.78 |
| PF00459 | Inositol_P | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 10.94 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 10.94 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 10.94 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 9.38 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.12 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.12 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 2.34 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.56 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.78 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.78 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.78 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.78 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.78 |
| COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 0.78 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.06 % |
| Unclassified | root | N/A | 10.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04YQLTR | Not Available | 512 | Open in IMG/M |
| 3300000955|JGI1027J12803_101812785 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000955|JGI1027J12803_108508951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 838 | Open in IMG/M |
| 3300001431|F14TB_100087266 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300002562|JGI25382J37095_10122958 | Not Available | 883 | Open in IMG/M |
| 3300004463|Ga0063356_103547813 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005166|Ga0066674_10116951 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300005175|Ga0066673_10189990 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005181|Ga0066678_10771136 | Not Available | 637 | Open in IMG/M |
| 3300005332|Ga0066388_100709842 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005332|Ga0066388_102372982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300005332|Ga0066388_103200386 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005332|Ga0066388_103911625 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005332|Ga0066388_107058363 | Not Available | 565 | Open in IMG/M |
| 3300005444|Ga0070694_101505062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005445|Ga0070708_101079829 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005446|Ga0066686_10395961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300005446|Ga0066686_10469840 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005450|Ga0066682_10798303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005451|Ga0066681_10124974 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005471|Ga0070698_100441856 | Not Available | 1236 | Open in IMG/M |
| 3300005529|Ga0070741_10009101 | All Organisms → cellular organisms → Bacteria | 19507 | Open in IMG/M |
| 3300005540|Ga0066697_10610185 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005553|Ga0066695_10181469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1317 | Open in IMG/M |
| 3300005587|Ga0066654_10822932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300005614|Ga0068856_101872737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300005713|Ga0066905_100882164 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005764|Ga0066903_101080108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1477 | Open in IMG/M |
| 3300005764|Ga0066903_104588882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300005764|Ga0066903_106762005 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005764|Ga0066903_107020962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300006032|Ga0066696_10078778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1929 | Open in IMG/M |
| 3300006797|Ga0066659_11303930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300006854|Ga0075425_101070955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300006871|Ga0075434_100285588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1670 | Open in IMG/M |
| 3300006871|Ga0075434_101036657 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006881|Ga0068865_101526675 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006904|Ga0075424_100662930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1114 | Open in IMG/M |
| 3300007076|Ga0075435_100764221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300009012|Ga0066710_101620877 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009012|Ga0066710_101701887 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300009085|Ga0105103_10764162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 559 | Open in IMG/M |
| 3300009088|Ga0099830_10907413 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300009137|Ga0066709_100372042 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300009137|Ga0066709_104227108 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009147|Ga0114129_12142796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300009792|Ga0126374_10498507 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300010046|Ga0126384_10106962 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300010047|Ga0126382_12201566 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010321|Ga0134067_10252233 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010333|Ga0134080_10587326 | Not Available | 540 | Open in IMG/M |
| 3300010336|Ga0134071_10029590 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300010337|Ga0134062_10670692 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010359|Ga0126376_12592684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300010360|Ga0126372_11507761 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010366|Ga0126379_11402578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300010391|Ga0136847_11053932 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300011271|Ga0137393_10376946 | Not Available | 1214 | Open in IMG/M |
| 3300011423|Ga0137436_1182997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300011444|Ga0137463_1254410 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012189|Ga0137388_10534220 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012198|Ga0137364_11077893 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012199|Ga0137383_10425692 | Not Available | 973 | Open in IMG/M |
| 3300012361|Ga0137360_11190807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300012922|Ga0137394_10952403 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012930|Ga0137407_11314214 | Not Available | 687 | Open in IMG/M |
| 3300012976|Ga0134076_10068413 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300012976|Ga0134076_10144499 | Not Available | 971 | Open in IMG/M |
| 3300014157|Ga0134078_10168649 | Not Available | 873 | Open in IMG/M |
| 3300014883|Ga0180086_1206358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300015053|Ga0137405_1196454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1169 | Open in IMG/M |
| 3300015069|Ga0167633_112922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300016387|Ga0182040_10051851 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300017654|Ga0134069_1151338 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300017659|Ga0134083_10283006 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300017974|Ga0187777_11430766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → Dongia mobilis | 511 | Open in IMG/M |
| 3300018032|Ga0187788_10528979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300018074|Ga0184640_10057975 | Not Available | 1616 | Open in IMG/M |
| 3300018088|Ga0187771_11709609 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 534 | Open in IMG/M |
| 3300018433|Ga0066667_10063757 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300018433|Ga0066667_11560934 | Not Available | 586 | Open in IMG/M |
| 3300019360|Ga0187894_10446978 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300020221|Ga0194127_10302297 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300021329|Ga0210362_1205506 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300022226|Ga0224512_10272035 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300023102|Ga0247754_1117680 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025432|Ga0208821_1014502 | All Organisms → cellular organisms → Archaea → DPANN group | 1846 | Open in IMG/M |
| 3300025615|Ga0210086_1152166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300025790|Ga0210075_1083376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300025918|Ga0207662_10913182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300025938|Ga0207704_11182488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300025972|Ga0207668_11040729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300026309|Ga0209055_1063262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300026331|Ga0209267_1134227 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300026532|Ga0209160_1212032 | Not Available | 698 | Open in IMG/M |
| 3300026538|Ga0209056_10421623 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300026540|Ga0209376_1039988 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300026548|Ga0209161_10466233 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027818|Ga0209706_10109139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300027897|Ga0209254_11103712 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028380|Ga0268265_10609963 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300028792|Ga0307504_10407720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 536 | Open in IMG/M |
| 3300031544|Ga0318534_10547237 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031751|Ga0318494_10238146 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300031768|Ga0318509_10770687 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031820|Ga0307473_10577189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300031833|Ga0310917_10423262 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031954|Ga0306926_12118749 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300032060|Ga0318505_10382035 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032061|Ga0315540_10066841 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300032063|Ga0318504_10300327 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032089|Ga0318525_10639715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300032090|Ga0318518_10510214 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300032173|Ga0315268_10630837 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300032180|Ga0307471_100346086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1594 | Open in IMG/M |
| 3300032828|Ga0335080_11216803 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300032892|Ga0335081_12256671 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300032897|Ga0335071_10495798 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300032955|Ga0335076_10505272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RBG_16_68_9 | 1092 | Open in IMG/M |
| 3300033158|Ga0335077_11548962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300033291|Ga0307417_10008040 | All Organisms → cellular organisms → Bacteria | 4535 | Open in IMG/M |
| 3300033417|Ga0214471_10112396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Parahaliea → Parahaliea mediterranea | 2242 | Open in IMG/M |
| 3300033481|Ga0316600_11064333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300033482|Ga0316627_102093007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300033486|Ga0316624_10507327 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300033487|Ga0316630_11420751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300033487|Ga0316630_11543215 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300034178|Ga0364934_0107412 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.34% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.56% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.78% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025790 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02704320 | 2070309004 | Green-Waste Compost | MLLEETAKIVLYTKQFGGTVTLLPDEWIERLAAIADFV |
| JGI1027J12803_1018127852 | 3300000955 | Soil | AAMIEETAKLQLYIRQFGGTVSLLPDEWVKKLAPIKDFL* |
| JGI1027J12803_1085089514 | 3300000955 | Soil | GLMAVGKTMHDAAKRAMMLEETAKVLLYCKQFGGELTLIPDEWVQSLAGIREFL* |
| F14TB_1000872661 | 3300001431 | Soil | MMLEETAKVLLYCKQFGGELTLIPDEWVQSLAGIREFL* |
| JGI25382J37095_101229582 | 3300002562 | Grasslands Soil | VGKTMRDAATRAMMLEETARILLYCRQFGGELTLIPSEWVERLAAFATFV* |
| Ga0063356_1035478131 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AMNLEETAKIVLYCKQFGGELALIPDEWVERLAALGEFI* |
| Ga0066674_101169511 | 3300005166 | Soil | RAMMLEETAKIVLYCKQFGGELALIPPEWVERLAQFASFM* |
| Ga0066673_101899903 | 3300005175 | Soil | ATRAMMLEETAKIVLYCKQFGGELALIPPEWVERLAQFASFM* |
| Ga0066678_107711361 | 3300005181 | Soil | LMTVGKTMRDAATRAMMLEETARILLYCRQFGGELTLIPSEWVERLAAFATFV* |
| Ga0066388_1007098421 | 3300005332 | Tropical Forest Soil | ATRAMMLEETAKLVLYCKQFGGELALIPDEWVERLASVANFL* |
| Ga0066388_1023729823 | 3300005332 | Tropical Forest Soil | RAMMLEETAKIVLYCKQFGGELALIPTEWVERLAQFANFM* |
| Ga0066388_1032003861 | 3300005332 | Tropical Forest Soil | MAVGKTMRDAATRAMMLEETAKLVLYCKQFGGDLALIPDEWVERLASVANFL* |
| Ga0066388_1039116252 | 3300005332 | Tropical Forest Soil | MHDAAKRAMMLEETAKVLLYCKQFGGELTVIPDEWVQSLAGIREFL* |
| Ga0066388_1070583632 | 3300005332 | Tropical Forest Soil | PNLRKAATRAMMLEETAKIVLYCKQFGGTVTLLPNEWIERLSSIADFV* |
| Ga0070694_1015050622 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AATRAMILEETAKIVLYCKQFGGTVSLLPDEWIDRLASLAEFV* |
| Ga0070708_1010798291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ATRAMMLEETAKIVLYCKQFGGEVALIPNEWVERLAQFANFI* |
| Ga0066686_103959612 | 3300005446 | Soil | MRDAATRAMMLEETAKILLYCRQFGGELTLIPSEWVERLAAVAEFV* |
| Ga0066686_104698401 | 3300005446 | Soil | RAMVLEETAKIVLYVKQFGGDVSLIPPDWAEQLAEREDLI* |
| Ga0066682_107983032 | 3300005450 | Soil | LMTVGKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFASFV* |
| Ga0066681_101249744 | 3300005451 | Soil | TRAMMLEETAKIVLYCKQFGGELALIPPEWVERLAQFASFM* |
| Ga0070698_1004418562 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ATRAMMLEETAKIILYTKQFGGTVTLLPDEWIDNLAALADFV* |
| Ga0070741_100091011 | 3300005529 | Surface Soil | MLEETAKILLYCKQFGGELTVIPNEWVERLAQFANFM* |
| Ga0066697_106101851 | 3300005540 | Soil | GKSMRDAATRAMMLEETAKILLYCKQFGGELTLIPPEWVERLAQLSSFL* |
| Ga0066695_101814692 | 3300005553 | Soil | MTVGKTMRDAATRAMMLEETAKILLYCKQFGGEMTLIPSEWVERLAAFASFV* |
| Ga0066654_108229322 | 3300005587 | Soil | MTVGKDLRDAATRAMILEETAKIVLYVKQFGGEVSVIPPDWVEQLAQLANFI* |
| Ga0068856_1018727371 | 3300005614 | Corn Rhizosphere | MTVGKTMRDAATRAMMLEETAKILLYCRQFGGELTVIPPPWVEQLAPLADFI* |
| Ga0066905_1008821642 | 3300005713 | Tropical Forest Soil | MLEETAKLVLYCKQFGGELALIPDEWVERLASVANFL* |
| Ga0066903_1010801082 | 3300005764 | Tropical Forest Soil | ETAKIVLYCKQFGGTVTLIPDEWVERLAPLADFI* |
| Ga0066903_1045888821 | 3300005764 | Tropical Forest Soil | MMLEETAKLVLYCRQFGGELALIPPEWVERLASVAAFL* |
| Ga0066903_1067620052 | 3300005764 | Tropical Forest Soil | AGKTLRDAATRAMNLEETAKILLYCKQFGGELAVLPDEWVERLASFADFV* |
| Ga0066903_1070209621 | 3300005764 | Tropical Forest Soil | ATRAMMLEETAKIVLYCRQFGGTVTLLPDEWIERLAALADFV* |
| Ga0066696_100787781 | 3300006032 | Soil | KTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFAEFV* |
| Ga0066659_113039301 | 3300006797 | Soil | MTVGKSMRDAATRAMTLEETAKIVLYCKQFGGELTLIPPEWVERLAAIAEFI* |
| Ga0075425_1010709551 | 3300006854 | Populus Rhizosphere | MTVGKTMRDAATRAMMLEETAKIVLYCRQFGGELALIPTEWVERLAQFANFM* |
| Ga0075434_1002855884 | 3300006871 | Populus Rhizosphere | KTMRDAATRAMMLEETAKIVLYCRQFGGELALIPTEWVERLAQFANFM* |
| Ga0075434_1010366571 | 3300006871 | Populus Rhizosphere | LMTVGKTMRDAATRAMMLEETAKILLYCKQFGGELAVIPSEWVERLSQFANFV* |
| Ga0068865_1015266753 | 3300006881 | Miscanthus Rhizosphere | IEETAKLYLYCKQFGGELAVIPPEWVERLASVASFI* |
| Ga0075424_1006629301 | 3300006904 | Populus Rhizosphere | ETAKIVLYTKQFGGTVTVLPDEWIERLAAIADFV* |
| Ga0075435_1007642211 | 3300007076 | Populus Rhizosphere | VGKTMRDAATRAMMLEETAKILLYCRQFGGELTVIPPEWVEQLAPLADFI* |
| Ga0066710_1016208773 | 3300009012 | Grasslands Soil | MRDAATRAMMLEETAKILLYCKQFGGELTLIPNEWVERLAPLASFL |
| Ga0066710_1017018871 | 3300009012 | Grasslands Soil | VGKSMRDAATRAMMLEETAKILLYCKQFGRELALIPPEWVERLAQLSSFL |
| Ga0105103_107641621 | 3300009085 | Freshwater Sediment | TRAMNLEETAKIVLYCKQFGGELTLIPDEWVEKLAAIADFI* |
| Ga0099830_109074132 | 3300009088 | Vadose Zone Soil | DLRDAATRAMILEETAKIVLYMKQFRGEVSVIPPDWVEQLAQLANFI* |
| Ga0066709_1003720425 | 3300009137 | Grasslands Soil | RAMMLEETAKILLYCKQFGGELTLIPPEWVERLAQLSSFL* |
| Ga0066709_1042271082 | 3300009137 | Grasslands Soil | EETAKVLLYCKQFGGELTLIPDDWVERLAQLATFM* |
| Ga0114129_121427962 | 3300009147 | Populus Rhizosphere | ETAKILLYCKQFGGELAVIPNEWVERLSQFANFV* |
| Ga0126374_104985071 | 3300009792 | Tropical Forest Soil | QCHGLMALGKTMRDAATRAMMLEETAKLALYCKQFGGELALIPDEWVERLASVASFL* |
| Ga0126384_101069621 | 3300010046 | Tropical Forest Soil | MMLEETAKLVLLARQFGGEITLIPPEWVERLASFASFL* |
| Ga0126382_122015662 | 3300010047 | Tropical Forest Soil | LMAVGKTMRDAATRAMMLEETAKLVLLAKQFGGEITLIPPEWVERLASVASFL* |
| Ga0134067_102522331 | 3300010321 | Grasslands Soil | TRAMMLEETAKILLYCKQFGGELTLIPNEWVERLAQLASFL* |
| Ga0134080_105873261 | 3300010333 | Grasslands Soil | HGLMTVGKTMRDAATRAMMLEETARILLYCRQFGGELTLIPSEWVERLAAFAGFV* |
| Ga0134071_100295905 | 3300010336 | Grasslands Soil | GKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPNEWVERLAQLASFL* |
| Ga0134062_106706921 | 3300010337 | Grasslands Soil | VGKSMRDAATRAMMLEETAKVLLYCKQFGGELTLIPPEWVERLAQLSSFL* |
| Ga0126376_125926841 | 3300010359 | Tropical Forest Soil | REAATRAMMIEETAKLVLLCKQFGGELAVIPPEWVERLASFASFM* |
| Ga0126372_115077612 | 3300010360 | Tropical Forest Soil | MAVGKTMRDAATRAMMLEETAKLVIYCKQFGGELTLIPPEWVERLAGFANFL* |
| Ga0126379_114025781 | 3300010366 | Tropical Forest Soil | MRDAATRAMMLEETAKLVLYCKQFGGELALIPDEWVERLASVANFL* |
| Ga0136847_110539321 | 3300010391 | Freshwater Sediment | MMIEETAKLYLYCKQFGGELAVIPPEWVERLASVASFL* |
| Ga0137393_103769461 | 3300011271 | Vadose Zone Soil | EETAKILLYCKQFGGELTLIPSEWVERLAAFATFV* |
| Ga0137436_11829972 | 3300011423 | Soil | GLMAVGKTMRDAATRAMMIEETAKLVLYCKQFGGDVALIPDEWVERLASFANFL* |
| Ga0137463_12544101 | 3300011444 | Soil | TVGPNLRKAATRAMMLEETAKIVLYTKQFGGTVTLVPDDWIERLAAIAEFV* |
| Ga0137388_105342203 | 3300012189 | Vadose Zone Soil | EETAKIVLYCKQFGGELTLIPPEWVERLAVIAEFI* |
| Ga0137364_110778932 | 3300012198 | Vadose Zone Soil | ETAKILLYCKQFGGELTLIPPEWVERLAQLSSFL* |
| Ga0137383_104256921 | 3300012199 | Vadose Zone Soil | HGLMTVGKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFASFV* |
| Ga0137360_111908072 | 3300012361 | Vadose Zone Soil | ATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFASFV* |
| Ga0137394_109524032 | 3300012922 | Vadose Zone Soil | LMTVGKSMRDAATRAMMLEETAKILLYCRQFGGELTLIPPEWVERLAQLSSFL* |
| Ga0137407_113142142 | 3300012930 | Vadose Zone Soil | VGKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFASFV* |
| Ga0134076_100684132 | 3300012976 | Grasslands Soil | MRDAATRAMMLEETAKIVLYCKQFGGELALIPIEWVERFAQFASFM* |
| Ga0134076_101444991 | 3300012976 | Grasslands Soil | MRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAVAEFV* |
| Ga0134078_101686491 | 3300014157 | Grasslands Soil | MRDAATRAMMLEETAKVLLYCKQFGGALALIPSEWVERLAAIAEFV* |
| Ga0180086_12063582 | 3300014883 | Soil | VGKTMRDAATRAMMIEETAKLYLYCKQFGGELAVIPPEWVERLASVATFL* |
| Ga0137405_11964543 | 3300015053 | Vadose Zone Soil | KTMRDAATRAMMLEETAKVLLYCKQFGGALALIPSEWVERLAAIAEFV* |
| Ga0167633_1129223 | 3300015069 | Glacier Forefield Soil | QCHGLMSVGKTMRDAATRAMMIEETAKIVLYCRQFGGELTLIPGEWVERLAGFAAFL* |
| Ga0182040_100518515 | 3300016387 | Soil | HGLMAVGKTMRDAATRAMMLEETVKLVIYCKQFGGELALIPPEWVERLAGFANFM |
| Ga0134069_11513382 | 3300017654 | Grasslands Soil | VGKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAVAEFV |
| Ga0134083_102830061 | 3300017659 | Grasslands Soil | MMLEETAKILLYCKQFGGELTLIPNEWVERLAQLASFL |
| Ga0187777_114307662 | 3300017974 | Tropical Peatland | MTVGKTMRDAATRAMMLEETAKILLYCKQFGGELAVIPNDWVERLAQFAAFL |
| Ga0187788_105289791 | 3300018032 | Tropical Peatland | RAMNLEETAKIILYCKQFGGELTLLPDEWVERLASFADFV |
| Ga0184640_100579751 | 3300018074 | Groundwater Sediment | IGKDLRDAATRAMVLEETAKIVLYVKQFGGDVSVIPPDWVEQLAQLANFV |
| Ga0187771_117096092 | 3300018088 | Tropical Peatland | LEETAKVLVYCKQFGGTVSLLPDEWVERLAPLADFI |
| Ga0066667_100637571 | 3300018433 | Grasslands Soil | MMLEETAKILLYCKQFGGELTLIPNEWVERLAQRASFL |
| Ga0066667_115609341 | 3300018433 | Grasslands Soil | MMLEETAKVLLYCKQFGGALALIPSEWVERLAAIAEFV |
| Ga0187894_104469782 | 3300019360 | Microbial Mat On Rocks | DAATRAMMLEETAKLVLYCRQFGGEVTAIPTEWVERLASVAAFL |
| Ga0194127_103022971 | 3300020221 | Freshwater Lake | MNLEETAKIVLYCKQFGGELTLIPDEWVGKLAAIADFI |
| Ga0210362_12055061 | 3300021329 | Estuarine | RAMMIEETAKLVLYTKQFGGTVTLLPDEWVERLAPLADFI |
| Ga0224512_102720352 | 3300022226 | Sediment | SAATRAMMIEETAKLSLYVKQFGGAVAHIPDPWVEQIAGYAEFM |
| Ga0247754_11176801 | 3300023102 | Soil | KNLRKAATRAMMIEETAKLVLYTQQFGGTVTLLPPEWVENLASLAEFI |
| Ga0208821_10145021 | 3300025432 | Peatland | ENLRKAVTRAMMLEETAKILMYCKQFGGTISLLPDEWVERLAPLADFI |
| Ga0210086_11521661 | 3300025615 | Natural And Restored Wetlands | TRAMMLEETAKIVLYTKQFGGTVTLLPNEWIEQLASLAEFI |
| Ga0210075_10833761 | 3300025790 | Natural And Restored Wetlands | RAMLLEETAKIVLYCKQFGGTVSLLPDEWIERLAPLADFI |
| Ga0207662_109131823 | 3300025918 | Switchgrass Rhizosphere | DAATRAMMIEETAKLVLYCKQFGGDVALIPDEWVERLASFANFL |
| Ga0207704_111824883 | 3300025938 | Miscanthus Rhizosphere | AATRAMMIEETAKLYLYCKQFGGELAVIPPEWVERLASVASFI |
| Ga0207668_110407291 | 3300025972 | Switchgrass Rhizosphere | ILQCHGLMAVGKTMSDAATRAMMLEETAKLVLYCKQYGGEMALIPDEWVQNLASIANFL |
| Ga0209055_10632622 | 3300026309 | Soil | DAATRAMMLEETARILLYCRQFGGELTLIPSEWVERLAAFASFV |
| Ga0209267_11342272 | 3300026331 | Soil | LEETAKILLYCKQFGGELTLIPSEWVERLAAVAEFV |
| Ga0209160_12120321 | 3300026532 | Soil | RDAATRAMMLEETARILLYCRQFGGELTLIPSEWVERLAAFAGFV |
| Ga0209056_104216231 | 3300026538 | Soil | GLMTVGKSMRDAATRAMMLEETAKILLYCKQFGGELTLIPPEWVERLAQLSCFL |
| Ga0209376_10399881 | 3300026540 | Soil | MMLEETAKILLYCKQFGGELTLIPNEWVERLAPLASFL |
| Ga0209161_104662332 | 3300026548 | Soil | TMRDAATRAMMLEETAKILLYCKQFGGELTLIPNEWVERLAQLASFL |
| Ga0209706_101091392 | 3300027818 | Freshwater Sediment | AAMLEETAKLQLYVQQFGGSVTLLPDEWVKKLEPIKDFL |
| Ga0209254_111037121 | 3300027897 | Freshwater Lake Sediment | LAATRAMLLEETAKIVLYTKQFGGSVTLLPDEWIERLAAIAEFV |
| Ga0268265_106099631 | 3300028380 | Switchgrass Rhizosphere | LRKAATRAMMIEETAKLVLYTQQFGGTVTLLPPEWVENLASLAEFI |
| Ga0307504_104077202 | 3300028792 | Soil | AMILEETAKIVLYVKQFGGEVSVIPPGWVEQLAQLANFI |
| Ga0318534_105472372 | 3300031544 | Soil | LQCHGLMAVGKTMRDAATRAMMLEETAKLVIYCKQFGGELALIPPEWVERLAGFANFL |
| Ga0318494_102381463 | 3300031751 | Soil | DAATRAMMIEETAKLVLYCKQFGGELAVIPPEWVERLASVANFL |
| Ga0318509_107706871 | 3300031768 | Soil | LQCHGLIAVGKTMRDAATRAMMIEETAKLVLYCKQFGGELAVIPPEWVERLASVANFL |
| Ga0307473_105771891 | 3300031820 | Hardwood Forest Soil | EETAKILLYCKQFGGELTVIPNEWVERLSQFANFV |
| Ga0310917_104232622 | 3300031833 | Soil | RAMMLEETAKLVIYCKQFGGELALIPPEWVERLAGFANFM |
| Ga0306926_121187492 | 3300031954 | Soil | MAVGKTMRDAATRAMMLEETAKLVLYCKQFGGDLALIPDEWVERLASVANFL |
| Ga0318505_103820352 | 3300032060 | Soil | AATRAMMLEETAKLVIYCKQFGGELTLIPPEWVERLAGFANFM |
| Ga0315540_100668411 | 3300032061 | Salt Marsh Sediment | LLEETAKIVLYTKQFGGTVTLLPDEWIDQLAALAEFI |
| Ga0318504_103003271 | 3300032063 | Soil | KTMRDAATRAMMLEETAKLVIYCKQFGGELTLIPPEWVERLAGFANFM |
| Ga0318525_106397152 | 3300032089 | Soil | LQCHGLMAAGKTMRDAATRAMMLEETAKLVLYCRQFGGELALIPPEWVERLASVAAFL |
| Ga0318518_105102141 | 3300032090 | Soil | KTMRDAATRAMMLEETAKLMIYCKQFGGELTLIPPEWVERLAGFANFM |
| Ga0315268_106308371 | 3300032173 | Sediment | VTRAMMLEETAKILMYCKQFGGTISLLPDEWVERLAPLADFI |
| Ga0307471_1003460863 | 3300032180 | Hardwood Forest Soil | TVGKTMRDAATRAMMLEETAKILLYCKQFGGELTLIPSEWVERLAAFATFV |
| Ga0335080_112168032 | 3300032828 | Soil | IEETAKLQLYIRQFGGTVSLLPDEWVKKLAPIKDFL |
| Ga0335081_122566711 | 3300032892 | Soil | AATRAMNLEETAKILLYCKQFGGELAVLPDEWVERLASFADFV |
| Ga0335071_104957982 | 3300032897 | Soil | LMTVGENLRKAATRAMMLEETAKIVLYCKQFGGSVSVLPGEWVERLAPLADFV |
| Ga0335076_105052721 | 3300032955 | Soil | AMMLEETAKIVLYVKQFGGTVSLLPNEWVEQLASIADFV |
| Ga0335077_115489622 | 3300033158 | Soil | LRKAATRAMMLEETAKIVLYTRQFGGTVTLLPNEWIERLAAIADFI |
| Ga0307417_100080405 | 3300033291 | Salt Marsh | NLRKAATRAMLLEETAKIVLYTKQFGGTVSFLPEQWVEQLASLADFI |
| Ga0214471_101123962 | 3300033417 | Soil | GLMAVGRTLRDAANRAMMLEETAKLVLYCKQFGGEIAVLPAEWVDQLAQLADFI |
| Ga0316600_110643331 | 3300033481 | Soil | VGETMRKAANRAVMLEETARLYLYCKQFGGEVAVIPPDWVEKLAPIKDFL |
| Ga0316627_1020930071 | 3300033482 | Soil | RDAATRAMMIEETAKLYLYCKQFGGDLAVIPPEWVERLSGFASFL |
| Ga0316624_105073271 | 3300033486 | Soil | GRNMRDAAKRAILLEETAKLVLYCKQFGGEMALIPNEWVQNLAGLRDFL |
| Ga0316630_114207512 | 3300033487 | Soil | AVMLEETARLYLYCKQFGGEVAVIPPDWVAKLAPIKDFL |
| Ga0316630_115432151 | 3300033487 | Soil | PNLRKAATRAMMLEETAKIVLYVKQFGGTVSYVPDDWVQQLAPLADFI |
| Ga0364934_0107412_1_108 | 3300034178 | Sediment | EETAKIVLYCKQFGGTVTPLPDEWIERLAALADFI |
| ⦗Top⦘ |