


| Basic Information | |
|---|---|
| Family ID | F064944 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | QLPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 90.62 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.625 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.531 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.562 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 0.00% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 37.50 |
| PF00378 | ECH_1 | 17.19 |
| PF02611 | CDH | 11.72 |
| PF00528 | BPD_transp_1 | 3.91 |
| PF01590 | GAF | 3.12 |
| PF00501 | AMP-binding | 1.56 |
| PF04392 | ABC_sub_bind | 1.56 |
| PF03741 | TerC | 1.56 |
| PF01977 | UbiD | 1.56 |
| PF00497 | SBP_bac_3 | 0.78 |
| PF13458 | Peripla_BP_6 | 0.78 |
| PF01145 | Band_7 | 0.78 |
| PF01734 | Patatin | 0.78 |
| PF13336 | AcetylCoA_hyd_C | 0.78 |
| PF13578 | Methyltransf_24 | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF07992 | Pyr_redox_2 | 0.78 |
| PF08450 | SGL | 0.78 |
| PF12706 | Lactamase_B_2 | 0.78 |
| PF00005 | ABC_tran | 0.78 |
| PF01875 | Memo | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 37.50 |
| COG2134 | CDP-diacylglycerol pyrophosphatase | Lipid transport and metabolism [I] | 11.72 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.56 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 1.56 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.56 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.78 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.78 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.78 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.78 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.62 % |
| Unclassified | root | N/A | 9.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10020718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1804 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1002208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3615 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10066945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300000955|JGI1027J12803_102173024 | Not Available | 1130 | Open in IMG/M |
| 3300002917|JGI25616J43925_10088631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1288 | Open in IMG/M |
| 3300004081|Ga0063454_101892902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300004156|Ga0062589_102583396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300004633|Ga0066395_10029566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2271 | Open in IMG/M |
| 3300005184|Ga0066671_10324613 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005332|Ga0066388_101780486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1094 | Open in IMG/M |
| 3300005332|Ga0066388_106740989 | Not Available | 578 | Open in IMG/M |
| 3300005437|Ga0070710_10105151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1687 | Open in IMG/M |
| 3300005467|Ga0070706_100537155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300005471|Ga0070698_100983111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 791 | Open in IMG/M |
| 3300005529|Ga0070741_11133778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 663 | Open in IMG/M |
| 3300005543|Ga0070672_100088581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2492 | Open in IMG/M |
| 3300005552|Ga0066701_10244645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300005555|Ga0066692_10690218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300005591|Ga0070761_10637325 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005713|Ga0066905_100186117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1537 | Open in IMG/M |
| 3300005719|Ga0068861_100753702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300005764|Ga0066903_104654812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300005764|Ga0066903_105721734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300005843|Ga0068860_100723996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300005921|Ga0070766_11023301 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005937|Ga0081455_10034501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4532 | Open in IMG/M |
| 3300006028|Ga0070717_10846133 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006176|Ga0070765_100043741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum | 3604 | Open in IMG/M |
| 3300006176|Ga0070765_101197042 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006176|Ga0070765_101776572 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006580|Ga0074049_13194354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300006794|Ga0066658_10833545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300006853|Ga0075420_101783602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300006893|Ga0073928_10199956 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300009090|Ga0099827_10970159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300009094|Ga0111539_12149950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300009137|Ga0066709_104254783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009162|Ga0075423_10719759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300009525|Ga0116220_10268966 | Not Available | 746 | Open in IMG/M |
| 3300009553|Ga0105249_11217698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300009698|Ga0116216_10781541 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009700|Ga0116217_10323543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300010036|Ga0126305_10605535 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010045|Ga0126311_10741342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300010048|Ga0126373_11283554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300010048|Ga0126373_12103526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300010335|Ga0134063_10609580 | Not Available | 556 | Open in IMG/M |
| 3300010360|Ga0126372_12539521 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010397|Ga0134124_13215632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300010398|Ga0126383_13697696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300010401|Ga0134121_11650538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300012189|Ga0137388_11176533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300012208|Ga0137376_11453692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300012351|Ga0137386_10829124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300012357|Ga0137384_10071068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 2891 | Open in IMG/M |
| 3300012362|Ga0137361_11690435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300012515|Ga0157338_1063037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012922|Ga0137394_11055419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300012948|Ga0126375_10212182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1281 | Open in IMG/M |
| 3300012971|Ga0126369_12084598 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300013096|Ga0157307_1088566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300014654|Ga0181525_10428421 | Not Available | 728 | Open in IMG/M |
| 3300014968|Ga0157379_11775649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300015372|Ga0132256_102100565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300015374|Ga0132255_105938236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 517 | Open in IMG/M |
| 3300016341|Ga0182035_10037791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3182 | Open in IMG/M |
| 3300016422|Ga0182039_10080453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2339 | Open in IMG/M |
| 3300016445|Ga0182038_11649676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300017792|Ga0163161_10114249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2022 | Open in IMG/M |
| 3300017965|Ga0190266_11213761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300017970|Ga0187783_10291076 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300018028|Ga0184608_10083116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
| 3300018086|Ga0187769_10721720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300019361|Ga0173482_10275612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300021475|Ga0210392_10295271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300021559|Ga0210409_10973090 | Not Available | 723 | Open in IMG/M |
| 3300022731|Ga0224563_1025348 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300022881|Ga0224545_1023106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 895 | Open in IMG/M |
| 3300024288|Ga0179589_10597533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300025916|Ga0207663_10970089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300025919|Ga0207657_11062115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300025932|Ga0207690_11122885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300025937|Ga0207669_10734036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300025944|Ga0207661_10092236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2525 | Open in IMG/M |
| 3300026089|Ga0207648_12088940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300026325|Ga0209152_10500744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300026538|Ga0209056_10138968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1888 | Open in IMG/M |
| 3300027061|Ga0209729_1050561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300027882|Ga0209590_10521656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300027908|Ga0209006_10358984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
| 3300027909|Ga0209382_10399457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1531 | Open in IMG/M |
| 3300028023|Ga0265357_1000069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 3733 | Open in IMG/M |
| 3300028708|Ga0307295_10037931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300028712|Ga0307285_10185288 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028712|Ga0307285_10221376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 533 | Open in IMG/M |
| 3300028784|Ga0307282_10070881 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300028796|Ga0307287_10284017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300028819|Ga0307296_10526822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300028881|Ga0307277_10115803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300031226|Ga0307497_10527791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300031525|Ga0302326_12490515 | Not Available | 650 | Open in IMG/M |
| 3300031546|Ga0318538_10092662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1549 | Open in IMG/M |
| 3300031546|Ga0318538_10562385 | Not Available | 618 | Open in IMG/M |
| 3300031564|Ga0318573_10292541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300031680|Ga0318574_10295891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300031747|Ga0318502_10148531 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031763|Ga0318537_10307203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031764|Ga0318535_10001334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6787 | Open in IMG/M |
| 3300031792|Ga0318529_10291706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300031793|Ga0318548_10622136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300031794|Ga0318503_10285896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031805|Ga0318497_10160011 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300031845|Ga0318511_10117096 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300031893|Ga0318536_10252987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300031897|Ga0318520_11071705 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031910|Ga0306923_11844267 | Not Available | 619 | Open in IMG/M |
| 3300031912|Ga0306921_11183018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300031913|Ga0310891_10356697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031945|Ga0310913_11230622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300031954|Ga0306926_10775056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300032039|Ga0318559_10138105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1102 | Open in IMG/M |
| 3300032044|Ga0318558_10552014 | Not Available | 575 | Open in IMG/M |
| 3300032160|Ga0311301_12451385 | Not Available | 586 | Open in IMG/M |
| 3300032205|Ga0307472_100118100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1867 | Open in IMG/M |
| 3300032805|Ga0335078_11851543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300032805|Ga0335078_12040365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 612 | Open in IMG/M |
| 3300033290|Ga0318519_10110232 | Not Available | 1493 | Open in IMG/M |
| 3300033551|Ga0247830_10177253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100207183 | 3300000597 | Forest Soil | WFVEASRFAGVEPREPARKGEPMSLEKFIAAGMR* |
| AF_2010_repII_A100DRAFT_10022081 | 3300000655 | Forest Soil | ARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGTR* |
| AF_2010_repII_A001DRAFT_100669452 | 3300000793 | Forest Soil | WFVEASRFAGVEPREPTRKGDPMSLEKFIAAGMR* |
| JGI1027J12803_1021730242 | 3300000955 | Soil | RQQWFAEASRFAGVEPREPARQGEPVSLEKFIAAGTR* |
| JGI25616J43925_100886311 | 3300002917 | Grasslands Soil | AMQRRWQLPARRQWFVEASRFAGVAPREPTRKGEPLSLEKFIAAGMR* |
| Ga0063454_1018929021 | 3300004081 | Soil | DASQSMKRRWQLPARQQWFGEASRFAGVEPREPARKGDPLSLEKFIAAGMR* |
| Ga0062589_1025833962 | 3300004156 | Soil | AKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR* |
| Ga0066395_100295663 | 3300004633 | Tropical Forest Soil | MDIENEPVRWDASRAMQRRWQLPARAQWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR* |
| Ga0066671_103246132 | 3300005184 | Soil | RWQLPARRQWFIEASRFVGIEPREPARPGDPLSLEKFIAAGMR* |
| Ga0066388_1017804863 | 3300005332 | Tropical Forest Soil | LPARAMWFKEASRFRGVPPREPAHRREPMRLERYVAAAR* |
| Ga0066388_1067409891 | 3300005332 | Tropical Forest Soil | FAGKRRWQLPARAMWFNEASRLSGVLPREPAHQREPMTLERYVAAAR* |
| Ga0070710_101051513 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | HAMQRRWQLPARRQWFVEASRFAGVEPRPPARKGEPMSLEKFIAAGMR* |
| Ga0070706_1005371552 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR* |
| Ga0070698_1009831112 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DSAKRRWQLPARRQWFAEASRFAGVEPRGPAKKGTPRSLEDFLAAGMR* |
| Ga0070741_111337782 | 3300005529 | Surface Soil | VAGKRRWQLPARAMWFNEASRFVGVEPKEPPAGRAPMTLEKFVAAQ* |
| Ga0070672_1000885813 | 3300005543 | Miscanthus Rhizosphere | MKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR* |
| Ga0066701_102446451 | 3300005552 | Soil | QWFVEASRFAGVAPREPARKGEPMSLEKFLGAGIR* |
| Ga0066692_106902181 | 3300005555 | Soil | WDASHAMQRRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGRR* |
| Ga0070761_106373252 | 3300005591 | Soil | MWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK* |
| Ga0066905_1001861171 | 3300005713 | Tropical Forest Soil | PARRQWYVEASQFAGVAPREPDKKGDPMSLEKFIAMGVR* |
| Ga0068861_1007537021 | 3300005719 | Switchgrass Rhizosphere | PARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR* |
| Ga0066903_1046548122 | 3300005764 | Tropical Forest Soil | MKRRWQLPARLQWFTEASRFAGIEPREPAHKGDPMSLEKFLAAGMR* |
| Ga0066903_1057217341 | 3300005764 | Tropical Forest Soil | LPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR* |
| Ga0068860_1007239961 | 3300005843 | Switchgrass Rhizosphere | QLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR* |
| Ga0070766_110233011 | 3300005921 | Soil | AMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK* |
| Ga0081455_100345015 | 3300005937 | Tabebuia Heterophylla Rhizosphere | WQLPARQQWFVEASRFADVEPREPARKGDPMSLEKFIAGGIR* |
| Ga0070717_108461332 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PARAQWFSQASRFAGVEPREPAGKGNPMTLERYLGAAR* |
| Ga0070765_1000437416 | 3300006176 | Soil | LPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK* |
| Ga0070765_1011970422 | 3300006176 | Soil | WQLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK* |
| Ga0070765_1017765722 | 3300006176 | Soil | WQLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVSAAR* |
| Ga0074049_131943541 | 3300006580 | Soil | QQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR* |
| Ga0066658_108335451 | 3300006794 | Soil | WDASHAMQRRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGIR* |
| Ga0075420_1017836021 | 3300006853 | Populus Rhizosphere | SLAAKRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR* |
| Ga0073928_101999561 | 3300006893 | Iron-Sulfur Acid Spring | RWQLPARAQWFNEASRFAGVEVVEPARAGSPRTLEKYVADQG* |
| Ga0099827_109701592 | 3300009090 | Vadose Zone Soil | WFDEASRFAGVAPRDPARKGDPLSLEKFIAAGMR* |
| Ga0111539_121499502 | 3300009094 | Populus Rhizosphere | WFVEASRFADVEPREPARKGDPMSLEKFVAAGMR* |
| Ga0066709_1042547832 | 3300009137 | Grasslands Soil | ENGRVRWDASFAMQRRWQLPARQQWFVEASRFAEVEPRAPTKKGDPLSLEKFIAAGMR* |
| Ga0075423_107197591 | 3300009162 | Populus Rhizosphere | QLPARRQWFVEASRFAGVEPRPPARKGEPMSLEKFIAAGMR* |
| Ga0116220_102689661 | 3300009525 | Peatlands Soil | ARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK* |
| Ga0105249_112176982 | 3300009553 | Switchgrass Rhizosphere | MKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGLR* |
| Ga0116216_107815411 | 3300009698 | Peatlands Soil | LPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAR* |
| Ga0116217_103235433 | 3300009700 | Peatlands Soil | AMWFAEASRFAGVEPREPAHKGNPMTLERYVAAK* |
| Ga0126305_106055352 | 3300010036 | Serpentine Soil | ARRQWYTEASRFAALEPREPPRKGSPMTLEKYLGLED* |
| Ga0126311_107413421 | 3300010045 | Serpentine Soil | LPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR* |
| Ga0126373_112835541 | 3300010048 | Tropical Forest Soil | QWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR* |
| Ga0126373_121035261 | 3300010048 | Tropical Forest Soil | QLPARRQWFVEASRFAGVEPREPARKGDPMSLERFIAAGMR* |
| Ga0134063_106095801 | 3300010335 | Grasslands Soil | PARRQWFVEASRFAGVEPREPARKDEPMSLEKFIAAGMR* |
| Ga0126372_125395212 | 3300010360 | Tropical Forest Soil | QRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIAAGMR* |
| Ga0134124_132156321 | 3300010397 | Terrestrial Soil | QLPARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR* |
| Ga0126383_136976962 | 3300010398 | Tropical Forest Soil | DASHAMKRRWQLPARRQWFVEASRFAGVEPREPARKGDPMSLETFIAAGMR* |
| Ga0134121_116505381 | 3300010401 | Terrestrial Soil | PVRWDASQSMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGTR* |
| Ga0137388_111765332 | 3300012189 | Vadose Zone Soil | DIENEPVRWDLSHAAKRRWQLPARRQWVLEASRFSGVAPRDPEKKGDPMSLEKFIAAGMR |
| Ga0137376_114536922 | 3300012208 | Vadose Zone Soil | RRQWFVEASRFANVEPSEPVRKGDPLSLEKFVAAGMR* |
| Ga0137386_108291242 | 3300012351 | Vadose Zone Soil | MQRRWQLPARRQWFGEASRFAGVAPREPARKGEPMSLEKFLGAGIR* |
| Ga0137384_100710681 | 3300012357 | Vadose Zone Soil | RQWFVEASRFVGVEPREPARKGDPMSLEKFIAAGMR* |
| Ga0137361_116904351 | 3300012362 | Vadose Zone Soil | LPARRQWFVEASRFANVEPSEPVRKGDPLSLEKFVAAGMR* |
| Ga0157338_10630372 | 3300012515 | Arabidopsis Rhizosphere | QLPARQQWFVEASRFADVEPREPARKGDPMSLERFIAAGMR* |
| Ga0137394_110554192 | 3300012922 | Vadose Zone Soil | KRRWQLPARQQWFAEASRFAGVELREPARKGDSLSLEKFVAAGMR* |
| Ga0126375_102121822 | 3300012948 | Tropical Forest Soil | DIENEPVRWDASRAMQRRWQLPARAQWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR |
| Ga0126369_120845982 | 3300012971 | Tropical Forest Soil | WDASHAMQRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFITAGMR* |
| Ga0157307_10885662 | 3300013096 | Soil | PARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR* |
| Ga0181525_104284212 | 3300014654 | Bog | ARAQWFTEASRFAGLEPRESASKRSPMTLEKYVGAK* |
| Ga0157379_117756491 | 3300014968 | Switchgrass Rhizosphere | LPARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR* |
| Ga0132256_1021005652 | 3300015372 | Arabidopsis Rhizosphere | QSMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR* |
| Ga0132255_1059382362 | 3300015374 | Arabidopsis Rhizosphere | EPVRWDVSYAAKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR* |
| Ga0182035_100377914 | 3300016341 | Soil | RWQLPARRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR |
| Ga0182039_100804533 | 3300016422 | Soil | VMDIENEPVRWDASVAMKRRWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR |
| Ga0182038_116496762 | 3300016445 | Soil | QWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0163161_101142493 | 3300017792 | Switchgrass Rhizosphere | VMDIENEPMRWDASQSMKRRWQLPARQQWFAEASPFSGVELREPARKGDPLSLEKFIADGTR |
| Ga0190266_112137611 | 3300017965 | Soil | KRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR |
| Ga0187783_102910761 | 3300017970 | Tropical Peatland | AGKRRWQLPARAMWFNEASRFRGVPPREPAHQREPMTLERYVAAAR |
| Ga0184608_100831162 | 3300018028 | Groundwater Sediment | PARQQWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR |
| Ga0187769_107217202 | 3300018086 | Tropical Peatland | AGKRRWQLPARAMWFAEASRFAGVEPKEPPAGRSPMTLERYVAAK |
| Ga0173482_102756122 | 3300019361 | Soil | QLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR |
| Ga0210392_102952711 | 3300021475 | Soil | LPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIAAGMR |
| Ga0210409_109730902 | 3300021559 | Soil | QQWFVEASRFAGVEPREPARKGEPLSLERFIAAGMR |
| Ga0224563_10253482 | 3300022731 | Soil | LPARGQWFTEASRFAGVETREPAHKGNPMTLEKYVAAK |
| Ga0224545_10231062 | 3300022881 | Soil | PARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK |
| Ga0179589_105975332 | 3300024288 | Vadose Zone Soil | AMQRRWQLPARRQWFVEASRFAGVAPREPTRKGEPLSLEKFIAAGMR |
| Ga0207663_109700891 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ASHAMQRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIADGMR |
| Ga0207657_110621151 | 3300025919 | Corn Rhizosphere | RQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGVR |
| Ga0207690_111228852 | 3300025932 | Corn Rhizosphere | RQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR |
| Ga0207669_107340362 | 3300025937 | Miscanthus Rhizosphere | LPARQQWFAEASPFSGVELREPARKGDPLSLEKFIAAGTR |
| Ga0207661_100922363 | 3300025944 | Corn Rhizosphere | PARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR |
| Ga0207648_120889402 | 3300026089 | Miscanthus Rhizosphere | YAAKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR |
| Ga0209152_105007441 | 3300026325 | Soil | RRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGIR |
| Ga0209056_101389683 | 3300026538 | Soil | RQWFVEASRFVGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0209729_10505611 | 3300027061 | Forest Soil | RRQWFVEASRFAGVEPREPAHKGDPMSLEKFIAADMR |
| Ga0209590_105216562 | 3300027882 | Vadose Zone Soil | IENEPVRWDLSHAAKRRWQLPARRQWFLEASRFSGVAPRDPDKKGDPMSLEKFIAAGMR |
| Ga0209006_103589843 | 3300027908 | Forest Soil | PARAMWFAEASHFAGVEPREPAHKGNPMTLERYVAAAK |
| Ga0209382_103994573 | 3300027909 | Populus Rhizosphere | AKRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR |
| Ga0265357_10000696 | 3300028023 | Rhizosphere | QLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK |
| Ga0307295_100379311 | 3300028708 | Soil | QSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR |
| Ga0307285_101852881 | 3300028712 | Soil | PARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR |
| Ga0307285_102213761 | 3300028712 | Soil | ASQSMKRRWQLPARQQWFAEASRFAGVALREPARKGDPLSLEKFVAAGMR |
| Ga0307282_100708811 | 3300028784 | Soil | RQWFHETSRFAGVEPRDPAKKGAPRSLEDFLAAGMR |
| Ga0307287_102840172 | 3300028796 | Soil | QSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFIAAGMR |
| Ga0307296_105268221 | 3300028819 | Soil | WDASQSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFIAAGMR |
| Ga0307277_101158031 | 3300028881 | Soil | QWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR |
| Ga0307497_105277912 | 3300031226 | Soil | QSMKRRWQLPARQQWFAEASRFAGVALREPARKGDPLSLEKFVAAGMR |
| Ga0302326_124905151 | 3300031525 | Palsa | AGKRRWQLPARARWFNEACPFVGVEPKEPAGGRAPMTLEKYVAAQ |
| Ga0318538_100926621 | 3300031546 | Soil | LTACRRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR |
| Ga0318538_105623851 | 3300031546 | Soil | IVSFTACRRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0318573_102925411 | 3300031564 | Soil | QLPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0318574_102958913 | 3300031680 | Soil | PARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0318502_101485311 | 3300031747 | Soil | WQLPARAVWFAEASRFAGVEPREPAHKGSPMTLERYVAAR |
| Ga0318537_103072032 | 3300031763 | Soil | RQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0318535_100013341 | 3300031764 | Soil | ASLAMKRRWQLPARRQWFIEASRFAGVEPRVPDRKGDPLSLEKFIAAGMR |
| Ga0318529_102917062 | 3300031792 | Soil | RWQLPVRRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR |
| Ga0318548_106221362 | 3300031793 | Soil | LPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAR |
| Ga0318503_102858962 | 3300031794 | Soil | QWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR |
| Ga0318497_101600111 | 3300031805 | Soil | RWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGMR |
| Ga0318511_101170962 | 3300031845 | Soil | LPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR |
| Ga0318536_102529872 | 3300031893 | Soil | RQWFIEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0318520_110717051 | 3300031897 | Soil | GKRRWQLPARAMWFAEASRFAGVEPRESAHKGNPMTLERYVAAR |
| Ga0306923_118442672 | 3300031910 | Soil | EPVRWDASFAMQRRWQLPARRQWFAEASRFTGVEPCEPSRKGDPLSLEKFLAAGTR |
| Ga0306921_111830181 | 3300031912 | Soil | DIENEPVRWDASVAMKRRWQLPARRQWFVEARRFAGVETREPARKGETMSLEKFVASGAR |
| Ga0310891_103566971 | 3300031913 | Soil | QWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR |
| Ga0310913_112306222 | 3300031945 | Soil | NEPVRWDASVAMKRRWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR |
| Ga0306926_107750561 | 3300031954 | Soil | SQAMKRRWQLPARRHWFVEASRFAGVEPREPARKGDPMSLEKFIAGGMR |
| Ga0318559_101381052 | 3300032039 | Soil | GWQLPARRQWFIEASRFAGVEPRVPDRKGDPLSLEKFIAAGMR |
| Ga0318558_105520141 | 3300032044 | Soil | RRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0311301_124513852 | 3300032160 | Peatlands Soil | RRWQLTARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK |
| Ga0307472_1001181003 | 3300032205 | Hardwood Forest Soil | VRWDASYAAKRRWQLPPRRQWYTEASLFAGVEPREPARRGDPFSLEKFLAVEK |
| Ga0335078_118515431 | 3300032805 | Soil | GKRRWQLPARACWFAEASRFGGVEPRAPAETRSPMTLEKYVAAK |
| Ga0335078_120403652 | 3300032805 | Soil | ARAQWYTQASRFLGVEPRDPDKKGNPMTLERYLAVAH |
| Ga0318519_101102321 | 3300033290 | Soil | ARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR |
| Ga0247830_101772533 | 3300033551 | Soil | QLPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR |
| ⦗Top⦘ |