


| Basic Information | |
|---|---|
| Family ID | F065215 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 44 residues |
| Representative Sequence | IDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 78.12 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.438 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.562 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.219 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.312 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 89.74% β-sheet: 0.00% Coil/Unstructured: 10.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.56 % |
| Unclassified | root | N/A | 48.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10040323 | Not Available | 1980 | Open in IMG/M |
| 3300001460|JGI24003J15210_10054227 | Not Available | 1322 | Open in IMG/M |
| 3300001460|JGI24003J15210_10084091 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 954 | Open in IMG/M |
| 3300001472|JGI24004J15324_10007830 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3959 | Open in IMG/M |
| 3300001589|JGI24005J15628_10043500 | Not Available | 1790 | Open in IMG/M |
| 3300001720|JGI24513J20088_1021049 | Not Available | 708 | Open in IMG/M |
| 3300002483|JGI25132J35274_1018260 | Not Available | 1676 | Open in IMG/M |
| 3300006025|Ga0075474_10107327 | Not Available | 898 | Open in IMG/M |
| 3300006735|Ga0098038_1042378 | Not Available | 1665 | Open in IMG/M |
| 3300006735|Ga0098038_1066568 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300006735|Ga0098038_1168213 | Not Available | 722 | Open in IMG/M |
| 3300006737|Ga0098037_1141034 | Not Available | 814 | Open in IMG/M |
| 3300006737|Ga0098037_1168456 | Not Available | 729 | Open in IMG/M |
| 3300006737|Ga0098037_1196264 | Not Available | 662 | Open in IMG/M |
| 3300006737|Ga0098037_1264591 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006752|Ga0098048_1060998 | Not Available | 1172 | Open in IMG/M |
| 3300006802|Ga0070749_10030596 | All Organisms → Viruses → Predicted Viral | 3363 | Open in IMG/M |
| 3300006802|Ga0070749_10036164 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3051 | Open in IMG/M |
| 3300006802|Ga0070749_10738758 | Not Available | 524 | Open in IMG/M |
| 3300006916|Ga0070750_10171353 | Not Available | 974 | Open in IMG/M |
| 3300006919|Ga0070746_10013617 | All Organisms → Viruses → Predicted Viral | 4562 | Open in IMG/M |
| 3300006919|Ga0070746_10023792 | All Organisms → Viruses → Predicted Viral | 3343 | Open in IMG/M |
| 3300006919|Ga0070746_10313962 | Not Available | 717 | Open in IMG/M |
| 3300006920|Ga0070748_1080959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1254 | Open in IMG/M |
| 3300007229|Ga0075468_10086223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 1012 | Open in IMG/M |
| 3300007234|Ga0075460_10070800 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300007234|Ga0075460_10200305 | Not Available | 679 | Open in IMG/M |
| 3300007276|Ga0070747_1099661 | Not Available | 1073 | Open in IMG/M |
| 3300007345|Ga0070752_1034591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2429 | Open in IMG/M |
| 3300007345|Ga0070752_1248092 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 693 | Open in IMG/M |
| 3300007540|Ga0099847_1066922 | Not Available | 1115 | Open in IMG/M |
| 3300007540|Ga0099847_1116774 | Not Available | 805 | Open in IMG/M |
| 3300009071|Ga0115566_10351750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 858 | Open in IMG/M |
| 3300009124|Ga0118687_10032475 | Not Available | 1720 | Open in IMG/M |
| 3300009481|Ga0114932_10215980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ct1yA16 | 1164 | Open in IMG/M |
| 3300009605|Ga0114906_1068399 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1319 | Open in IMG/M |
| 3300009605|Ga0114906_1127083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 895 | Open in IMG/M |
| 3300010148|Ga0098043_1163789 | Not Available | 625 | Open in IMG/M |
| 3300010296|Ga0129348_1238719 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 612 | Open in IMG/M |
| 3300010300|Ga0129351_1041381 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1896 | Open in IMG/M |
| 3300011013|Ga0114934_10397704 | Not Available | 614 | Open in IMG/M |
| 3300012920|Ga0160423_10222662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 1310 | Open in IMG/M |
| 3300012920|Ga0160423_10356649 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300012920|Ga0160423_10679051 | Not Available | 695 | Open in IMG/M |
| 3300012954|Ga0163111_10030564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 4033 | Open in IMG/M |
| 3300012954|Ga0163111_11353375 | Not Available | 700 | Open in IMG/M |
| 3300013010|Ga0129327_10024181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3174 | Open in IMG/M |
| 3300017708|Ga0181369_1006766 | Not Available | 3011 | Open in IMG/M |
| 3300017708|Ga0181369_1014234 | Not Available | 1995 | Open in IMG/M |
| 3300017708|Ga0181369_1037966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 1112 | Open in IMG/M |
| 3300017713|Ga0181391_1081979 | Not Available | 737 | Open in IMG/M |
| 3300017714|Ga0181412_1015474 | Not Available | 2205 | Open in IMG/M |
| 3300017721|Ga0181373_1100576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 510 | Open in IMG/M |
| 3300017729|Ga0181396_1039281 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300017752|Ga0181400_1178296 | Not Available | 593 | Open in IMG/M |
| 3300017753|Ga0181407_1011073 | Not Available | 2571 | Open in IMG/M |
| 3300017755|Ga0181411_1117781 | Not Available | 777 | Open in IMG/M |
| 3300017760|Ga0181408_1160319 | Not Available | 578 | Open in IMG/M |
| 3300017764|Ga0181385_1207160 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 592 | Open in IMG/M |
| 3300017765|Ga0181413_1024541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 1890 | Open in IMG/M |
| 3300017770|Ga0187217_1017865 | Not Available | 2555 | Open in IMG/M |
| 3300017770|Ga0187217_1161091 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300017771|Ga0181425_1173736 | Not Available | 680 | Open in IMG/M |
| 3300017771|Ga0181425_1243280 | Not Available | 557 | Open in IMG/M |
| 3300017771|Ga0181425_1287932 | Not Available | 505 | Open in IMG/M |
| 3300017776|Ga0181394_1122659 | Not Available | 819 | Open in IMG/M |
| 3300017779|Ga0181395_1273402 | Not Available | 514 | Open in IMG/M |
| 3300017782|Ga0181380_1049403 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300017818|Ga0181565_10673251 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 658 | Open in IMG/M |
| 3300017949|Ga0181584_10905687 | Not Available | 517 | Open in IMG/M |
| 3300017951|Ga0181577_10962021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 505 | Open in IMG/M |
| 3300017957|Ga0181571_10100713 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300017957|Ga0181571_10541326 | Not Available | 708 | Open in IMG/M |
| 3300017958|Ga0181582_10669715 | Not Available | 628 | Open in IMG/M |
| 3300017962|Ga0181581_10222599 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300017964|Ga0181589_10789326 | Not Available | 589 | Open in IMG/M |
| 3300017986|Ga0181569_11042426 | Not Available | 526 | Open in IMG/M |
| 3300018049|Ga0181572_10187989 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300018416|Ga0181553_10324693 | Not Available | 851 | Open in IMG/M |
| 3300018418|Ga0181567_10869893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 568 | Open in IMG/M |
| 3300018421|Ga0181592_10373641 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300018421|Ga0181592_10965001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 551 | Open in IMG/M |
| 3300018423|Ga0181593_10806490 | Not Available | 657 | Open in IMG/M |
| 3300018424|Ga0181591_10064783 | All Organisms → Viruses → Predicted Viral | 3046 | Open in IMG/M |
| 3300018426|Ga0181566_10351995 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300018428|Ga0181568_10699257 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 792 | Open in IMG/M |
| 3300019937|Ga0194022_1016805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 963 | Open in IMG/M |
| 3300020191|Ga0181604_10240231 | Not Available | 855 | Open in IMG/M |
| 3300020207|Ga0181570_10090285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1749 | Open in IMG/M |
| 3300020388|Ga0211678_10153962 | Not Available | 984 | Open in IMG/M |
| 3300021368|Ga0213860_10307617 | Not Available | 692 | Open in IMG/M |
| 3300022072|Ga0196889_1009207 | All Organisms → Viruses → Predicted Viral | 2194 | Open in IMG/M |
| 3300022934|Ga0255781_10275873 | Not Available | 775 | Open in IMG/M |
| 3300022937|Ga0255770_10193576 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300023087|Ga0255774_10348495 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 687 | Open in IMG/M |
| 3300023087|Ga0255774_10459183 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 555 | Open in IMG/M |
| 3300023110|Ga0255743_10414303 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 661 | Open in IMG/M |
| 3300023116|Ga0255751_10085138 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
| 3300023180|Ga0255768_10321587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 857 | Open in IMG/M |
| 3300025071|Ga0207896_1003818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2815 | Open in IMG/M |
| 3300025086|Ga0208157_1007166 | All Organisms → Viruses | 3891 | Open in IMG/M |
| 3300025098|Ga0208434_1019103 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300025099|Ga0208669_1036642 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300025102|Ga0208666_1013826 | All Organisms → Viruses → Predicted Viral | 2696 | Open in IMG/M |
| 3300025102|Ga0208666_1036589 | Not Available | 1450 | Open in IMG/M |
| 3300025102|Ga0208666_1039992 | Not Available | 1366 | Open in IMG/M |
| 3300025108|Ga0208793_1091600 | Not Available | 863 | Open in IMG/M |
| 3300025120|Ga0209535_1032231 | Not Available | 2455 | Open in IMG/M |
| 3300025120|Ga0209535_1133332 | Not Available | 818 | Open in IMG/M |
| 3300025120|Ga0209535_1150713 | Not Available | 733 | Open in IMG/M |
| 3300025137|Ga0209336_10019216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 2469 | Open in IMG/M |
| 3300025138|Ga0209634_1069520 | Not Available | 1660 | Open in IMG/M |
| 3300025168|Ga0209337_1078831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1602 | Open in IMG/M |
| 3300025543|Ga0208303_1072968 | Not Available | 776 | Open in IMG/M |
| 3300025645|Ga0208643_1019866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2367 | Open in IMG/M |
| 3300025653|Ga0208428_1019934 | Not Available | 2219 | Open in IMG/M |
| 3300025671|Ga0208898_1079253 | Not Available | 1062 | Open in IMG/M |
| 3300025674|Ga0208162_1091762 | Not Available | 919 | Open in IMG/M |
| 3300025759|Ga0208899_1123696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 926 | Open in IMG/M |
| 3300025818|Ga0208542_1092395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 880 | Open in IMG/M |
| 3300025828|Ga0208547_1019719 | All Organisms → Viruses → Predicted Viral | 2753 | Open in IMG/M |
| 3300025887|Ga0208544_10413743 | Not Available | 501 | Open in IMG/M |
| 3300025889|Ga0208644_1018085 | All Organisms → Viruses → Predicted Viral | 4526 | Open in IMG/M |
| 3300028599|Ga0265309_10917355 | Not Available | 602 | Open in IMG/M |
| 3300029448|Ga0183755_1006819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 5020 | Open in IMG/M |
| 3300029448|Ga0183755_1013425 | All Organisms → Viruses → Predicted Viral | 3052 | Open in IMG/M |
| 3300032073|Ga0315315_10088198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2882 | Open in IMG/M |
| 3300034375|Ga0348336_023783 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3073 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.56% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.66% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 21.09% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.28% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.34% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.34% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.56% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.78% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.78% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_100403231 | 3300001450 | Marine | KRLEQIGEIEELYRAQGEIRTLRSMLRLRDDING* |
| JGI24003J15210_100542271 | 3300001460 | Marine | KTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDINN* |
| JGI24003J15210_100840912 | 3300001460 | Marine | AKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING* |
| JGI24004J15324_100078301 | 3300001472 | Marine | IAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING* |
| JGI24005J15628_100435001 | 3300001589 | Marine | NRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING* |
| JGI24513J20088_10210491 | 3300001720 | Marine | RIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDINN* |
| JGI25132J35274_10182601 | 3300002483 | Marine | VNRIDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLREDING* |
| Ga0075474_101073272 | 3300006025 | Aqueous | DKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0098038_10423781 | 3300006735 | Marine | IDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0098038_10665681 | 3300006735 | Marine | NPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0098038_11682132 | 3300006735 | Marine | EEIVSRINKVHKRLEQISEVEEMYRAQGEIRTLRAMLRLRDDING* |
| Ga0098037_11410342 | 3300006737 | Marine | LYNPFLEEIVSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGN* |
| Ga0098037_11684561 | 3300006737 | Marine | HRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGN* |
| Ga0098037_11962641 | 3300006737 | Marine | KRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0098037_12645912 | 3300006737 | Marine | PELYNPFLEEVVSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRAMLRLRDDINGT* |
| Ga0098048_10609981 | 3300006752 | Marine | IDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0070749_100305961 | 3300006802 | Aqueous | RIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG* |
| Ga0070749_100361641 | 3300006802 | Aqueous | IDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0070749_107387581 | 3300006802 | Aqueous | YNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0070750_101713532 | 3300006916 | Aqueous | PELYNPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0070746_100136173 | 3300006919 | Aqueous | EEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG* |
| Ga0070746_100237921 | 3300006919 | Aqueous | KRLEQINDVEELYRAQGEVRILRSLLLLREHVNG* |
| Ga0070746_103139621 | 3300006919 | Aqueous | PEMYNPFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG* |
| Ga0070748_10809591 | 3300006920 | Aqueous | NPFLEEIANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDINGS* |
| Ga0075468_100862232 | 3300007229 | Aqueous | ELYNPFLEEIANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDINGS* |
| Ga0075460_100708001 | 3300007234 | Aqueous | ELYNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0075460_102003052 | 3300007234 | Aqueous | IMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0070747_10996611 | 3300007276 | Aqueous | THKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING* |
| Ga0070752_10345912 | 3300007345 | Aqueous | IDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG* |
| Ga0070752_12480922 | 3300007345 | Aqueous | PELYNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0099847_10669221 | 3300007540 | Aqueous | EKTHKRLEQISEVEELYRAQGEIRVLRAMLRLREDING* |
| Ga0099847_11167742 | 3300007540 | Aqueous | NPELYNPFMEEITKRIEKTHRRLEQISEVEELYRAQGEIRTLRSMLRLRDDINGSS* |
| Ga0115566_103517502 | 3300009071 | Pelagic Marine | VHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0118687_100324751 | 3300009124 | Sediment | HKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0114932_102159801 | 3300009481 | Deep Subsurface | RIDKVHKRLEQISEVEELYRAQGEIRVLRAMLRLREDING* |
| Ga0114906_10683991 | 3300009605 | Deep Ocean | ELYNPFLEEIANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING* |
| Ga0114906_11270831 | 3300009605 | Deep Ocean | PFLEEIANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDINGS* |
| Ga0098043_11637891 | 3300010148 | Marine | HKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGN* |
| Ga0129348_12387191 | 3300010296 | Freshwater To Marine Saline Gradient | KRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0129351_10413812 | 3300010300 | Freshwater To Marine Saline Gradient | EEIGIRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG* |
| Ga0114934_103977041 | 3300011013 | Deep Subsurface | ELYNPFLEEIVSRIEKAHKRLEQISEVEELYRAQGEIRVLRAMLRLREDING* |
| Ga0160423_102226622 | 3300012920 | Surface Seawater | VSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRAMLRLREDINGS* |
| Ga0160423_103566491 | 3300012920 | Surface Seawater | SRIDKVHKRLEQLNDIEEVYRAQGEIRMLRAMLRLRDDING* |
| Ga0160423_106790512 | 3300012920 | Surface Seawater | KRLEQLNDIEEVYRAQGEIRMLRAMLRLRDDINGT* |
| Ga0163111_100305642 | 3300012954 | Surface Seawater | EIVSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0163111_113533751 | 3300012954 | Surface Seawater | EIVSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGN* |
| Ga0129327_100241812 | 3300013010 | Freshwater To Marine Saline Gradient | LYNPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING* |
| Ga0181369_10067662 | 3300017708 | Marine | RIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181369_10142342 | 3300017708 | Marine | EIQSRIDKVHRRLEQLNDIEEVYRAQGDIRMLRSMLRLRDDINGXVS |
| Ga0181369_10379662 | 3300017708 | Marine | RIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGS |
| Ga0181391_10819791 | 3300017713 | Seawater | RRLEQISDVEEMYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0181412_10154741 | 3300017714 | Seawater | KVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181373_11005762 | 3300017721 | Marine | HRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGS |
| Ga0181396_10392812 | 3300017729 | Seawater | PFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRAMLRLRDDINGS |
| Ga0181400_11782961 | 3300017752 | Seawater | SRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181407_10110731 | 3300017753 | Seawater | NPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181411_11177812 | 3300017755 | Seawater | MEEITKRIERVHRRLEQISDVEEMYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0181408_11603192 | 3300017760 | Seawater | VLNRINNTQRRLEQIGDVEEMYRAQGEIRALRSMLRLREDVNG |
| Ga0181385_12071602 | 3300017764 | Seawater | RINKVHKRLEQISEVEEMYRAQGEIRTLRAMLRLRDDINGS |
| Ga0181413_10245411 | 3300017765 | Seawater | NPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRTLRSMLRLRDDINGS |
| Ga0187217_10178651 | 3300017770 | Seawater | RRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGSS |
| Ga0187217_11610911 | 3300017770 | Seawater | NPELYKPCLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRAMLRLRDDINGS |
| Ga0181425_11737361 | 3300017771 | Seawater | FLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLREDING |
| Ga0181425_12432801 | 3300017771 | Seawater | QSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181425_12879322 | 3300017771 | Seawater | RVHRRLEQISDVEEMYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0181394_11226591 | 3300017776 | Seawater | DKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181395_12734021 | 3300017779 | Seawater | HRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0181380_10494031 | 3300017782 | Seawater | RIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING |
| Ga0181565_106732512 | 3300017818 | Salt Marsh | RIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181584_109056871 | 3300017949 | Salt Marsh | NPFLEEIFKRIENVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181577_109620212 | 3300017951 | Salt Marsh | EEIFKRIENVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181571_101007131 | 3300017957 | Salt Marsh | MYNPFLEEIMRRIDNVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHING |
| Ga0181571_105413262 | 3300017957 | Salt Marsh | DNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181582_106697152 | 3300017958 | Salt Marsh | EEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181581_102225991 | 3300017962 | Salt Marsh | NPFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181589_107893262 | 3300017964 | Salt Marsh | PFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181569_110424261 | 3300017986 | Salt Marsh | HKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181572_101879892 | 3300018049 | Salt Marsh | VHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181553_103246931 | 3300018416 | Salt Marsh | THKRLEQLNDIEEVYRAQGEIRMLRSMLRLREDING |
| Ga0181567_108698931 | 3300018418 | Salt Marsh | IDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181592_103736411 | 3300018421 | Salt Marsh | ITERINKVHKRLEQISDVEELYRAQGEIRALRSMLVLREHVNG |
| Ga0181592_109650011 | 3300018421 | Salt Marsh | SFLEEIGIRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181593_108064901 | 3300018423 | Salt Marsh | MNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181591_100647831 | 3300018424 | Salt Marsh | NVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0181566_103519952 | 3300018426 | Salt Marsh | NKVHKRLEQISDVEELYRAQGEIRALRSMLVLREHVNG |
| Ga0181568_106992571 | 3300018428 | Salt Marsh | HKRLEQITDVEELYRAQGEIRVLRSLLLLREHING |
| Ga0194022_10168051 | 3300019937 | Freshwater | NRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0181604_102402311 | 3300020191 | Salt Marsh | LYNPFLEEILTRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHING |
| Ga0181570_100902852 | 3300020207 | Salt Marsh | NPEMYNPFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0211678_101539622 | 3300020388 | Marine | IDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0213860_103076171 | 3300021368 | Seawater | EKTHKRLEQLNDIEEVYRAQGEIRMLRSMLRLREDING |
| Ga0196889_10092072 | 3300022072 | Aqueous | ITKRIEKTHRRLEQISEVEELYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0255781_102758732 | 3300022934 | Salt Marsh | PKMYNPFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0255770_101935761 | 3300022937 | Salt Marsh | IRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0255774_103484951 | 3300023087 | Salt Marsh | FLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0255774_104591831 | 3300023087 | Salt Marsh | HKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0255743_104143031 | 3300023110 | Salt Marsh | PELYNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0255751_100851382 | 3300023116 | Salt Marsh | EMYNPFLEEIMRRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0255768_103215871 | 3300023180 | Salt Marsh | KRIENVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0207896_10038182 | 3300025071 | Marine | AKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLRDDING |
| Ga0208157_10071663 | 3300025086 | Marine | VHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0208434_10191031 | 3300025098 | Marine | YNPFMEEITKRIDRVHRRLEQISDVEEMYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0208669_10366422 | 3300025099 | Marine | ELYNPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0208666_10138263 | 3300025102 | Marine | LEEIVSRINKVHKRLEQISEVEEMYRAQGEIRTLRAMLRLRDDINGS |
| Ga0208666_10365891 | 3300025102 | Marine | SRINKVHKRLEQISEVEEMYRAQGEIRTLRAMLRLRDDING |
| Ga0208666_10399921 | 3300025102 | Marine | IDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDINGXKLS |
| Ga0208793_10916002 | 3300025108 | Marine | EEIVSRIDKVHKRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0209535_10322312 | 3300025120 | Marine | NPFLEEIANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING |
| Ga0209535_11333322 | 3300025120 | Marine | EIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0209535_11507131 | 3300025120 | Marine | NLELYNPFLEEITERINKAHKRLEQINEIEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0209336_100192162 | 3300025137 | Marine | NRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING |
| Ga0209634_10695201 | 3300025138 | Marine | IANRIAKTHKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING |
| Ga0209337_10788311 | 3300025168 | Marine | THKRLEQIGEIEELYRAQGEIRTLRSMLRLREDING |
| Ga0208303_10729681 | 3300025543 | Aqueous | ELYNPFMEEITKRIEKTHRRLEQISEVEELYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0208643_10198661 | 3300025645 | Aqueous | FLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0208428_10199342 | 3300025653 | Aqueous | RIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0208898_10792532 | 3300025671 | Aqueous | LYNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0208162_10917622 | 3300025674 | Aqueous | HKRLEQISDVEELYRAQGEIRALRSMLVLREHVNG |
| Ga0208899_11236961 | 3300025759 | Aqueous | LEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0208542_10923952 | 3300025818 | Aqueous | ELYNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0208547_10197191 | 3300025828 | Aqueous | PFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| Ga0208544_104137432 | 3300025887 | Aqueous | LYNPFMEEITKRIEKTHRRLEQISEVEELYRAQGEIRTLRSMLRLRDDINGSS |
| Ga0208644_10180853 | 3300025889 | Aqueous | RRIDNVHKRLEQINDVEELYRAQGEVRILRSLLLLREHVNG |
| Ga0265309_109173551 | 3300028599 | Sediment | EEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0183755_10068191 | 3300029448 | Marine | LYNPFLEEIQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0183755_10134251 | 3300029448 | Marine | NPELYNPFLEEIVSRIEKAHKRLEQISEVEELYRAQGEIRVLRAMLRLREDING |
| Ga0315315_100881981 | 3300032073 | Seawater | IQSRIDKVHRRLEQLNDIEEVYRAQGEIRMLRSMLRLRDDING |
| Ga0348336_023783_1_153 | 3300034375 | Aqueous | YNPFLEEIMNRIDKVHKRLEQITDVEELYRAQGEIRVLRSLLLLREHVNG |
| ⦗Top⦘ |