


| Basic Information | |
|---|---|
| Family ID | F065089 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTRKIAYWASTAIVAVALLGALTYLTGSEQVVSGFAKAGYPQ |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.28 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 91.41 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.062 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.844 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 8.59 |
| PF08327 | AHSA1 | 7.03 |
| PF13493 | DUF4118 | 3.12 |
| PF04367 | DUF502 | 2.34 |
| PF01638 | HxlR | 2.34 |
| PF12704 | MacB_PCD | 2.34 |
| PF00903 | Glyoxalase | 1.56 |
| PF00528 | BPD_transp_1 | 1.56 |
| PF04794 | YdjC | 1.56 |
| PF04909 | Amidohydro_2 | 1.56 |
| PF07676 | PD40 | 1.56 |
| PF12840 | HTH_20 | 1.56 |
| PF08241 | Methyltransf_11 | 1.56 |
| PF13809 | Tubulin_2 | 1.56 |
| PF06439 | 3keto-disac_hyd | 1.56 |
| PF13191 | AAA_16 | 0.78 |
| PF00106 | adh_short | 0.78 |
| PF13564 | DoxX_2 | 0.78 |
| PF03795 | YCII | 0.78 |
| PF03551 | PadR | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| PF12680 | SnoaL_2 | 0.78 |
| PF13792 | Obsolete Pfam Family | 0.78 |
| PF11578 | DUF3237 | 0.78 |
| PF03702 | AnmK | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF07681 | DoxX | 0.78 |
| PF03572 | Peptidase_S41 | 0.78 |
| PF12833 | HTH_18 | 0.78 |
| PF13620 | CarboxypepD_reg | 0.78 |
| PF09722 | Xre_MbcA_ParS_C | 0.78 |
| PF13360 | PQQ_2 | 0.78 |
| PF14559 | TPR_19 | 0.78 |
| PF05163 | DinB | 0.78 |
| PF08450 | SGL | 0.78 |
| PF13517 | FG-GAP_3 | 0.78 |
| PF05974 | DUF892 | 0.78 |
| PF13664 | DUF4149 | 0.78 |
| PF01400 | Astacin | 0.78 |
| PF08681 | DUF1778 | 0.78 |
| PF00498 | FHA | 0.78 |
| PF14534 | DUF4440 | 0.78 |
| PF04250 | DUF429 | 0.78 |
| PF13520 | AA_permease_2 | 0.78 |
| PF13703 | Obsolete Pfam Family | 0.78 |
| PF04893 | Yip1 | 0.78 |
| PF00069 | Pkinase | 0.78 |
| PF08240 | ADH_N | 0.78 |
| PF00291 | PALP | 0.78 |
| PF00857 | Isochorismatase | 0.78 |
| PF08447 | PAS_3 | 0.78 |
| PF13946 | DUF4214 | 0.78 |
| PF14224 | DUF4331 | 0.78 |
| PF07040 | DUF1326 | 0.78 |
| PF00924 | MS_channel | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.12 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.12 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 2.34 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 1.56 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.78 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.78 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.78 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.78 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.78 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.78 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.78 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.06 % |
| Unclassified | root | N/A | 10.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig87370 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 2170459017|G14TP7Y01BJ9SS | Not Available | 639 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2001781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
| 3300000443|F12B_10958397 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300000550|F24TB_10019121 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300000550|F24TB_13904359 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300000787|JGI11643J11755_11226198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 571 | Open in IMG/M |
| 3300000891|JGI10214J12806_13008975 | Not Available | 733 | Open in IMG/M |
| 3300000955|JGI1027J12803_105618334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300000955|JGI1027J12803_106149149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2830 | Open in IMG/M |
| 3300000956|JGI10216J12902_102395098 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100307410 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300003267|soilL1_10031857 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300004114|Ga0062593_101398510 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300004156|Ga0062589_102501377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300004480|Ga0062592_101189864 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005175|Ga0066673_10367172 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005176|Ga0066679_10688377 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005293|Ga0065715_10443729 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005439|Ga0070711_101406619 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005451|Ga0066681_10671834 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005454|Ga0066687_10029489 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300005539|Ga0068853_100975943 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005549|Ga0070704_101952295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300005563|Ga0068855_102546459 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005575|Ga0066702_10410924 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005598|Ga0066706_11335217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300005614|Ga0068856_100653156 | Not Available | 1072 | Open in IMG/M |
| 3300005843|Ga0068860_101673889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300006169|Ga0082029_1510926 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300006169|Ga0082029_1715993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300006791|Ga0066653_10357682 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006796|Ga0066665_10470869 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300006845|Ga0075421_101650237 | Not Available | 695 | Open in IMG/M |
| 3300006845|Ga0075421_102509166 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006846|Ga0075430_101556587 | Not Available | 543 | Open in IMG/M |
| 3300006847|Ga0075431_100673341 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006847|Ga0075431_101974506 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006854|Ga0075425_101540295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 750 | Open in IMG/M |
| 3300006854|Ga0075425_101829638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300006914|Ga0075436_100138732 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300006918|Ga0079216_11197694 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300007076|Ga0075435_100933941 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300007076|Ga0075435_101443825 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300007076|Ga0075435_101570204 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300009012|Ga0066710_104684155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300009093|Ga0105240_12541393 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009094|Ga0111539_11643696 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009137|Ga0066709_100765705 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300009137|Ga0066709_104258605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
| 3300009147|Ga0114129_11603194 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300009156|Ga0111538_10540055 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300009156|Ga0111538_11481661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300010038|Ga0126315_10955581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010040|Ga0126308_10727804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010303|Ga0134082_10441186 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010359|Ga0126376_12804214 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010400|Ga0134122_10119052 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300011439|Ga0137432_1024991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1737 | Open in IMG/M |
| 3300012004|Ga0120134_1014231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1236 | Open in IMG/M |
| 3300012208|Ga0137376_10601959 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012211|Ga0137377_11946767 | Not Available | 504 | Open in IMG/M |
| 3300012360|Ga0137375_10475947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300012960|Ga0164301_10873713 | Not Available | 695 | Open in IMG/M |
| 3300012986|Ga0164304_10005600 | All Organisms → cellular organisms → Bacteria | 5102 | Open in IMG/M |
| 3300013308|Ga0157375_12486025 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300014054|Ga0120135_1005662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1264 | Open in IMG/M |
| 3300015164|Ga0167652_1081771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300015199|Ga0167647_1007776 | All Organisms → cellular organisms → Bacteria | 3446 | Open in IMG/M |
| 3300015371|Ga0132258_11630450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
| 3300015374|Ga0132255_102793741 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300015374|Ga0132255_103862697 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300017654|Ga0134069_1197221 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300018052|Ga0184638_1324396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300018075|Ga0184632_10465489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300018076|Ga0184609_10587965 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300018469|Ga0190270_10357468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300018482|Ga0066669_10931902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 780 | Open in IMG/M |
| 3300019883|Ga0193725_1087870 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300021344|Ga0193719_10301884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
| 3300021363|Ga0193699_10006402 | All Organisms → cellular organisms → Bacteria | 4247 | Open in IMG/M |
| 3300021363|Ga0193699_10367324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300022756|Ga0222622_11374485 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300024049|Ga0233359_1044744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300025796|Ga0210113_1023632 | Not Available | 1262 | Open in IMG/M |
| 3300025901|Ga0207688_10167696 | Not Available | 1304 | Open in IMG/M |
| 3300025904|Ga0207647_10662894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300025917|Ga0207660_11493715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300025921|Ga0207652_10442781 | Not Available | 1171 | Open in IMG/M |
| 3300025924|Ga0207694_11420874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300025930|Ga0207701_10466906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300025936|Ga0207670_10992856 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025941|Ga0207711_11487309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300025945|Ga0207679_10287973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1411 | Open in IMG/M |
| 3300025972|Ga0207668_10361346 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300025996|Ga0208777_1006175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300026023|Ga0207677_12074769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300026088|Ga0207641_10092207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2653 | Open in IMG/M |
| 3300026312|Ga0209153_1231033 | Not Available | 609 | Open in IMG/M |
| 3300026322|Ga0209687_1205413 | Not Available | 608 | Open in IMG/M |
| 3300026508|Ga0257161_1057261 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027324|Ga0209845_1032233 | Not Available | 842 | Open in IMG/M |
| 3300027727|Ga0209328_10134614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300028380|Ga0268265_10683125 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300028536|Ga0137415_11013302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300028811|Ga0307292_10395134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300028814|Ga0307302_10173129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1050 | Open in IMG/M |
| 3300028814|Ga0307302_10209488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 952 | Open in IMG/M |
| 3300028889|Ga0247827_10217869 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031229|Ga0299913_11541185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
| 3300031538|Ga0310888_10506252 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031562|Ga0310886_10759280 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031854|Ga0310904_11439287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300031901|Ga0307406_10398308 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031911|Ga0307412_11337243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300031944|Ga0310884_10138213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300031995|Ga0307409_101551301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300032000|Ga0310903_10223196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300032005|Ga0307411_11501443 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300032012|Ga0310902_10883948 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032017|Ga0310899_10024289 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300032179|Ga0310889_10489688 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300033407|Ga0214472_11349982 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300033412|Ga0310810_10746196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300033475|Ga0310811_10086520 | All Organisms → cellular organisms → Bacteria | 4099 | Open in IMG/M |
| 3300033811|Ga0364924_163985 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300034819|Ga0373958_0156210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.56% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_05104340 | 2124908045 | Soil | MARKIVYWGSTTIVCLMLLFALMYLTGTEQVVSGFAKAGYPQHLRI |
| 4ZMR_01785390 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MIRKIAYWSSTALVAASLLMALTYLTGSEQVVSGFT |
| ICChiseqgaiiDRAFT_20017813 | 3300000033 | Soil | MVRKVAYWIXTGIVSAGLLFSXIYLTGSEQVVSGFAKAG |
| F12B_109583972 | 3300000443 | Soil | MIPKVAYWGSTGIAALMLLAAASYLTGSEEVVSGFAKAGYPQ |
| F24TB_100191212 | 3300000550 | Soil | MVRTVAYWTTTAIAALALLGSLSYLTGSEQVVSGFTKAGY |
| F24TB_139043591 | 3300000550 | Soil | MALKITYWVSTILAAVMLGFALSYLTGNEQVVTGFNHLGYPQHL |
| JGI11643J11755_112261981 | 3300000787 | Soil | MTRKIAYWCSTVIVALALLGSLSYLTGSEQVVSGFA |
| JGI10214J12806_130089751 | 3300000891 | Soil | MVRKIAYWGSTVLAAVSLLGALSYLIGNEQAIAGFAKAGYPQH |
| JGI1027J12803_1056183341 | 3300000955 | Soil | MTRNIAYWASTAIVAVMLLMALSYLTGSEQVVSGFAKAGYPQ |
| JGI1027J12803_1061491492 | 3300000955 | Soil | MARTIAYWATTAIVALALLGSLSYLTGNEQVVSGFAKAG |
| JGI10216J12902_1023950984 | 3300000956 | Soil | MPRTITSWASTGIVSVMLLMALSYLTGNEQVVAGF |
| JGIcombinedJ26739_1003074103 | 3300002245 | Forest Soil | MARKVAYWTSTALVSAALLMAVTYLSGSEQVVSGFA |
| soilL1_100318571 | 3300003267 | Sugarcane Root And Bulk Soil | VPRTIGYWITTAILALALLGSLTYLTGSEEVVSGFAKAGYP |
| Ga0062593_1013985101 | 3300004114 | Soil | MKGRKIAYWVATIIVGVGLLGALSYLTGNEQVVSGFAKAGYPQHLRIVLGLAKPAAAIV |
| Ga0062589_1025013772 | 3300004156 | Soil | MGRKIAYWGSTAIVGFALLGSLSYLTGNEQVVSGFAKAGYPQHLRIV |
| Ga0062592_1011898641 | 3300004480 | Soil | MKGRKIAYWVATIIVGVGLLGALSYLTGNEQVVSGFAKAGYPQHLRIVL |
| Ga0066673_103671722 | 3300005175 | Soil | MARKIAYWTSTVIVAVMLLFALSYLTGNPQVVSGFAKAGYPP |
| Ga0066679_106883772 | 3300005176 | Soil | MGRKIAYWTTTTIAGVMLLMSLTYLTGNEQVVSGFAKAGYPQHLRIVLG |
| Ga0065715_104437291 | 3300005293 | Miscanthus Rhizosphere | MPRTITYWASTGIVSVMLLLALSYLTGNEQVVSGFAKAGWPQLLRIVLGVAK |
| Ga0070711_1014066192 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRKIVYWSATALACLALLGSLSYLTGSQQVVEGFAKAGY |
| Ga0066681_106718342 | 3300005451 | Soil | MARKIAYWTSTAIACLALFGSLTYLTGSQEVVAGFAKAGY |
| Ga0066687_100294891 | 3300005454 | Soil | MARKVAYWTSTVIACLALFGALTYLSGSAEVAAGFAKAGYPQHLRIVLGI |
| Ga0068853_1009759432 | 3300005539 | Corn Rhizosphere | MAQKVAYWISTGLASLALLGSLTYLTGSEEVVAGFTKAGYPQHLR |
| Ga0070704_1019522951 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MARKIAYWGSTAITCLGLIAALTYLTGNEQVVSGFVKAGYPQHLRIALG |
| Ga0068855_1025464592 | 3300005563 | Corn Rhizosphere | MGRKIAYWVSTVIACLALFGSLTYLSGSEQVVEGFAKA |
| Ga0066702_104109242 | 3300005575 | Soil | MARKVAYWTSTVIACLALFGALTYLSGSAEVAAGFAKAGYPQHLRIVLGIAKPI |
| Ga0066706_113352172 | 3300005598 | Soil | MAPKIAYWTSTVIACLALFASLTYLTGSEQVVAGFAKAG |
| Ga0068856_1006531563 | 3300005614 | Corn Rhizosphere | MGRKIAYWVSTAIVGVMLLMALSYLTGNEQVVSGFVKSGYP |
| Ga0068860_1016738893 | 3300005843 | Switchgrass Rhizosphere | MGRKIAYWVSTAIVGVMLLMALSYLTGNEQVVSGFVKSGYPQHLRIVL |
| Ga0082029_15109261 | 3300006169 | Termite Nest | MRGKIAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGYPQHLGIVLGLAKPAAAIV |
| Ga0082029_17159931 | 3300006169 | Termite Nest | MMGRKIAYWVSTVIVGVGLLGALSYLTGNEQVVSGFAKAGYPQHL |
| Ga0066653_103576822 | 3300006791 | Soil | MARKIAYWTSTVIVAVMLLFALSYLTGNPQVVSGFAKAGYPPHL |
| Ga0066665_104708692 | 3300006796 | Soil | MARKIAYWTSTVIVAVMLLFALSYLTGNPQVVSGFA |
| Ga0075421_1016502372 | 3300006845 | Populus Rhizosphere | MARKIAFWTSTGIVAVMLLFALSYLTGSQQVVEGFTKA |
| Ga0075421_1025091661 | 3300006845 | Populus Rhizosphere | MVRTVAYWGSTAIVGAMLLLALSYLTGNEQVVTGFTKAGYPQHLRIVLG |
| Ga0075430_1015565871 | 3300006846 | Populus Rhizosphere | MRRTIAYWSTTAIVALMLLGSLSYLTGNEQVVSGFA |
| Ga0075431_1006733413 | 3300006847 | Populus Rhizosphere | MARTVAYWTTTAIAALMLLFSLSYLTGNEQVVNGFAKAGYPQHLRIVLG |
| Ga0075431_1019745061 | 3300006847 | Populus Rhizosphere | MVRTVAYWGSTAIVGAMLLLALSYLTGNEQVVTGFTKAGYPQHLRIVLGIVKP |
| Ga0075425_1015402951 | 3300006854 | Populus Rhizosphere | MARKIAYWGSTAIVAVSLLDALTYLTGNEQVVSGF |
| Ga0075425_1018296382 | 3300006854 | Populus Rhizosphere | VNRYVYWVTTSIVGLALLGSLSYLTGSEQVVTGFTKAGY |
| Ga0075436_1001387321 | 3300006914 | Populus Rhizosphere | MGRKIAYWVSTVIACLALFGSLTYLSGSEQVVEGFAKAGYPQHLRI |
| Ga0079216_111976941 | 3300006918 | Agricultural Soil | MGRKIAYWGSTVLAGLALLGSLSYLTGNEQVVTGFTKAGYPQLLRIVLGLAKPAAAIV |
| Ga0075435_1009339412 | 3300007076 | Populus Rhizosphere | MTRKIAYWSSTAIVAVALLGALTYLTGSEQVVSGFAKAGYPQH |
| Ga0075435_1014438252 | 3300007076 | Populus Rhizosphere | MGRKIAYWVSTVIACLALFGSLTYLSGSEQVVEGFAKAG |
| Ga0075435_1015702041 | 3300007076 | Populus Rhizosphere | MVRKIAYWSSTALVATMLLLALSYLTGNQQVVSGFARSGYPQH |
| Ga0066710_1046841551 | 3300009012 | Grasslands Soil | MARKIAYWTSTVVACLALFGSLTYLTGSAEVVAGFAKAGYPQHLRIV |
| Ga0105240_125413932 | 3300009093 | Corn Rhizosphere | MPRRIAYWTTTAIVSVMLLGSLSYLTGDEQVVTGFTKAGYPQHLRIVLGIAKP |
| Ga0111539_116436962 | 3300009094 | Populus Rhizosphere | VTRKIAYWCSTVIVALALLGSLSYLTGSEQVVSGF |
| Ga0066709_1007657051 | 3300009137 | Grasslands Soil | QPLHSGGYMVRKIVYWTSTVIVAVMLLFALSYLTGNPQVVSGFTKAG* |
| Ga0066709_1042586052 | 3300009137 | Grasslands Soil | MIQSSRREFMARKIAYWTSTALACLALFGSLTYLTGSAEVVAGFAKAGYPQHLRIVL |
| Ga0114129_116031941 | 3300009147 | Populus Rhizosphere | MARRVVYWGTTGLVALALLGSLSYLTGNEAVVAGFAKAGYPQHL |
| Ga0111538_105400551 | 3300009156 | Populus Rhizosphere | MKGRKIAYWVATIIVGVGLLGALSYLTGNEQVVSGFA |
| Ga0111538_114816612 | 3300009156 | Populus Rhizosphere | MGRRKIAYWGTTALAGVALLGALSYLTGNEQVVSGFAKAGYPQHLRIVLG |
| Ga0126315_109555811 | 3300010038 | Serpentine Soil | MARRIAYWGSTALTGLGLIAALGYLTGNAEVVSGFTRAG |
| Ga0126308_107278043 | 3300010040 | Serpentine Soil | MVQKTAYWGSTAIVAVMLLMALSYLTGNEQVVTGFAKA |
| Ga0134082_104411861 | 3300010303 | Grasslands Soil | MARKIAYWSSTVIACLALFGSLSYLSGSAEVVSGFAKAGYPQHL |
| Ga0126376_128042141 | 3300010359 | Tropical Forest Soil | MKMAGKIGFWASTGIVAATLLFALSYLTGNPQVVEGFTKAGYPQHLRIVLGILK |
| Ga0134122_101190523 | 3300010400 | Terrestrial Soil | MGRKIAYWVSTAIVGVMLLMALSYLTGNEQVVSGFVK |
| Ga0137432_10249914 | 3300011439 | Soil | MARKVVYWGSTAIVSLMLLMSLSYLTGSEQVVSGF |
| Ga0120134_10142311 | 3300012004 | Permafrost | LNPRRIVYWGSTSLVALSLLMALTYLSGSEQVVAGFAKAGYPQ |
| Ga0137376_106019591 | 3300012208 | Vadose Zone Soil | MARKIAYWGSTALLCLALFGALSYLTGSEQVVAGF |
| Ga0137377_119467671 | 3300012211 | Vadose Zone Soil | MARKIAYWGSTAIACLALLASVTYLSGNEQVVSGFAKAGYPQHL |
| Ga0137375_104759471 | 3300012360 | Vadose Zone Soil | MARKIAYWTSTVIAAAMLSFALTYLTGNPTVVEGFNHLGYPQHLRL |
| Ga0164301_108737132 | 3300012960 | Soil | MEGKKIVYWGSTALACLALFGSLTFLTGSQQVVEGFAKA |
| Ga0164304_100056005 | 3300012986 | Soil | MTRNIAYWASTAIVAVALLGALTYLTGSEQVVSGFAKAGYPQH |
| Ga0157375_124860252 | 3300013308 | Miscanthus Rhizosphere | MPRTITYWASTGIVSVMLLLALSYLTGNEQVVSGFAKAGWPQLLRIVLG |
| Ga0120135_10056621 | 3300014054 | Permafrost | LNPRKIVYWGSTSLVALSLLMALTYLSGSEQVVAGFAKAGYPQHLRIVLGIVKP |
| Ga0167652_10817711 | 3300015164 | Glacier Forefield Soil | MVKRIAYWSSTAIAAASLLMAVTYLSGSEQVVSGFAKAGYPQHLR |
| Ga0167647_10077765 | 3300015199 | Glacier Forefield Soil | MVKRIAYWSSTAIAAASLLMAVTYLSGSEQVVSGFAKAG |
| Ga0132258_116304501 | 3300015371 | Arabidopsis Rhizosphere | MGRTVAYWSTTVIVSFALLGSLSYLTGNEQVVSGFAKAGYPQHLRIVLGFAKPA |
| Ga0132255_1027937411 | 3300015374 | Arabidopsis Rhizosphere | VSRKIGYWVSTAILALALLGSLTYLTGSEQVVSGFAKAGYPQHL |
| Ga0132255_1038626972 | 3300015374 | Arabidopsis Rhizosphere | VSRTIGHRRIGYWISTGLLALALLGSLSYLTGSEQ |
| Ga0134069_11972212 | 3300017654 | Grasslands Soil | MARKIAYWTSTVIVAVMLLFALSYLTGNPQVVSGFAKAGYPPHLRIV |
| Ga0184638_13243962 | 3300018052 | Groundwater Sediment | MVRKVAYWISTVIVSVMLLFALIYLAGSEQVVSGFAKTGYP |
| Ga0184618_104049302 | 3300018071 | Groundwater Sediment | MVRKIAYWASTIIAAVMLGFALSYLTGSPQVVAGFDHLG |
| Ga0184632_104654892 | 3300018075 | Groundwater Sediment | MARKIAYWISTAIGCLALFGSLTYLTGSEEVVAGFAKAGY |
| Ga0184609_105879651 | 3300018076 | Groundwater Sediment | MVRKIAYWSSTTIVAVMLLFALIYLSGNEQVVSGFAKAGYPQHL |
| Ga0190270_103574682 | 3300018469 | Soil | MGRRIAYWGTTAIVGFALLGSLSYLTGNEQVVSGFAK |
| Ga0066669_109319023 | 3300018482 | Grasslands Soil | MARKIIYWTSTALACLALLGSLTYLTGSQEVVAGFAKAGY |
| Ga0193725_10878702 | 3300019883 | Soil | MVRRIAYWGSTALACLALLGSLSYLTGSEQVVAGFAKAGYP |
| Ga0193719_103018841 | 3300021344 | Soil | MARKIAYWGPTALACLALLGSLTYLTGSEQVVSGFAK |
| Ga0193699_100064021 | 3300021363 | Soil | LNPRKIVYWGSTSLVALSLLMALTYLSGSEQVVSG |
| Ga0193699_103673241 | 3300021363 | Soil | LNPRKIVYWGSTSLVALSLLMALTYLSGSEQVVSGFAKA |
| Ga0222622_113744851 | 3300022756 | Groundwater Sediment | MALKIAYWASTVIAAVMLGFALSYLTGNEQVVTGFTHLGYPQHLR |
| Ga0233359_10447441 | 3300024049 | Soil | MVRKIAYWSTTAIAAASLLAAVTYLSGSEQVVSGFAKAGYPQHLRI |
| Ga0210113_10236322 | 3300025796 | Natural And Restored Wetlands | MTRRIAYWCSTVIVALALLGSLSYLTGSEQVVSGFARSGYPQHL |
| Ga0207688_101676961 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGRKIAYWVATIIVGVGLLGALSYLTGNEQVVSGFAK |
| Ga0207647_106628942 | 3300025904 | Corn Rhizosphere | MKGRKIAYWVATIIVGVGLLGALSYLTGNEQVVSGFAKAGYPQHLRIVLGL |
| Ga0207660_114937151 | 3300025917 | Corn Rhizosphere | LNSRTIVYWGSTSLVALSLLMALTYLTSSEQVVSGFAK |
| Ga0207652_104427811 | 3300025921 | Corn Rhizosphere | MARKVVYWVSTSLVCLALFGSLSYLTGSAQVVEGFAKA |
| Ga0207694_114208742 | 3300025924 | Corn Rhizosphere | MGRKIAYWVSTAIVGVMLLMALSYLTGNEQVVSGFVKSGYPQHLRIVLGIAKPAA |
| Ga0207701_104669062 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKKVAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGY |
| Ga0207670_109928561 | 3300025936 | Switchgrass Rhizosphere | VARKLAYWISTALVAVALLGSLTYLTGSEQVVSGFAKAGYPQHLRIVLG |
| Ga0207711_114873091 | 3300025941 | Switchgrass Rhizosphere | MGRKIAYWVSTAIVGVMLLMALSYLTGNEQVVSGFVKSGYPQHLRIVLGIAKP |
| Ga0207679_102879731 | 3300025945 | Corn Rhizosphere | MAQKIVYWSSTVIACLALLGSLSYLTGSEEVVAGFAKA |
| Ga0207668_103613463 | 3300025972 | Switchgrass Rhizosphere | MPRRIAYWTTTAIVSVMLLGSLSYLTGNEQVVTGFTKAGYPQ |
| Ga0208777_10061751 | 3300025996 | Rice Paddy Soil | MARKIVYWSSTAIACLALLGSLTYLTGSREVVEGFAKAGYPQHLRIVLGIA |
| Ga0207677_120747692 | 3300026023 | Miscanthus Rhizosphere | MGKKVAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGYPQHLRIVLGLAKP |
| Ga0207641_100922071 | 3300026088 | Switchgrass Rhizosphere | MTQKIAYWTSTAIVAVMLLMALSYLTGSEQVVSGFAK |
| Ga0209153_12310332 | 3300026312 | Soil | MVQKIAYWVSTVIVCLALFGSLTYLTGSEQVVAGFA |
| Ga0209687_12054132 | 3300026322 | Soil | MARKVAYWTSTVIACLALFGALTYLSGSAEVAAGFAK |
| Ga0257161_10572612 | 3300026508 | Soil | MARKIAYWGSTGLACLALLGSLSYLTGSEQVVAGFTKA |
| Ga0209845_10322331 | 3300027324 | Groundwater Sand | MVRKIAYWSSTAIAAIALLLALSYLTGNEQVVSGFAKAGYPQHLRIVLGI |
| Ga0209328_101346141 | 3300027727 | Forest Soil | MARKVAYWTSTALVSAALLMAVTYLSGSEQVVSGFAKAGYPQHLRIVLG |
| Ga0268265_106831251 | 3300028380 | Switchgrass Rhizosphere | MPRRIAYWTTTAIVSVMLLGSLSYLTGNEQVVTGFTKAGYPQH |
| Ga0137415_110133021 | 3300028536 | Vadose Zone Soil | MARKTAYWISTALASLALLGALTYLTGSEQVVSGFAKVGYPQHLRI |
| Ga0307292_103951341 | 3300028811 | Soil | MARKIVYWGATALVSVALLGSLTYLTGSEQVVAGFTKAGYPQYLRIIL |
| Ga0307302_101731292 | 3300028814 | Soil | MVRKIAYWGPTALACLALLGSLTYLTGSDQVVSGFAKAGYPQHLRIVLGIAK |
| Ga0307302_102094881 | 3300028814 | Soil | MARKITYWTSTAIACLALFGSLTYLTGSEEVVAGFAKA |
| Ga0247827_102178693 | 3300028889 | Soil | MTRKIAYWCSTVIVALALLGSLSYLTGSEQVVSGFTRSGYP |
| Ga0299913_115411852 | 3300031229 | Soil | MARKVAYWISTVIVAVALLGSLTYLTGSEQVVSGFAKAGYP |
| Ga0310888_105062521 | 3300031538 | Soil | MGRKIAYWVSTVIVGVGLLGALSYLTGNEQVVSGFAKAGYPQHLR |
| Ga0310886_107592801 | 3300031562 | Soil | MPRTITYWASTGIVSVMLLMALSYLTGNEQVVAGFAKA |
| Ga0310904_114392871 | 3300031854 | Soil | MGQKVAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGY |
| Ga0307406_103983082 | 3300031901 | Rhizosphere | MGQKVAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGYPQH |
| Ga0307412_113372432 | 3300031911 | Rhizosphere | MLRKIAYWGSTAITGLGLIAALSYLTGNDQVVSGFVKAGY |
| Ga0310884_101382132 | 3300031944 | Soil | MGRKIAYWGSTAIVGFALLGSLSYLTGNEQVVSGFAKAGYP |
| Ga0307409_1015513011 | 3300031995 | Rhizosphere | MGQKVAYWGSTALVGVALLGALSYLTGNEQVVSGFAKAGYPQHL |
| Ga0310903_102231961 | 3300032000 | Soil | MGRKIAYWGSTAIVGFALLGSLSYLTGNEQVVSGFAKAGYPQHLRIVLGFAKPAAAI |
| Ga0307411_115014431 | 3300032005 | Rhizosphere | MGHKVAYWGSTALVGVALLGSLSYLTGNEQVVSGF |
| Ga0310902_108839482 | 3300032012 | Soil | MGRTIAYWSTTTLVALALLGSLSYLTGSEQVVSGFAKAGYPQH |
| Ga0310899_100242893 | 3300032017 | Soil | MGRKIAYWGSTAIVGFALLGSLSYLTGNEQVVSGFAKAGYPQHLRIVLG |
| Ga0310889_104896881 | 3300032179 | Soil | MGRTIAYWSTTTLVALALLGSLSYLTGSEQVVSGFAKAGYPQHLR |
| Ga0214472_113499822 | 3300033407 | Soil | TRTIVYWIATVIVALMLLTSLSDLTGSEQVVSGFEKAG |
| Ga0310810_107461961 | 3300033412 | Soil | MARKVAYWISTVIVGVMLGFALTYLTGSAQIVEGFKHLGYP |
| Ga0310811_100865201 | 3300033475 | Soil | MTRYLYWGSTALVALALLGSLSYLTGSVQVVSGFTM |
| Ga0364924_163985_3_116 | 3300033811 | Sediment | MARTIAYWTTTVIVAVMLLFALSYLTGNAQVVSGFANA |
| Ga0373958_0156210_447_572 | 3300034819 | Rhizosphere Soil | MTRKIAYWASTAIVAVALLGALTYLTGSEQVVSGFAKAGYPQ |
| ⦗Top⦘ |