


| Basic Information | |
|---|---|
| Family ID | F064981 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.94 % |
| % of genes near scaffold ends (potentially truncated) | 86.72 % |
| % of genes from short scaffolds (< 2000 bps) | 94.53 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF12146 | Hydrolase_4 | 6.25 |
| PF13460 | NAD_binding_10 | 3.91 |
| PF07369 | DUF1488 | 3.12 |
| PF12695 | Abhydrolase_5 | 3.12 |
| PF03795 | YCII | 2.34 |
| PF04072 | LCM | 2.34 |
| PF13628 | DUF4142 | 2.34 |
| PF06902 | Fer4_19 | 1.56 |
| PF04940 | BLUF | 1.56 |
| PF07366 | SnoaL | 1.56 |
| PF03734 | YkuD | 1.56 |
| PF09992 | NAGPA | 0.78 |
| PF17209 | Hfq | 0.78 |
| PF00571 | CBS | 0.78 |
| PF02775 | TPP_enzyme_C | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF03576 | Peptidase_S58 | 0.78 |
| PF00027 | cNMP_binding | 0.78 |
| PF04226 | Transgly_assoc | 0.78 |
| PF07238 | PilZ | 0.78 |
| PF14518 | Haem_oxygenas_2 | 0.78 |
| PF12536 | DUF3734 | 0.78 |
| PF07758 | DUF1614 | 0.78 |
| PF00113 | Enolase_C | 0.78 |
| PF00872 | Transposase_mut | 0.78 |
| PF11799 | IMS_C | 0.78 |
| PF06781 | CrgA | 0.78 |
| PF07478 | Dala_Dala_lig_C | 0.78 |
| PF01726 | LexA_DNA_bind | 0.78 |
| PF05099 | TerB | 0.78 |
| PF13599 | Pentapeptide_4 | 0.78 |
| PF02074 | Peptidase_M32 | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF00881 | Nitroreductase | 0.78 |
| PF14759 | Reductase_C | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.34 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.34 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.56 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.78 |
| COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.78 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4089 | Uncharacterized membrane protein | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.28 % |
| Unclassified | root | N/A | 11.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1095361 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300000890|JGI11643J12802_11383534 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300000891|JGI10214J12806_12586596 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300000956|JGI10216J12902_101195145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 876 | Open in IMG/M |
| 3300001228|SwM_135654 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004479|Ga0062595_100930853 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005045|Ga0071328_178413 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300005093|Ga0062594_101960975 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005343|Ga0070687_100911735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 631 | Open in IMG/M |
| 3300005347|Ga0070668_101904280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300005356|Ga0070674_101579875 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005364|Ga0070673_100119880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 2193 | Open in IMG/M |
| 3300005439|Ga0070711_101508056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 587 | Open in IMG/M |
| 3300005466|Ga0070685_10564914 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005555|Ga0066692_10026939 | All Organisms → cellular organisms → Bacteria | 2996 | Open in IMG/M |
| 3300005598|Ga0066706_10579869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. BK313 | 891 | Open in IMG/M |
| 3300005614|Ga0068856_101509021 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005719|Ga0068861_100990110 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005719|Ga0068861_101235916 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005764|Ga0066903_100551835 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300005764|Ga0066903_102859369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 936 | Open in IMG/M |
| 3300005764|Ga0066903_104633673 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005843|Ga0068860_102839238 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005844|Ga0068862_100007343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 9155 | Open in IMG/M |
| 3300005937|Ga0081455_10041336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4056 | Open in IMG/M |
| 3300006102|Ga0075015_100713621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300006175|Ga0070712_100265674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1376 | Open in IMG/M |
| 3300006196|Ga0075422_10190443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 838 | Open in IMG/M |
| 3300006845|Ga0075421_102057178 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006847|Ga0075431_101905708 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006881|Ga0068865_100271520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1347 | Open in IMG/M |
| 3300007076|Ga0075435_100925703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300009012|Ga0066710_102436959 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009101|Ga0105247_11659833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300009137|Ga0066709_101338977 | Not Available | 1047 | Open in IMG/M |
| 3300009156|Ga0111538_10350370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 1869 | Open in IMG/M |
| 3300009156|Ga0111538_12263937 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009168|Ga0105104_10507307 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300009171|Ga0105101_10204166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
| 3300009176|Ga0105242_11799465 | Not Available | 651 | Open in IMG/M |
| 3300009177|Ga0105248_10008416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11322 | Open in IMG/M |
| 3300009545|Ga0105237_12592840 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009553|Ga0105249_11604427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 723 | Open in IMG/M |
| 3300009818|Ga0105072_1032262 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300009837|Ga0105058_1084411 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010358|Ga0126370_12119605 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010358|Ga0126370_12609755 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010366|Ga0126379_10578510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300010366|Ga0126379_13179775 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010371|Ga0134125_10610659 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300010371|Ga0134125_11478663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300010373|Ga0134128_10252462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1979 | Open in IMG/M |
| 3300010373|Ga0134128_10728778 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300010373|Ga0134128_12629958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 555 | Open in IMG/M |
| 3300010375|Ga0105239_10294429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
| 3300010401|Ga0134121_12804502 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010868|Ga0124844_1264797 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012198|Ga0137364_10433991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300012200|Ga0137382_11332868 | Not Available | 506 | Open in IMG/M |
| 3300012210|Ga0137378_11368286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300012211|Ga0137377_10898824 | Not Available | 817 | Open in IMG/M |
| 3300012212|Ga0150985_116094048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 641 | Open in IMG/M |
| 3300012515|Ga0157338_1009878 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300012582|Ga0137358_10527287 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012929|Ga0137404_10922111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 797 | Open in IMG/M |
| 3300012960|Ga0164301_11085167 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012961|Ga0164302_10471341 | Not Available | 878 | Open in IMG/M |
| 3300012971|Ga0126369_10570363 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012984|Ga0164309_11041628 | Not Available | 677 | Open in IMG/M |
| 3300012988|Ga0164306_10076751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2113 | Open in IMG/M |
| 3300013297|Ga0157378_11486055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 722 | Open in IMG/M |
| 3300013306|Ga0163162_13251303 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300013307|Ga0157372_10927605 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300014318|Ga0075351_1020732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1029 | Open in IMG/M |
| 3300014326|Ga0157380_10611263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
| 3300014969|Ga0157376_10545188 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300015371|Ga0132258_12999608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1170 | Open in IMG/M |
| 3300015372|Ga0132256_102469079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella | 622 | Open in IMG/M |
| 3300015372|Ga0132256_102815066 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300016341|Ga0182035_10192209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1607 | Open in IMG/M |
| 3300016341|Ga0182035_10322795 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300016357|Ga0182032_10287831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
| 3300016357|Ga0182032_11265306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella → Methyloligella sp. GL2 | 636 | Open in IMG/M |
| 3300016445|Ga0182038_10809282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 822 | Open in IMG/M |
| 3300018028|Ga0184608_10399276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300018482|Ga0066669_10215977 | Not Available | 1484 | Open in IMG/M |
| 3300022889|Ga0247785_1004489 | Not Available | 1353 | Open in IMG/M |
| 3300023057|Ga0247797_1026787 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025900|Ga0207710_10686624 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025919|Ga0207657_11081024 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025919|Ga0207657_11207819 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025924|Ga0207694_11031077 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300025928|Ga0207700_10304710 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300025945|Ga0207679_10253593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 1497 | Open in IMG/M |
| 3300025972|Ga0207668_11405445 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026023|Ga0207677_11155595 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026089|Ga0207648_11579969 | Not Available | 616 | Open in IMG/M |
| 3300026118|Ga0207675_100573621 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300026142|Ga0207698_11475837 | Not Available | 695 | Open in IMG/M |
| 3300026325|Ga0209152_10263230 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027395|Ga0209996_1041505 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300027680|Ga0207826_1077609 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300027818|Ga0209706_10410100 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027874|Ga0209465_10362991 | Not Available | 725 | Open in IMG/M |
| 3300027909|Ga0209382_10574999 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300027915|Ga0209069_10458902 | Not Available | 709 | Open in IMG/M |
| 3300027964|Ga0256864_1024182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1589 | Open in IMG/M |
| 3300027964|Ga0256864_1038624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300028380|Ga0268265_11422496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 696 | Open in IMG/M |
| 3300028592|Ga0247822_10565258 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300030620|Ga0302046_10891931 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031232|Ga0302323_103020547 | Not Available | 537 | Open in IMG/M |
| 3300031250|Ga0265331_10494973 | Not Available | 550 | Open in IMG/M |
| 3300031368|Ga0307429_1063121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1112 | Open in IMG/M |
| 3300031368|Ga0307429_1090326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 877 | Open in IMG/M |
| 3300031740|Ga0307468_101514543 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031744|Ga0306918_11476667 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031890|Ga0306925_10281418 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300031892|Ga0310893_10343600 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032017|Ga0310899_10685974 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300032042|Ga0318545_10152727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 821 | Open in IMG/M |
| 3300032122|Ga0310895_10226291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300032179|Ga0310889_10460083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
| 3300032211|Ga0310896_10288856 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300032261|Ga0306920_101930402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 829 | Open in IMG/M |
| 3300033550|Ga0247829_10851712 | Not Available | 759 | Open in IMG/M |
| 3300034354|Ga0364943_0124268 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300034817|Ga0373948_0075261 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.34% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.56% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10953612 | 3300000655 | Forest Soil | DTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID* |
| JGI11643J12802_113835343 | 3300000890 | Soil | TEDTKKAKEFAASADLKEALMKAGVLDTPTIYFLESID* |
| JGI10214J12806_125865961 | 3300000891 | Soil | NKSEIVVVFDTEDTKKAKEFAASADLKEAMMAAGVLDTPTI* |
| JGI10216J12902_1011951454 | 3300000956 | Soil | DTKKAKDFAASADLKETMKQSGVLDTPTIYFLESID* |
| SwM_1356542 | 3300001228 | Switchgrass Rhizosphere | TKKAKDFAASTDLKEAMIKAGVLDTPTIYFLESID* |
| Ga0062595_1009308531 | 3300004479 | Soil | DTEDTKKAKEFAASADLKEAMMAAGVLDTPTIYFLESID* |
| Ga0071328_1784133 | 3300005045 | Permafrost | VVVFDTEDTKRAKDFAASTDLKEAMMKVGVLDTPTIYFLEAID* |
| Ga0062594_1019609751 | 3300005093 | Soil | VVFDTEDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID* |
| Ga0070687_1009117351 | 3300005343 | Switchgrass Rhizosphere | VVFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTIYLLESID* |
| Ga0070668_1019042801 | 3300005347 | Switchgrass Rhizosphere | FDTEDTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID* |
| Ga0070674_1015798751 | 3300005356 | Miscanthus Rhizosphere | FDTEDTKKAKDFAASSDLKEAMMKAGVLDTPTIYFLESID* |
| Ga0070673_1001198804 | 3300005364 | Switchgrass Rhizosphere | FDTEDTKKAKDFALSADLKEVMKQSGVLDTPTIYFLESID* |
| Ga0070711_1015080561 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTLYFLESID* |
| Ga0070685_105649143 | 3300005466 | Switchgrass Rhizosphere | VFDTEDTKKAKEFAASADLKEAMEKAGVLDTPTIYFLESID* |
| Ga0066692_100269397 | 3300005555 | Soil | VFDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID* |
| Ga0066706_105798692 | 3300005598 | Soil | DTTDTKKAKEFATSSDLKDVMTKAGVIDVPTMYFLESI* |
| Ga0068856_1015090211 | 3300005614 | Corn Rhizosphere | KSEIVVVFDTEDTKKAKEFAASPDLKEAMMAAGVIDTPTIYFLESID* |
| Ga0068861_1009901102 | 3300005719 | Switchgrass Rhizosphere | EDTKKAKEFAASADLKEAMMKAGVLDTPTIYFLESID* |
| Ga0068861_1012359161 | 3300005719 | Switchgrass Rhizosphere | DTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID* |
| Ga0066903_1005518354 | 3300005764 | Tropical Forest Soil | TKDTQKAKAFAASPDLKEVMSKAGVVDTPTIYFLESID* |
| Ga0066903_1028593691 | 3300005764 | Tropical Forest Soil | VVFETKDTKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID* |
| Ga0066903_1046336732 | 3300005764 | Tropical Forest Soil | DTKKAKDFAASADLKEVMKQSGVLDTPTIYFLESID* |
| Ga0068860_1028392381 | 3300005843 | Switchgrass Rhizosphere | FDTEDTKKAKEFAASADLKEAMMKAGVLDTPTIYFLESID* |
| Ga0068862_1000073431 | 3300005844 | Switchgrass Rhizosphere | FDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID* |
| Ga0081455_100413369 | 3300005937 | Tabebuia Heterophylla Rhizosphere | FDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID* |
| Ga0075015_1007136211 | 3300006102 | Watersheds | VFDTEDTQKAKDFAASADLDEAMKQAGVLDTPTIYFLESID* |
| Ga0070712_1002656741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SETVVVFDTEDTKKASDFAASADLKEAMKQAGVLDTPTIYFLESID* |
| Ga0075422_101904431 | 3300006196 | Populus Rhizosphere | KKAKDFAVSADLKEVMKQSGVLDTPTIYFLESID* |
| Ga0075421_1020571783 | 3300006845 | Populus Rhizosphere | DTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID* |
| Ga0075431_1019057082 | 3300006847 | Populus Rhizosphere | IVVVFDTEDTKKAKEFAASAALKEAMMAAGVLDTPTIYFLESID* |
| Ga0068865_1002715201 | 3300006881 | Miscanthus Rhizosphere | VVVFDTEDPKKAKDFAASADLKEAMKHAGILDTPTLSQA* |
| Ga0075435_1009257031 | 3300007076 | Populus Rhizosphere | MFDTEDTKKAKEFAASADLKEAMIKAGVVDQPTIYFLESID* |
| Ga0066710_1024369592 | 3300009012 | Grasslands Soil | SSTLRIPRWPKDFAASADLKEAMIRAGVLDTPTIYFLESID |
| Ga0105247_116598331 | 3300009101 | Switchgrass Rhizosphere | TEDTKKAKEFAASADLKEAMMAAGVIDTPTIYFLESID* |
| Ga0066709_1013389771 | 3300009137 | Grasslands Soil | IFDTTDTKKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI* |
| Ga0111538_103503701 | 3300009156 | Populus Rhizosphere | SEIVIVFDTEDTKKAKDFAMSADLKEVMKQSGVLETPTIYFLESID* |
| Ga0111538_122639371 | 3300009156 | Populus Rhizosphere | KKAKDFAMSADLKEAMKQAGVLDNPTIYFLESID* |
| Ga0105104_105073071 | 3300009168 | Freshwater Sediment | EFVVVFDTEDTKKANEFAASTDLKESMMAAGVLDAPTIYFLESID* |
| Ga0105101_102041661 | 3300009171 | Freshwater Sediment | IVVVFDTRDTKSAKTFAASDDLKDAMTEAGVLDTPTVYFLESID* |
| Ga0105242_117994651 | 3300009176 | Miscanthus Rhizosphere | TEDTKRAKAFATSTDLEETMAEASVVDTPTIYFLESID* |
| Ga0105248_1000841613 | 3300009177 | Switchgrass Rhizosphere | KKAKDFAASADLKEAMIKAGVLDTPTIYFLESID* |
| Ga0105237_125928402 | 3300009545 | Corn Rhizosphere | LVVFDTESTKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID* |
| Ga0105249_116044271 | 3300009553 | Switchgrass Rhizosphere | IVVVFDTEDPKKAKDFAASADLKEAMKQSGVLDAPTIYFLESID* |
| Ga0105072_10322621 | 3300009818 | Groundwater Sand | TKKAKDFAASADLKEAMMEAGVLDTPTIYFLESID* |
| Ga0105058_10844112 | 3300009837 | Groundwater Sand | VVVFDTKDTKVAKAFAASAGLKEAMTKAGVVDVPTIYLLESI* |
| Ga0126370_121196052 | 3300010358 | Tropical Forest Soil | AAKIAKDFATSADLKEAMKQAGVLDTPTIYFLESID* |
| Ga0126370_126097551 | 3300010358 | Tropical Forest Soil | KSEIVIVFDTEDTKKAKDFAASADLKEVMKQAGVLDTPTIYFLESID* |
| Ga0126379_105785101 | 3300010366 | Tropical Forest Soil | KKAKAFAASADLKEAMTKAGVVDMPTIYFLESID* |
| Ga0126379_131797752 | 3300010366 | Tropical Forest Soil | VVFDTEDTKKAKDFAASADLKAAMKQAGVLDTPTIYFLESID* |
| Ga0134125_106106591 | 3300010371 | Terrestrial Soil | VFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTIYFLESID* |
| Ga0134125_114786631 | 3300010371 | Terrestrial Soil | VVVFDTKETKVAKDFVVSTDLKEAMTKAGVVDTPTIYFLESID* |
| Ga0134128_102524625 | 3300010373 | Terrestrial Soil | DTKKARDFAASADLKEAMKQAGVLDTPTIYFLESID* |
| Ga0134128_107287783 | 3300010373 | Terrestrial Soil | KSEIVVVFDTESTKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID* |
| Ga0134128_126299581 | 3300010373 | Terrestrial Soil | TKKAKDFAASADLKEAMEKAGVLDTPTIYLLESID* |
| Ga0105239_102944293 | 3300010375 | Corn Rhizosphere | EIVVVFDTEDTKKAKEFAASADLKEAMDTAGVLDTPTIYFLESID* |
| Ga0134121_128045022 | 3300010401 | Terrestrial Soil | VFDTQDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID* |
| Ga0124844_12647971 | 3300010868 | Tropical Forest Soil | IVFDTEDTKKAKDFAASADLKEVMKQSGVLDTPTIYFLESID* |
| Ga0137364_104339912 | 3300012198 | Vadose Zone Soil | RIPRWPKDFAASADLKEAMIKAGVLDTPTIYFLESID* |
| Ga0137382_113328681 | 3300012200 | Vadose Zone Soil | DTKKAKEFATSSDLKDVMTKAGVIDVPTMYFLESI* |
| Ga0137378_113682862 | 3300012210 | Vadose Zone Soil | EDTKKAKDFAASADLNEAMIKAGVLDTPTIYFLESID* |
| Ga0137377_108988241 | 3300012211 | Vadose Zone Soil | TDTEKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI* |
| Ga0150985_1160940482 | 3300012212 | Avena Fatua Rhizosphere | EIVVVFDTKETKMAKDFSASADLKEAMTKAGVVDTPTIYFLESID* |
| Ga0157338_10098781 | 3300012515 | Arabidopsis Rhizosphere | TQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID* |
| Ga0137358_105272872 | 3300012582 | Vadose Zone Soil | VFDTEDTKKAKDFAASALKEAMIKAGVLDTPTIYFLKSID* |
| Ga0137404_109221111 | 3300012929 | Vadose Zone Soil | VVFDTEDTKKAKDFAASADLKEAMEKAGVLDAPTIYFLESID* |
| Ga0164301_110851671 | 3300012960 | Soil | EDTKKAKEFAASADLKEAMEKAGVLDTPTIYFLESID* |
| Ga0164302_104713412 | 3300012961 | Soil | DAADTKKAKEFATSSNLKDVMTKAGVIDVPTMYFLESI* |
| Ga0126369_105703631 | 3300012971 | Tropical Forest Soil | TEDTKKAKDFAASADLKEAMQRAGVLFTPTIYFLESID* |
| Ga0164309_110416282 | 3300012984 | Soil | VVVFDTEDTKRANEFAASADVKDAMMKAGVLDTPTIDFLESID* |
| Ga0164306_100767513 | 3300012988 | Soil | VILEKAKEFAAAADLKEAMEKAGVLDTPTIYFLESID* |
| Ga0157378_114860551 | 3300013297 | Miscanthus Rhizosphere | KETKVAKDFAVSTDLKEAMTEGGVVDTPTIYFLESID* |
| Ga0163162_132513031 | 3300013306 | Switchgrass Rhizosphere | TKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID* |
| Ga0157372_109276051 | 3300013307 | Corn Rhizosphere | SEIVVVFDTEDTKKAKEFAASADLKEAMMAAGVIDTPTIYFLESID* |
| Ga0075351_10207321 | 3300014318 | Natural And Restored Wetlands | DTKKAKDFAASADLKEAMEKAGVLDTPTIYFLESID* |
| Ga0157380_106112633 | 3300014326 | Switchgrass Rhizosphere | VVVFDTKDTKSAKTFAASDDLKKAMGEAGVLDTPTVYFLESID* |
| Ga0157376_105451881 | 3300014969 | Miscanthus Rhizosphere | TEDPKKAKDFAASADLKEAMKHAGILDTPTIYFL* |
| Ga0132258_129996081 | 3300015371 | Arabidopsis Rhizosphere | KKAKDFAASADLKEAMEKAGVLDTPTIYLLESID* |
| Ga0132256_1024690791 | 3300015372 | Arabidopsis Rhizosphere | SEIVVVFDTQDTKKAKEFAASSDLKEAMLKAGVLDTPTIFS* |
| Ga0132256_1028150661 | 3300015372 | Arabidopsis Rhizosphere | TKKAKDFAASAGLKEAMEQAGILDTPTIYFLESID* |
| Ga0182035_101922091 | 3300016341 | Soil | VVVFETKDSKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID |
| Ga0182035_103227954 | 3300016341 | Soil | VFDTEDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID |
| Ga0182032_102878311 | 3300016357 | Soil | ETKDSKKAKAFAASADLKEAMTKAGVVDMPTIYFLESID |
| Ga0182032_112653061 | 3300016357 | Soil | EDTKKAKDFAASDDLKEAMKRSGVLDTLTIYFLDSID |
| Ga0182038_108092821 | 3300016445 | Soil | VVFDTNDTKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID |
| Ga0184608_103992762 | 3300018028 | Groundwater Sediment | VPGQLFGAEDTKRAKEFAASADLKEAMMAAGVIDTPTIYFLESID |
| Ga0066669_102159771 | 3300018482 | Grasslands Soil | TTDTKKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI |
| Ga0247785_10044891 | 3300022889 | Soil | VVFDTKDTQKAKAFAASPDLKEAMSRASVVDTPTIYFLESID |
| Ga0247797_10267871 | 3300023057 | Soil | VVFDTKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID |
| Ga0207710_106866241 | 3300025900 | Switchgrass Rhizosphere | TEDTKKAKDFATSAALTEAMMKAGVLDTPTIYFLESID |
| Ga0207657_110810241 | 3300025919 | Corn Rhizosphere | KSEIVVVFDTEDPKKAKDFAASADLKEAMKHAGILDTPTIYFLESID |
| Ga0207657_112078191 | 3300025919 | Corn Rhizosphere | KSEIVVVFDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID |
| Ga0207694_110310773 | 3300025924 | Corn Rhizosphere | TKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID |
| Ga0207700_103047101 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID |
| Ga0207679_102535933 | 3300025945 | Corn Rhizosphere | SNKSEIVIVFDTEDTKKAKDFAVSADLKEVMKQSGVLDTPTIYFLESID |
| Ga0207668_114054452 | 3300025972 | Switchgrass Rhizosphere | SNKSEIVVVFDTEDTRMAKAFAASADLKEAMVKAGVLDTPTIYFLESID |
| Ga0207677_111555951 | 3300026023 | Miscanthus Rhizosphere | VVVFDTKDTKMAKDFAGSVDLKEAMAEAGVVDMPTIYLLESID |
| Ga0207648_115799692 | 3300026089 | Miscanthus Rhizosphere | TEDTKRAKAFATSTDLEETMAEASVVDTPTIYFLESID |
| Ga0207675_1005736211 | 3300026118 | Switchgrass Rhizosphere | EDTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID |
| Ga0207698_114758371 | 3300026142 | Corn Rhizosphere | GYQEGKGFAASTDLKGAMIKAGVLDTPTIYFFESID |
| Ga0209152_102632302 | 3300026325 | Soil | EDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID |
| Ga0209996_10415051 | 3300027395 | Arabidopsis Thaliana Rhizosphere | DTEDTKKAKDFAASAELKEAMEKAGVLDTPTIYFLESID |
| Ga0207826_10776091 | 3300027680 | Tropical Forest Soil | MLPNRAKAFAAWAELKEAMMRAGVVDTPTIYFLESID |
| Ga0209706_104101001 | 3300027818 | Freshwater Sediment | KSEVVVVFDTKDTKLAKEFAGSADLKEAMMKAGVEDSPTIYFLESID |
| Ga0209465_103629912 | 3300027874 | Tropical Forest Soil | SEIVIVFDTEDTKKAKDFAASADLKEVMKQSGVLDTPTIYFLETV |
| Ga0209382_105749991 | 3300027909 | Populus Rhizosphere | TKRAKEFAASPDLKEAMMAAGVLDAPTIYFLESID |
| Ga0209069_104589022 | 3300027915 | Watersheds | DTTKAKAFAGSADLKEAMMKAGVLDTPTIYFLESID |
| Ga0256864_10241824 | 3300027964 | Soil | FDTKETKMAKDFAASAVLKQAMSKAGVVDTPTIYFLESID |
| Ga0256864_10386241 | 3300027964 | Soil | VVVFDTKETKMAKDFAASADLKQAMSKAGVVDTPTIYF |
| Ga0268265_114224962 | 3300028380 | Switchgrass Rhizosphere | VFDTKETKVAKDFAVSTDLREAMTKAGVVDTPTIYFLESID |
| Ga0247822_105652581 | 3300028592 | Soil | TKRAKEFAASADLKEAMMAAGVIDTPTIYFLESID |
| Ga0302046_108919311 | 3300030620 | Soil | DTEDTKKAKDFAASADLREAMMKAGVLDTPTIYFLESID |
| Ga0302323_1030205472 | 3300031232 | Fen | MDTKKARDFAASADLKETMMKAGVVDKPTIYFLELA |
| Ga0265331_104949731 | 3300031250 | Rhizosphere | FDDMDTKKAKEFAHSADLKETMMKAGVVDVPTIYFLETI |
| Ga0307429_10631211 | 3300031368 | Salt Marsh | DTEDTSKAKEFADSTDLKEAMAKAGVSDTPTIYFLESID |
| Ga0307429_10903262 | 3300031368 | Salt Marsh | VVVFDTEDTKKAKDFAASADLKETMTKAGVVDAPTIYFLESID |
| Ga0307468_1015145433 | 3300031740 | Hardwood Forest Soil | VVVFDTKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID |
| Ga0306918_114766671 | 3300031744 | Soil | MRFWLLFAAGAELKEAMMKAGVMDTPTIYFLESID |
| Ga0306925_102814181 | 3300031890 | Soil | FDTEDTKKAKDFAASDDLKEAMKRSGVLDTPTIYFLDSID |
| Ga0310893_103436001 | 3300031892 | Soil | VVVFDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID |
| Ga0310899_106859741 | 3300032017 | Soil | VVFDTKDTKSAKAFAASDDLKDAMTKAGVLDTPTVYFLESID |
| Ga0318545_101527271 | 3300032042 | Soil | VFDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID |
| Ga0310895_102262911 | 3300032122 | Soil | VVFDTKDTNSAKAFAVSDDLKKAMSEAGLDTPTVYFLESID |
| Ga0310889_104600831 | 3300032179 | Soil | TKKAKEFAASPDLKEAMMAAGVLDAPTIYFLESID |
| Ga0310896_102888561 | 3300032211 | Soil | SEIVVVFDTEDTKKAKEFAASADLKEAMETAGVLDTPTIYFLESID |
| Ga0306920_1019304021 | 3300032261 | Soil | DDKSEIVVVFDTKDTKRAKDFAASPNLRERMVKAGVMDDPTIYFLESV |
| Ga0247829_108517121 | 3300033550 | Soil | VVVFDTKDTKSAKAFAASDDLKDAMTKAGVLDTPTVYFLESID |
| Ga0364943_0124268_1_117 | 3300034354 | Sediment | TEDTKKAKDFAASADLKEAMMEAGVLDTPTIYFLESID |
| Ga0373948_0075261_3_140 | 3300034817 | Rhizosphere Soil | EIVVVFDTEDTKKAKEFAASADLKEAMETAGVLDTPTIYFLESID |
| ⦗Top⦘ |