


| Basic Information | |
|---|---|
| Family ID | F065019 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MAHPPPRALIKFLKPYDREIRDLALQLRALVLEEMAPCYENIYDAYS |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.48 % |
| % of genes near scaffold ends (potentially truncated) | 97.66 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.531 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.625 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01177 | Asp_Glu_race | 23.44 |
| PF00326 | Peptidase_S9 | 9.38 |
| PF13302 | Acetyltransf_3 | 5.47 |
| PF09471 | Peptidase_M64 | 5.47 |
| PF13091 | PLDc_2 | 3.12 |
| PF14015 | DUF4231 | 2.34 |
| PF01790 | LGT | 1.56 |
| PF03372 | Exo_endo_phos | 1.56 |
| PF01979 | Amidohydro_1 | 0.78 |
| PF02652 | Lactate_perm | 0.78 |
| PF02900 | LigB | 0.78 |
| PF04229 | GrpB | 0.78 |
| PF08818 | DUF1801 | 0.78 |
| PF13466 | STAS_2 | 0.78 |
| PF04191 | PEMT | 0.78 |
| PF14337 | Abi_alpha | 0.78 |
| PF07676 | PD40 | 0.78 |
| PF14534 | DUF4440 | 0.78 |
| PF02897 | Peptidase_S9_N | 0.78 |
| PF13242 | Hydrolase_like | 0.78 |
| PF08530 | PepX_C | 0.78 |
| PF16217 | M64_N | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.78 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.78 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.78 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.78 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.78 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.78 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.53 % |
| Unclassified | root | N/A | 5.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001432|JGI24034J14986_102596 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300004643|Ga0062591_102044972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 592 | Open in IMG/M |
| 3300004643|Ga0062591_102574567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300004808|Ga0062381_10108289 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005176|Ga0066679_11038171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300005177|Ga0066690_10428859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300005178|Ga0066688_10665731 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005187|Ga0066675_11397192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300005295|Ga0065707_10208970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300005336|Ga0070680_101296231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 630 | Open in IMG/M |
| 3300005338|Ga0068868_101117523 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005354|Ga0070675_101448600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300005440|Ga0070705_101202895 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005441|Ga0070700_100365327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300005445|Ga0070708_100194185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300005445|Ga0070708_100261241 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300005445|Ga0070708_101484322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300005451|Ga0066681_10160522 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300005459|Ga0068867_101660807 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 598 | Open in IMG/M |
| 3300005471|Ga0070698_102227795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 501 | Open in IMG/M |
| 3300005518|Ga0070699_100206626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300005526|Ga0073909_10130708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300005536|Ga0070697_101862116 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005546|Ga0070696_100042636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3136 | Open in IMG/M |
| 3300005546|Ga0070696_100874361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300005549|Ga0070704_100808043 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005549|Ga0070704_100867004 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005549|Ga0070704_100992503 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005549|Ga0070704_101439510 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005553|Ga0066695_10904817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005560|Ga0066670_10201378 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005574|Ga0066694_10280372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300005617|Ga0068859_101863470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 664 | Open in IMG/M |
| 3300005618|Ga0068864_101420750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300005618|Ga0068864_102430276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005719|Ga0068861_100613185 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005764|Ga0066903_101551577 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300005844|Ga0068862_101068102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300006032|Ga0066696_10734140 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006034|Ga0066656_10195294 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300006049|Ga0075417_10238565 | Not Available | 869 | Open in IMG/M |
| 3300006173|Ga0070716_101523939 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006358|Ga0068871_101434628 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006796|Ga0066665_10520306 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300006796|Ga0066665_10669006 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300006797|Ga0066659_10525260 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300006844|Ga0075428_100969590 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006852|Ga0075433_11951598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300007004|Ga0079218_13742345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300007258|Ga0099793_10323514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300009038|Ga0099829_11388810 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009038|Ga0099829_11502411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009088|Ga0099830_11506374 | Not Available | 560 | Open in IMG/M |
| 3300009088|Ga0099830_11584871 | Not Available | 546 | Open in IMG/M |
| 3300009089|Ga0099828_10410574 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300009089|Ga0099828_11800936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300009137|Ga0066709_103049313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300009147|Ga0114129_13358701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 516 | Open in IMG/M |
| 3300009553|Ga0105249_10487797 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300010047|Ga0126382_10700133 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300010301|Ga0134070_10247016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300010320|Ga0134109_10089214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300010358|Ga0126370_11757268 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010361|Ga0126378_10168633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2246 | Open in IMG/M |
| 3300010400|Ga0134122_10197089 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300010400|Ga0134122_12795440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300010400|Ga0134122_13026183 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010401|Ga0134121_10681324 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300010401|Ga0134121_12484789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 560 | Open in IMG/M |
| 3300010403|Ga0134123_12484323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300010403|Ga0134123_12765464 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012198|Ga0137364_10913505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012200|Ga0137382_11008032 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012201|Ga0137365_11185378 | Not Available | 547 | Open in IMG/M |
| 3300012206|Ga0137380_11344316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300012208|Ga0137376_11089146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012209|Ga0137379_10044426 | All Organisms → cellular organisms → Bacteria | 4287 | Open in IMG/M |
| 3300012210|Ga0137378_10639523 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 974 | Open in IMG/M |
| 3300012210|Ga0137378_11454119 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012226|Ga0137447_1071414 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012357|Ga0137384_11573171 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012358|Ga0137368_10987115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012361|Ga0137360_11626492 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012469|Ga0150984_112955747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300012532|Ga0137373_10126765 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300012532|Ga0137373_10464536 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012582|Ga0137358_10400920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300012917|Ga0137395_10712110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300012922|Ga0137394_11422954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012923|Ga0137359_10330199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300012930|Ga0137407_10865012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300012948|Ga0126375_11343753 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012976|Ga0134076_10251607 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300013297|Ga0157378_10035759 | All Organisms → cellular organisms → Bacteria | 4395 | Open in IMG/M |
| 3300013306|Ga0163162_10410927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
| 3300013308|Ga0157375_11459444 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300014166|Ga0134079_10630655 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014325|Ga0163163_10923774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300014326|Ga0157380_13519259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 502 | Open in IMG/M |
| 3300015078|Ga0167660_1037707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300015245|Ga0137409_10243619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
| 3300015371|Ga0132258_10728752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2497 | Open in IMG/M |
| 3300015372|Ga0132256_100740383 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300018061|Ga0184619_10042753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1951 | Open in IMG/M |
| 3300018083|Ga0184628_10431568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300020060|Ga0193717_1124915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300021082|Ga0210380_10150745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300023014|Ga0233358_105302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 601 | Open in IMG/M |
| 3300025910|Ga0207684_10977760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 709 | Open in IMG/M |
| 3300025922|Ga0207646_10976464 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300025922|Ga0207646_11070764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 710 | Open in IMG/M |
| 3300025931|Ga0207644_11435491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300025935|Ga0207709_11150727 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025960|Ga0207651_11006712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300026095|Ga0207676_11104000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300026300|Ga0209027_1319522 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026550|Ga0209474_10428665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300026551|Ga0209648_10677881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027654|Ga0209799_1148203 | Not Available | 534 | Open in IMG/M |
| 3300027691|Ga0209485_1025423 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300027875|Ga0209283_10572934 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300028792|Ga0307504_10066817 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300032003|Ga0310897_10616516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300032035|Ga0310911_10708583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300032205|Ga0307472_101291979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300032205|Ga0307472_101719328 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300023014 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P29 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24034J14986_1025962 | 3300001432 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYPPPRELLKFLKPYDKTTRDLALQLRALLLDEIAPCYENIYDAYSAVAIGYGTSEKL |
| Ga0062591_1020449722 | 3300004643 | Soil | MSKKPPAELVKFLKPYDRAIQKLALDLRLIVIDELAPCYENIYDAYSAVAIGYGS |
| Ga0062591_1025745672 | 3300004643 | Soil | MPKFSPPSALIKFLKPYDREVRELALQLRSLLLEEIAPCYENIYDAYSAVAIGYGTS |
| Ga0062381_101082891 | 3300004808 | Wetland Sediment | MAHRPPPELIKFLKPYDREIRDLALKLRALVLEEMAPCYENIYDAYSAVSIGYGTSDRLR |
| Ga0066679_110381712 | 3300005176 | Soil | MTHPAPADLIKFLRPYDPQVQELALKLRALVLEEMAPCYENIYDAYSAVAIGYGT |
| Ga0066690_104288591 | 3300005177 | Soil | MSQSTPAALIKFLKPYDGEIRDLALKLRALVLEEMAPCYENIYDAY |
| Ga0066688_106657312 | 3300005178 | Soil | LKYPPPTALIKFLKPYDREIQTLALKLRALMLEEMAPCYENI |
| Ga0066675_113971921 | 3300005187 | Soil | VKYSPPNALIKFLKPYDQEVRDAALKLRALVLEEMAPCFENIYDAYSAVAIGYGTS |
| Ga0065707_102089701 | 3300005295 | Switchgrass Rhizosphere | LPHYKPPASLIKFLKPYDRAIQKLALDLRALVLEEMAPCHENIYDAYSAV |
| Ga0070680_1012962311 | 3300005336 | Corn Rhizosphere | MKHKPPAELVEFLKPYDRKIQKLALDLRSIVVTEFGPCYENIYDAYSAVAM |
| Ga0068868_1011175231 | 3300005338 | Miscanthus Rhizosphere | VKYPPPRELLKFLKPYDKATRDLALQLRALLLDEMAPCYENIYDAYSAVAIGYGTS |
| Ga0070675_1014486002 | 3300005354 | Miscanthus Rhizosphere | MAYPPPSDLKKFLRVYDPEVQRLALKLRALVLEEMAPCYENIYDA |
| Ga0070705_1012028952 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRHPAPVALIKFLRPYDRAIQKLALDLRSLVLEEMAPCHENIYDAYSAVAIGYGPTDR |
| Ga0070700_1003653272 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VWLMMEYPPPADLKKFLRPYDRDVQKLALSLRALVLSEMAPCYENIYDAYSA |
| Ga0070708_1001941853 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYPPPAALKKFLKPYDPEIRDLALSLRALVLEEMAPCYENIYDAYSAVAIGY |
| Ga0070708_1002612413 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYSPPRELIKFLKPYDREIRDLALNLRALVLAETAPCYENIYDAYSAVAIGYG |
| Ga0070708_1014843221 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPAPADLIKFLRPYDPQVQELALKLRALVLEEMAPCYENIYDAYSAVA |
| Ga0066681_101605222 | 3300005451 | Soil | LKYPPPTALIKFLKPYDREVRDVALKLRALVLEEMAPCYEN |
| Ga0068867_1016608071 | 3300005459 | Miscanthus Rhizosphere | VKYPPPRELLKFLKPYDKATRDLALQLRALLLDEMAPCYENIYDAYS |
| Ga0070698_1022277952 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRYKPPAALIKFLKPYDREVQKLALDLRALVLEEMAPCHENIYDAYSAVA |
| Ga0070699_1002066262 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHPPPRALIKFLKPYDREIRDLALQLRALVLEEMAPCYENIYDAYS |
| Ga0073909_101307081 | 3300005526 | Surface Soil | MTAYPAPAALKKFLRPYDKDVRELALNLRALVLEEMAPCYENIYDAYSAVAIGYGTSER |
| Ga0070697_1018621162 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LKYPPPTALVKFLKPYDREIQTLALKLRALMLEEMAPCYENIYDAYSA |
| Ga0070696_1000426363 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRYKPPAALIKFLRPYDREVQKLALDLRALVLEEMAPCHENIYDAYSAV |
| Ga0070696_1008743612 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHRPPPALIKFLKPYDREIQDLALRLRALVLEEMAPCYE |
| Ga0070704_1008080431 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKSSPPSALIKFLKPYDPGVRDLALQLRDLLLEEIAPCYEN |
| Ga0070704_1008670041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VKHSVPRALIKFLKPYDPEIRDLALKLRALVLEEMEPCYENIYDAYSAVA |
| Ga0070704_1009925031 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRYPAPPELIKFLKPYERSVRDLALGLRLLVLEEMAPCYENIYD |
| Ga0070704_1014395101 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRRPPPDLIKFLKPYDRAVQQLALNLRSVVIEEMAPCHENI |
| Ga0066695_109048171 | 3300005553 | Soil | MAYSVPADLISFLKPYDSGIRQLALRLRVLLLEEMAPCYENIYD |
| Ga0066670_102013781 | 3300005560 | Soil | MSFPVPRQLTNFLKPYDPEIRNLAVKLRALVLEEMAPCYENIYDAYSAVAIG |
| Ga0066694_102803722 | 3300005574 | Soil | MAYSVPADLIRFLKPYDSGIRQLALRLRVLLLEEMAPCYENIYDAYSAVAIGYGTSE |
| Ga0068859_1018634701 | 3300005617 | Switchgrass Rhizosphere | MDMSSYPPPAELIRFLKPYDKAVRELALGLRRLVIEEMAPCYENIYDAYNA |
| Ga0068864_1014207501 | 3300005618 | Switchgrass Rhizosphere | MDYPPPADLKKFLRPYHREVQQLALGLRALVLAEMAPCYENIYDAYSAVAIGYGTSDRM |
| Ga0068864_1024302761 | 3300005618 | Switchgrass Rhizosphere | MPNKPPAELIKFLKPYERAIQKLALDLRLIVIDELAPCHENIYDAYSAVAIGYGSSD |
| Ga0068861_1006131851 | 3300005719 | Switchgrass Rhizosphere | MRRHPAPVALIKFLRPYDRAIQKLALDLRSLVLEEMAPCHENIYDAYSAVAIGYGPTD |
| Ga0066903_1015515773 | 3300005764 | Tropical Forest Soil | LNPPPAELIKFLKPYDPEIRDLALQLRALVLTEMAPCYENIYD |
| Ga0068862_1010681021 | 3300005844 | Switchgrass Rhizosphere | MNYPPPAALKKFLKPYDAEIRDLALQLRALVLEEMAPCYENIYDAYSAVA |
| Ga0066696_107341401 | 3300006032 | Soil | MKYPPPAALKKFLKPYAREVRDLALDLRALVLEEMAPCYENIYDAY |
| Ga0066656_101952942 | 3300006034 | Soil | MPVYSAPAALIKFLRPYKPEIRELALQLRALVLEEMAPCYENIYDAYSAVAI |
| Ga0075417_102385652 | 3300006049 | Populus Rhizosphere | VKYPVPSSLRRFLKPYDRTVRTLALQLRELLLDEIGPCYENIY |
| Ga0070716_1015239392 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYPPPRALLKFLKPYEKATRDLALQLRALLLEEMAPCYENIYDAYSAVAIGYGTSERLG |
| Ga0068871_1014346281 | 3300006358 | Miscanthus Rhizosphere | MEYPPPVDLKKFLRPYDREVQKLALNLRALLLEEMAPCYENIYDAYSAVAIGY |
| Ga0066665_105203061 | 3300006796 | Soil | MSLRPPRALLGFLKPYDRAIRDLALAVRAFVLQDMTPCYE |
| Ga0066665_106690061 | 3300006796 | Soil | LKYPPPTALIKFLKPYDREIQTLALKLRALMLEEMAPCYENIYDAY |
| Ga0066659_105252601 | 3300006797 | Soil | LKHQPPTALIKFLKPYDREIQSLALNLRALVLEEMAPCYEN |
| Ga0075428_1009695901 | 3300006844 | Populus Rhizosphere | MNYPPPAALKKFLKPYDAEIRDLALELRGLVLEEMAPCFENIYDAYSAVAIGYGTSD |
| Ga0075433_119515982 | 3300006852 | Populus Rhizosphere | VKHPPPRELLKFLKPYDAPVRELALQLRALLLEEMGPCYENIYDAYSAVAIGYG |
| Ga0079218_137423452 | 3300007004 | Agricultural Soil | MKRHPPPISLIEFLKPYDAAIRDLALSLRSLVLEEMAPCHENIYDAYSAVAI |
| Ga0099793_103235141 | 3300007258 | Vadose Zone Soil | MKRHSPPPALIKFLKPFDADVRDLALSLRSLVIDEMAPCYENIYDAYSAVAIG |
| Ga0099829_113888102 | 3300009038 | Vadose Zone Soil | VNHPPPRELIKFLKPYDPEVRDLALQLRALLLEEMAPCYENIYDAYSAVAIGYGTSDRL |
| Ga0099829_115024112 | 3300009038 | Vadose Zone Soil | LSKQSPPAALIKFLKPYDREIRELALQLRALVLEEMAPCY |
| Ga0099830_115063742 | 3300009088 | Vadose Zone Soil | MAHSPPPALIKFLKPYNREIRELALKLRALVLEEMAPCYENIYDAYSAVAIG |
| Ga0099830_115848711 | 3300009088 | Vadose Zone Soil | MPYPPPAALITFLKPYDREIQTLALQLRALVLGEMAPCYENIYDAYSAVAIGYG |
| Ga0099828_104105741 | 3300009089 | Vadose Zone Soil | MPHTPPAALIKFLKPYDREIRELALKVRALLLEEMAPCYENIYDAYGAVAI |
| Ga0099828_118009361 | 3300009089 | Vadose Zone Soil | MLTNKKHPPPKALLQLLKPYDRAIRKLALAVRSVVLAEMAPCHENIYDAYNAVSLGYGPTDRLRD |
| Ga0066709_1030493131 | 3300009137 | Grasslands Soil | MRRYAPPPDLIKFLRPYDRAIKKLALSLRVLVLEEMAPCYENIYDAYSAVAIG |
| Ga0114129_133587012 | 3300009147 | Populus Rhizosphere | MMPSKPPAELIKFLKPYDRAIQKLCLDLRKIVIAELAPCYENIYD |
| Ga0105249_104877971 | 3300009553 | Switchgrass Rhizosphere | MKHKPPAELVEFLKPYDRKIQKLALDLRSIVVTEFGPCYENIYDAYSAVAMG |
| Ga0126382_107001332 | 3300010047 | Tropical Forest Soil | MHPPPAVLKKFLEPFDPEVRDLALKLRCLVLEEMAPCYEN |
| Ga0134070_102470162 | 3300010301 | Grasslands Soil | VKYSPPNALIKFLKPYDQEVRDAALKLRALVLEEMAPCFENIYDAYSAVAIGYGTSDRLS |
| Ga0134109_100892142 | 3300010320 | Grasslands Soil | VNFSPPAALIKFLKPYDREVRDLALQLRALLLEEMALCYENI* |
| Ga0126370_117572682 | 3300010358 | Tropical Forest Soil | MRYPPPAPLIKFLKPYDPAVRDLALQLRQLVLEEMAPCYENIYDAYSAVA |
| Ga0126378_101686331 | 3300010361 | Tropical Forest Soil | MAHPCPADLKKFLRPYDRDVQQLALGLRALLLEEMAPCYRN |
| Ga0134122_101970892 | 3300010400 | Terrestrial Soil | MAARYKPPAALIKFLKPYDREVQKLALDLRALVLEEMAPCHENIYDAYSAVAIGYGPTDRVS |
| Ga0134122_127954402 | 3300010400 | Terrestrial Soil | MPRRYPPPPELVKFLQPYDRAIQKLALGLRALVLEEMAPCHENIYDAYSAVAIGYGP |
| Ga0134122_130261831 | 3300010400 | Terrestrial Soil | VKYPVPSALRTFLKPYDKSIRDLALQLRDVLLEEMAPCYENIYDAYSAVAIGYGTSERL |
| Ga0134121_106813242 | 3300010401 | Terrestrial Soil | VKYPPPRALLKFLKPYDKATRDLALQLRALLLEEMAPCYENIYD |
| Ga0134121_124847892 | 3300010401 | Terrestrial Soil | VKHPPPRELLKFLKPYDKTTRDLALGLRALLLDEIAPCYENIYDAYSAVAIGYGTSE |
| Ga0134123_124843232 | 3300010403 | Terrestrial Soil | MEYPPPADLKKFLRPYDREVQKLALNLRALLLEEMAPCYENIYDAYSAVAIGYGTSDR |
| Ga0134123_127654642 | 3300010403 | Terrestrial Soil | MKAAGLTRKHPVPRELVKFLKPYDRAIQDLALRLRELVLQEMAPCHENIYDAYSAV |
| Ga0137364_109135052 | 3300012198 | Vadose Zone Soil | MSIKPPKELLRFLEPYSRPIRELALGLRELVIDELAPCNENIY |
| Ga0137382_110080321 | 3300012200 | Vadose Zone Soil | MMKRKPPKELIAFLRPYGPTIRELALSLRELVIGEMAPCYENIY |
| Ga0137365_111853781 | 3300012201 | Vadose Zone Soil | LEYPAPKELIKFLKPYDREIRELALNLRALVLEEMAPCYENIYD |
| Ga0137380_113443161 | 3300012206 | Vadose Zone Soil | MKITYPPPAELKKFLTPYDREIQQLALSLRALILEEMAPCYENI |
| Ga0137376_110891461 | 3300012208 | Vadose Zone Soil | MSFPVPRQLTNFLKPYDPEIRSLAVKLRALVLDEMAPCYENI |
| Ga0137379_100444261 | 3300012209 | Vadose Zone Soil | MATSAPPALRKFLEPYDREVRDLALKLRALVIEEMAPCYENIYDAYSAVAIGY |
| Ga0137378_106395231 | 3300012210 | Vadose Zone Soil | RPYSLKYPTPTALIKFLKSYDQEVRDLALKLRALVLEEMAPCFENIYDA* |
| Ga0137378_114541191 | 3300012210 | Vadose Zone Soil | MATSAPPALRKFLEPYDREVRDLALKLRALVIEEMAPCYENIYDA |
| Ga0137447_10714142 | 3300012226 | Soil | MRRHPPPPALVKFLKPYDRAIQDLALKLRSLVLEEMAPCYENIYDAYSAVAIGYGTSERL |
| Ga0137384_115731711 | 3300012357 | Vadose Zone Soil | MATSAPPALRKFLEPYDREVRDLALKLRALVIEEMAPCYENIYDAYSA |
| Ga0137368_109871151 | 3300012358 | Vadose Zone Soil | MRRYPPPAALIQFLKPYDRGIQDLALGLRSLVLEEMAPCYENIYDAYNAVAIGYGS |
| Ga0137360_116264922 | 3300012361 | Vadose Zone Soil | VKYSPPPALLTFLRPYDREVRDLAVRLRALVLEELAPCYENIY |
| Ga0150984_1129557472 | 3300012469 | Avena Fatua Rhizosphere | MSYPPPAALKKFLRPYDREVQQLALNLRALLLEEMAPCYENIYDAY |
| Ga0137373_101267651 | 3300012532 | Vadose Zone Soil | MAHRPPPALIRFLKPYDREIRDLALKLRALVLEEMAPCYEN |
| Ga0137373_104645361 | 3300012532 | Vadose Zone Soil | VNYPPPRELIKFLKPYAPEIRNVALQLRALVLDEMAPCYENIYDAYSA |
| Ga0137358_104009203 | 3300012582 | Vadose Zone Soil | MNRPPPTLIKFLKPYDREVRDLALQLRSLVLEEMAPCYENIYDAY |
| Ga0137395_107121102 | 3300012917 | Vadose Zone Soil | MRRRHPPSELIRFLKPYDRETRHLALSLRSLVLEEMAPCHENIYDAYSAVAMGYGPT |
| Ga0137394_114229542 | 3300012922 | Vadose Zone Soil | MTHRPPPSLIKFLKPYDREIQDLAVKLRALVLEEMAPCYE |
| Ga0137359_103301992 | 3300012923 | Vadose Zone Soil | MAHRPPPSLTKFLKPFDPEIQELALELRALVLEEMAPCYENIYDAYSA |
| Ga0137407_108650122 | 3300012930 | Vadose Zone Soil | MSFPVPRQLTNFLKPYDPEIRSLAVKLRVLVLEEMGPCYENIYDAYSAVAIGYG |
| Ga0126375_113437532 | 3300012948 | Tropical Forest Soil | VKYSVPLSLRTFLKPYDPSVRSLALQLRAVLLEEIGPCYENIYDAYSAVAIGY |
| Ga0134076_102516072 | 3300012976 | Grasslands Soil | VDYPPPAALRKFLRSYDGEIQNLALNLRALVLEELGPCYENIYDAYSAVAIGYGT |
| Ga0157378_100357594 | 3300013297 | Miscanthus Rhizosphere | MKYPPPAALKKFLKPYDREVRDLALGLRALLLEEMAPCYENIY |
| Ga0163162_104109272 | 3300013306 | Switchgrass Rhizosphere | MNYPPPAALKKFLKPYDAEIRDLALQLRALVLEEMEPCYENIYDAY |
| Ga0157375_114594441 | 3300013308 | Miscanthus Rhizosphere | VKYSVPAALRKFLKPYDREVRDLAIEVRQLMLEEMAPCYENIY |
| Ga0134079_106306552 | 3300014166 | Grasslands Soil | MKYPPPAVLKKFLKPYDREVRDLALGLRALLLEEMAPCYE |
| Ga0163163_109237742 | 3300014325 | Switchgrass Rhizosphere | MNYPPPAALKKFLKPYDAEIRDLALQLRALVLEEMAPCYENI |
| Ga0157380_135192591 | 3300014326 | Switchgrass Rhizosphere | MSIKPPAELVKFLKPYDRAIQKLALDLRLIVIEELAPCYENIYD |
| Ga0167660_10377071 | 3300015078 | Glacier Forefield Soil | MKHPPPAALIKFLKPYEREVRDLALGLRAVVLDEMAPCYENIYDAYSAVAIGYGT |
| Ga0137409_102436191 | 3300015245 | Vadose Zone Soil | VTHQPPPALIKFLKPYDREIQGLALKLRALVLEEMAPCYENIYDAYSAV |
| Ga0137409_103452801 | 3300015245 | Vadose Zone Soil | MSGSDMSHVPPAALIKFLKPYDREIQDLALKLRALVLEEM |
| Ga0132258_107287521 | 3300015371 | Arabidopsis Rhizosphere | VKYSVPAALRKFLKPYDREVRDLAIEVRQLMLEEMAPCYENI |
| Ga0132256_1007403831 | 3300015372 | Arabidopsis Rhizosphere | VKYPPPRELLKFLKPYDKATRDLALQLRALLLEEMAPCYENIYDAYSAVAI |
| Ga0184619_100427531 | 3300018061 | Groundwater Sediment | MTPTKRLRKHPAPRALVKFLKPYDPAIQELALGLRSLLLEEMAPC |
| Ga0184628_104315681 | 3300018083 | Groundwater Sediment | MNYPPPAALKKFLKPYDAEIKDLALQLRGLVLEEMAPCFENIYD |
| Ga0193717_11249152 | 3300020060 | Soil | MSRRHPPPPDLVKFLKPYDRAVQKLALNLRLLVLEEMAPCYENIYDAYSAVAIGYGTSDR |
| Ga0210380_101507452 | 3300021082 | Groundwater Sediment | MNYPPPAALKKFLKPYDAEIRELALQLRVLVLEEMAPCYENIYDAYSAVAI |
| Ga0233358_1053021 | 3300023014 | Soil | MPRHKPPPDLIKFLKPYDRAVQQLALGLRALVLEEMAPCHENIYDAYSAVAIGYGPTD |
| Ga0207684_109777602 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHPPPSALIKFLKPYDREIRDLALELRALVLEEMGPCYENIYD |
| Ga0207646_109764642 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVESRNTTYPPPAALKKFLKPYDGEIQQLALDLRALVLEEMAPCY |
| Ga0207646_110707642 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQAPPAALIKFLKPYDRKIQKLALKLRALVLKEMAPCYENI |
| Ga0207687_119251491 | 3300025927 | Miscanthus Rhizosphere | MTHPPPPALIKFLKPYDREIQDLALALRALVLEEVAPC |
| Ga0207644_114354912 | 3300025931 | Switchgrass Rhizosphere | MIYPPPAALKKFLKPYDAEIRDLALQLRALVLEEMAPCYENIY |
| Ga0207709_111507272 | 3300025935 | Miscanthus Rhizosphere | VKYSVPAALRKFLKPYDREVRDLAIEVRQLMLEEMAPCYENIYDAYSAVAIGYGTSE |
| Ga0207651_110067121 | 3300025960 | Switchgrass Rhizosphere | MDMSSYPPPAELIRFLKPYDKAVRELALGLRRLVIEEMAPCYENIYDAYN |
| Ga0207676_111040001 | 3300026095 | Switchgrass Rhizosphere | MVRYKPPAALIKFLKPYDREVQKLALDLRTLVLEEMAPCHENIYDAYSAVAMG |
| Ga0209027_13195222 | 3300026300 | Grasslands Soil | LSYPPPPALKKFLKPYEPSVRDLALQLRALLLGEMAPCYENIYDAYSAVAI |
| Ga0209474_104286652 | 3300026550 | Soil | LNHPPPKKLLKFLKPYDSGVRDLALQLRGLLLEEMAPCYENIYDA |
| Ga0209648_106778812 | 3300026551 | Grasslands Soil | MPHPPPSALIKFLKPYDREIQKLALQVRALVLEEMAPCYENIYDAYS |
| Ga0209799_11482031 | 3300027654 | Tropical Forest Soil | MHPPPAALKKFLKPYDPEVRDLALKLRSLVLEEMAPCYENIYDAYSAVAIGYDSIF |
| Ga0209485_10254231 | 3300027691 | Agricultural Soil | MPNQPPAELIEFLKPYDRAIQKLALDLRKIVIEELAPCHENIYDAYSAVAIGYGSSERFS |
| Ga0209283_105729341 | 3300027875 | Vadose Zone Soil | LARQSPPAALIKFLRPYDPEIRELALQLRALVLEEMAPCYENIYDAYSAVAIGYGT |
| Ga0307504_100668171 | 3300028792 | Soil | MKYSQPPALIKFLKPYDREIRELALQLRALLLEEIGPCYENIYDAYSAVAIGYGAS |
| Ga0310897_106165162 | 3300032003 | Soil | MSHSPPATLKKFLKPYDPKVRALALQLRALVLEEMAPCYENIYDAYSAVAIG |
| Ga0310911_107085832 | 3300032035 | Soil | MAHPCPADLKKFLRPYDRDVQQLALGLRALLLEEMAPCYENIYDAY |
| Ga0307472_1012919791 | 3300032205 | Hardwood Forest Soil | MRHPPPKELLQFLEPYDRPIRELALATRNLVLEEMAPCIENMYDAYSAVALGY |
| Ga0307472_1017193282 | 3300032205 | Hardwood Forest Soil | VKFPPPKELIKFLRPYDPSVRELALGLRELVLQEMAPCYENIYDAY |
| ⦗Top⦘ |