


| Basic Information | |
|---|---|
| Family ID | F064906 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.91 % |
| % of genes near scaffold ends (potentially truncated) | 96.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.62 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.844 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.906 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.469 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.062 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF03668 | ATP_bind_2 | 59.38 |
| PF05643 | DUF799 | 3.91 |
| PF01769 | MgtE | 3.91 |
| PF08007 | JmjC_2 | 3.91 |
| PF00587 | tRNA-synt_2b | 3.91 |
| PF02482 | Ribosomal_S30AE | 3.91 |
| PF04552 | Sigma54_DBD | 3.12 |
| PF04963 | Sigma54_CBD | 2.34 |
| PF12686 | DUF3800 | 1.56 |
| PF00005 | ABC_tran | 1.56 |
| PF01807 | zf-CHC2 | 0.78 |
| PF00908 | dTDP_sugar_isom | 0.78 |
| PF02776 | TPP_enzyme_N | 0.78 |
| PF00593 | TonB_dep_Rec | 0.78 |
| PF12399 | BCA_ABC_TP_C | 0.78 |
| PF03968 | LptD_N | 0.78 |
| PF01380 | SIS | 0.78 |
| PF16068 | DUF4810 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 59.38 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 5.47 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 3.91 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 3.91 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 3.91 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 3.91 |
| COG4380 | Uncharacterized conserved protein, DUF799 domain | Function unknown [S] | 3.91 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.78 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.84 % |
| Unclassified | root | N/A | 10.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003331|Ga0006572J49612_1160275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 550 | Open in IMG/M |
| 3300005072|Ga0070923_1837658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 733 | Open in IMG/M |
| 3300005175|Ga0066673_10830160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
| 3300005179|Ga0066684_10913026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 572 | Open in IMG/M |
| 3300005332|Ga0066388_102484531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300005344|Ga0070661_100443627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300005435|Ga0070714_101163034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 752 | Open in IMG/M |
| 3300005444|Ga0070694_100970852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 704 | Open in IMG/M |
| 3300005529|Ga0070741_10637159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 947 | Open in IMG/M |
| 3300005530|Ga0070679_100988929 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005538|Ga0070731_10878695 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005538|Ga0070731_11190098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300005549|Ga0070704_102086924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300005614|Ga0068856_101989623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300005844|Ga0068862_101505355 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005921|Ga0070766_10442977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 856 | Open in IMG/M |
| 3300005994|Ga0066789_10439479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 545 | Open in IMG/M |
| 3300006176|Ga0070765_100976499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300006354|Ga0075021_10734952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
| 3300006578|Ga0074059_11766639 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300006806|Ga0079220_11984710 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006894|Ga0079215_10297049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 889 | Open in IMG/M |
| 3300009545|Ga0105237_11914308 | Not Available | 601 | Open in IMG/M |
| 3300010159|Ga0099796_10522022 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010373|Ga0134128_12728509 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010376|Ga0126381_101433046 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300012357|Ga0137384_10276179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1400 | Open in IMG/M |
| 3300012917|Ga0137395_10984973 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012918|Ga0137396_10240113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1335 | Open in IMG/M |
| 3300012922|Ga0137394_10384392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 1197 | Open in IMG/M |
| 3300012940|Ga0164243_10856548 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012988|Ga0164306_10821695 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300016270|Ga0182036_10125475 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300016341|Ga0182035_10460137 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300016341|Ga0182035_11503910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 606 | Open in IMG/M |
| 3300016357|Ga0182032_10014903 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300016357|Ga0182032_10976484 | Not Available | 723 | Open in IMG/M |
| 3300016387|Ga0182040_11804192 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300016422|Ga0182039_12038641 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300016445|Ga0182038_10169619 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300017927|Ga0187824_10033496 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300017927|Ga0187824_10210285 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300017930|Ga0187825_10097888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300017961|Ga0187778_10625818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 723 | Open in IMG/M |
| 3300020170|Ga0179594_10010156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2596 | Open in IMG/M |
| 3300021088|Ga0210404_10462406 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021088|Ga0210404_10588086 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021405|Ga0210387_10361259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1284 | Open in IMG/M |
| 3300021406|Ga0210386_10374002 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300021433|Ga0210391_10128898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1992 | Open in IMG/M |
| 3300021444|Ga0213878_10226853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 790 | Open in IMG/M |
| 3300021476|Ga0187846_10282012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 688 | Open in IMG/M |
| 3300021478|Ga0210402_12031843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300022903|Ga0247774_1009953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3467 | Open in IMG/M |
| 3300023270|Ga0247784_1045488 | Not Available | 1066 | Open in IMG/M |
| 3300023270|Ga0247784_1128616 | Not Available | 654 | Open in IMG/M |
| 3300025911|Ga0207654_11119684 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025914|Ga0207671_10866709 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300025929|Ga0207664_10298705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1416 | Open in IMG/M |
| 3300025941|Ga0207711_12126526 | Not Available | 504 | Open in IMG/M |
| 3300025942|Ga0207689_10351611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300025949|Ga0207667_10199948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2050 | Open in IMG/M |
| 3300025986|Ga0207658_11555217 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300026298|Ga0209236_1248407 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300026300|Ga0209027_1143800 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300026701|Ga0208577_101273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300027109|Ga0208603_1031348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300027388|Ga0208995_1003184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2676 | Open in IMG/M |
| 3300027587|Ga0209220_1016570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1963 | Open in IMG/M |
| 3300027616|Ga0209106_1010819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1917 | Open in IMG/M |
| 3300027669|Ga0208981_1027321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 1458 | Open in IMG/M |
| 3300027821|Ga0209811_10292520 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027826|Ga0209060_10579002 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027869|Ga0209579_10153057 | Not Available | 1230 | Open in IMG/M |
| 3300028380|Ga0268265_10463755 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300028877|Ga0302235_10345463 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300028906|Ga0308309_11660345 | Not Available | 543 | Open in IMG/M |
| 3300029997|Ga0302302_1126333 | Not Available | 1018 | Open in IMG/M |
| 3300030503|Ga0311370_12244550 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300030520|Ga0311372_10433040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1972 | Open in IMG/M |
| 3300030743|Ga0265461_10764414 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300030862|Ga0265753_1051081 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031057|Ga0170834_103622103 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031507|Ga0307509_10797416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300031544|Ga0318534_10034049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2795 | Open in IMG/M |
| 3300031544|Ga0318534_10272186 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300031544|Ga0318534_10793498 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031681|Ga0318572_10832575 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031723|Ga0318493_10860334 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031724|Ga0318500_10164181 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031748|Ga0318492_10119589 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300031748|Ga0318492_10788190 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031751|Ga0318494_10570413 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031753|Ga0307477_11129570 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031754|Ga0307475_11034113 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031769|Ga0318526_10273145 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031778|Ga0318498_10516348 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031778|Ga0318498_10542862 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031796|Ga0318576_10069268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1565 | Open in IMG/M |
| 3300031798|Ga0318523_10039908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2168 | Open in IMG/M |
| 3300031805|Ga0318497_10392963 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031819|Ga0318568_10652659 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031823|Ga0307478_10356771 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300031835|Ga0318517_10536052 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031845|Ga0318511_10130624 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031896|Ga0318551_10010999 | All Organisms → cellular organisms → Bacteria | 3932 | Open in IMG/M |
| 3300031896|Ga0318551_10646203 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031897|Ga0318520_10542263 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031910|Ga0306923_10106403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3170 | Open in IMG/M |
| 3300031941|Ga0310912_10707608 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031962|Ga0307479_10677120 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300032044|Ga0318558_10137754 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300032044|Ga0318558_10353679 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300032054|Ga0318570_10281723 | Not Available | 755 | Open in IMG/M |
| 3300032065|Ga0318513_10045446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1951 | Open in IMG/M |
| 3300032065|Ga0318513_10156686 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300032065|Ga0318513_10553159 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300032074|Ga0308173_11584512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300032091|Ga0318577_10597955 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032805|Ga0335078_10004211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 21348 | Open in IMG/M |
| 3300032805|Ga0335078_11426646 | Not Available | 780 | Open in IMG/M |
| 3300032896|Ga0335075_10143648 | Not Available | 2997 | Open in IMG/M |
| 3300032896|Ga0335075_10777644 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300032896|Ga0335075_11230423 | Not Available | 647 | Open in IMG/M |
| 3300032955|Ga0335076_10568035 | Not Available | 1017 | Open in IMG/M |
| 3300033158|Ga0335077_12147784 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033289|Ga0310914_10525177 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300033829|Ga0334854_002994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4127 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.78% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Compost | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost | 0.78% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003331 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-R (Metagenome Metatranscriptome, Counting Only) | Engineered | Open in IMG/M |
| 3300005072 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 64 soap2 | Engineered | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026701 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN407 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0006572J49612_11602752 | 3300003331 | Ionic Liquid And High Solid Enriched | RELIELGYRDAMEARDELLAFMSGEKVPPAIATPTVAETSEAT* |
| Ga0070923_18376581 | 3300005072 | Compost | YTRELIELGYRDAMEARDELLAFMSGEKVPPAIATPTVAETSEAT* |
| Ga0066673_108301601 | 3300005175 | Soil | GYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT* |
| Ga0066684_109130261 | 3300005179 | Soil | LMFEAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT* |
| Ga0066388_1024845311 | 3300005332 | Tropical Forest Soil | YTRALIELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT* |
| Ga0070661_1004436271 | 3300005344 | Corn Rhizosphere | ESGYTRELIELGYRDAMEAREALDAFMSGEKTPQVVATSPGVVAQAT* |
| Ga0070714_1011630342 | 3300005435 | Agricultural Soil | ALIELGYRDAMEARAALVAFMSGERLPPLMTAAGVAQAT* |
| Ga0070694_1009708521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT* |
| Ga0070741_106371592 | 3300005529 | Surface Soil | SGYTRALIELGYRDAMEARAAILAFMSGEKLPPVLTSPGVAQAT* |
| Ga0070679_1009889292 | 3300005530 | Corn Rhizosphere | ALIELGYRDAMEARTPLLAFMGGEKLPQVMTAPGVAQVT* |
| Ga0070731_108786951 | 3300005538 | Surface Soil | RALIELGYRDAMDARAAIMAFMSGEKLPPVLTSPGVAQAT* |
| Ga0070731_111900982 | 3300005538 | Surface Soil | FESGYTRALIELGYRDAMDARAAIIAFMSGEKLPPVLTSPGVAQAT* |
| Ga0070704_1020869241 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAMIELGYRDAMQARTALVAFMSGEKLPHVMTAPGVAQAT* |
| Ga0068856_1019896231 | 3300005614 | Corn Rhizosphere | ESGYTRALIELGYRDAMEARAAIMAFMSGEKLPPVLTSPGVAQAT* |
| Ga0068862_1015053552 | 3300005844 | Switchgrass Rhizosphere | LIELGYRDATEARSTLLAFMSGEKTPQAAAAPGVVAQAT* |
| Ga0070766_104429771 | 3300005921 | Soil | TRALIELGYRDAMEARAALQAFMEGEKLPQVMTAAGVAQAT* |
| Ga0066789_104394792 | 3300005994 | Soil | GYTRELIELGYKDAMEARTTLLAFMTGEALPSVITAAGVTQAT* |
| Ga0070765_1009764992 | 3300006176 | Soil | GYTRALIELGYRDAMEARAAIMAFMSGEKLPPVLTSPGVAQAT* |
| Ga0075021_107349521 | 3300006354 | Watersheds | GYTRALIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT* |
| Ga0074059_117666392 | 3300006578 | Soil | LVELGYRDAMQARTALVAFMSGEKLPHVMTAPGVAQAT* |
| Ga0079220_119847101 | 3300006806 | Agricultural Soil | LIELGYRDAMEARSALVAFMSGERLPPLMTAAGVAQAT* |
| Ga0079215_102970492 | 3300006894 | Agricultural Soil | FESSYTRELIELGYRDAMEARTTLVAFMSGENLPSVVTAPGVAQAT* |
| Ga0105237_119143082 | 3300009545 | Corn Rhizosphere | ELIELGYRDAMEARGALDAFMSGEKTPQVVDTAPGVVAQAT* |
| Ga0099796_105220222 | 3300010159 | Vadose Zone Soil | VKHLIELGYRDAMEARSALLAFMSGEKLPQVMTAAGVAQAT* |
| Ga0134128_127285092 | 3300010373 | Terrestrial Soil | YLTFESGYTRALIELGYRDAMEARAAIMAFMSGEKLPPVLTSPGVAQAT* |
| Ga0126381_1014330461 | 3300010376 | Tropical Forest Soil | AGYTRALIELGYRDAMEARGALLAFMSGERLPGVMTAAGVAQAT* |
| Ga0137384_102761791 | 3300012357 | Vadose Zone Soil | ALIELGYRDAMEARGGITAFMSGEKLPTVMTAAGVAQAT* |
| Ga0137395_109849732 | 3300012917 | Vadose Zone Soil | FEAGYTRALIELGYRDAMEARSALLAFMSGEKLPQVMTAAGVAQAT* |
| Ga0137396_102401131 | 3300012918 | Vadose Zone Soil | ALIELGYRDAMEARAALTAFMSGEKLPQVMTAAGVAQAT* |
| Ga0137394_103843921 | 3300012922 | Vadose Zone Soil | ALIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT* |
| Ga0164243_108565481 | 3300012940 | Compost | TRELIELGYRDAMEARCALRAFVTGEQLPSLLTSPGVAQAT* |
| Ga0164306_108216952 | 3300012988 | Soil | YTRAMIELGYRDAMQARTALVAFMSGEKLPHVMTAPGVAQAT* |
| Ga0182036_101254751 | 3300016270 | Soil | ELGYRDAMEARSALVAFMGGEKLPQLMTAAGVAQAT |
| Ga0182035_104601371 | 3300016341 | Soil | ESGYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0182035_115039103 | 3300016341 | Soil | ALIELGYRDAMEARAALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0182032_100149036 | 3300016357 | Soil | FEAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0182032_109764842 | 3300016357 | Soil | ELGYRDAMEVQPALLAFMSGERSPPVLTAPVVAQST |
| Ga0182040_118041921 | 3300016387 | Soil | YTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0182039_120386412 | 3300016422 | Soil | LIELGYRDAMEARAALMAFMSGEKLPQLMTAAAVAQVSS |
| Ga0182038_101696194 | 3300016445 | Soil | RALIELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT |
| Ga0187824_100334964 | 3300017927 | Freshwater Sediment | YTRALIELGYRDAMEARTPLLAFMGGEKLPQVMTASGVAQVT |
| Ga0187824_102102851 | 3300017927 | Freshwater Sediment | SGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0187825_100978881 | 3300017930 | Freshwater Sediment | SGYTRALIELGYRDAMEARTALLAFMGGEKLPQMLTASGVAQLT |
| Ga0187778_106258181 | 3300017961 | Tropical Peatland | GYTRALIELGYRDAMEARSALVAFMSGARLPAVLTAPGVAQAT |
| Ga0179594_100101564 | 3300020170 | Vadose Zone Soil | LIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT |
| Ga0210404_104624062 | 3300021088 | Soil | MFEAGYTRALIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT |
| Ga0210404_105880861 | 3300021088 | Soil | ALIELGYRDAMEARAAIMAFMSGEKLPPVLTSPGVAQATS |
| Ga0210387_103612593 | 3300021405 | Soil | AYTRALIELGYRDAMQARTALIAFMSGERLPQVMTSPGVAQVT |
| Ga0210386_103740023 | 3300021406 | Soil | LIELGYRDAMQARAAIMAFMSGEKLPPVMTSPGVAQAT |
| Ga0210391_101288981 | 3300021433 | Soil | AAYTRALIELGYRDAMQARTALIAFMSGERLPQVMTSPGVAQVT |
| Ga0213878_102268532 | 3300021444 | Bulk Soil | ALIELGYRDAMEARGALVAFMSGARLPAVLTAPGVAQAT |
| Ga0187846_102820121 | 3300021476 | Biofilm | LIFEAGYTRALIELGYRDAMEARSALVAFMSGARLPAVLTAPGVAQAT |
| Ga0210402_120318431 | 3300021478 | Soil | GYTRALIELGYRDAMEARLPLTAFMSGEKLPQVMTAAGVAQAT |
| Ga0247774_10099531 | 3300022903 | Plant Litter | RDLIQLGYRDAMEARTCLLAFVQGETLPSVMTSPGVAQAT |
| Ga0247784_10454881 | 3300023270 | Plant Litter | ELIELGYKDAMEARTALLAFIEGETLPKVMTSAGVAQAT |
| Ga0247784_11286162 | 3300023270 | Plant Litter | TRELIELGYKDAMEARTALLAFIEGETLPKVMTSAGVAQAT |
| Ga0207654_111196842 | 3300025911 | Corn Rhizosphere | YLMFEAGYTRAMIELGYRDAMQARTALVAFMSGEKLPHVMTAPGVAQAT |
| Ga0207671_108667091 | 3300025914 | Corn Rhizosphere | IELGYRDAMEAREALDAFMSGEKTPQVVAKAPGVVAQAT |
| Ga0207664_102987053 | 3300025929 | Agricultural Soil | TRALIELGYRDAMEARAALVAFMSGERLPPLMTAAGVAQAT |
| Ga0207711_121265262 | 3300025941 | Switchgrass Rhizosphere | ELIELGYRDAMEARGALDAFMSGEKTPQVVDTAPGVVAQAT |
| Ga0207689_103516112 | 3300025942 | Miscanthus Rhizosphere | MFESGYTRELIELGYKDAMDARCALNAFVMGEQLPSVITSPGVAQAT |
| Ga0207667_101999485 | 3300025949 | Corn Rhizosphere | YRDAMEAREALDAFMSGEKTPQVVATSPGVVAQAT |
| Ga0207658_115552171 | 3300025986 | Switchgrass Rhizosphere | GYRDAMEAREALDAFMSGEKTPQVVATSPGVVAQAT |
| Ga0209236_12484071 | 3300026298 | Grasslands Soil | ELGYRDAMEARGGITAFMSGEKLPTVMTAAGVAQAT |
| Ga0209027_11438002 | 3300026300 | Grasslands Soil | GYTRALIELGYRDAMEARSALTAFMCGEKLPQVMTAAGVAQAT |
| Ga0208577_1012731 | 3300026701 | Soil | GYTRALIELGYRDAMEARSALLAFMSGEKLPQVMTAAGVAQAT |
| Ga0208603_10313482 | 3300027109 | Forest Soil | MFEAGYTRALIELGYRDAMQARTALIAFMSGEKLPEVISAPGVAQAT |
| Ga0208995_10031844 | 3300027388 | Forest Soil | ALIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT |
| Ga0209220_10165704 | 3300027587 | Forest Soil | LGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT |
| Ga0209106_10108191 | 3300027616 | Forest Soil | LMFEAGYTRALIELGYRDAMEARSALTAFMSGEKLPQVMTAAGVAQAT |
| Ga0208981_10273211 | 3300027669 | Forest Soil | ELGYRDAMEARSALLAFMSGEKLPQVMTAAGVAQAT |
| Ga0209811_102925201 | 3300027821 | Surface Soil | VCAQAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0209060_105790022 | 3300027826 | Surface Soil | EAGYTRALIELGYRDAMEARGALLAFMEGEKLPQVMTAAGVAQAT |
| Ga0209579_101530572 | 3300027869 | Surface Soil | ELIELGYRDAMDARAALLAFMEGERLPPVLTSPGVAQAT |
| Ga0268265_104637551 | 3300028380 | Switchgrass Rhizosphere | LIELGYRDATEARSTLLAFMSGEKTPQAAAAPGVVAQAT |
| Ga0302235_103454631 | 3300028877 | Palsa | MFEAGYTRALIELGYRDAMEARSALIAFMSGEKLPQVMTAAGVAQAT |
| Ga0308309_116603452 | 3300028906 | Soil | ALIELGYRDAMQARTALLAFMSGEKLPTVMTAPGVVQAT |
| Ga0302302_11263331 | 3300029997 | Palsa | RALIELGYRDAMQARIALIAFMSGERLPQVMTSPGVAQVT |
| Ga0311370_122445501 | 3300030503 | Palsa | RELIELGYRDATEARATIMAFMSGEKLPPVLTSPGVAQAT |
| Ga0311372_104330404 | 3300030520 | Palsa | IELGYRDAMEARAAIMAFMSGEKLPPVLTSPGVAQAT |
| Ga0265461_107644142 | 3300030743 | Soil | MFEAGYTRALIELGYRDAMEARGALLAFMSGEKLPAVMTAAGVAQAT |
| Ga0265753_10510811 | 3300030862 | Soil | LGYRDAMEARGALLAFMSGEKLPAVMTAAGVTQAT |
| Ga0170834_1036221031 | 3300031057 | Forest Soil | EVGYTRALIELGYRDDMEARGALLAFMSGEKLPAVMTAAGVAQAT |
| Ga0307509_107974162 | 3300031507 | Ectomycorrhiza | GEYTRELIELGYKDAMEARTALLAFIEGENLPNVMTSPGVAQAT |
| Ga0318534_100340494 | 3300031544 | Soil | IELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318534_102721861 | 3300031544 | Soil | YLTFESGYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318534_107934982 | 3300031544 | Soil | LIELGYRDAMEARAALLAFMSGEKLPQVLTAAGVAQAT |
| Ga0318572_108325751 | 3300031681 | Soil | RALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318493_108603341 | 3300031723 | Soil | GYTRALIELGYRDALEARTALLAFMSGEKLPQVMTAAGVAQAT |
| Ga0318500_101641812 | 3300031724 | Soil | LTFEAGYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318492_101195893 | 3300031748 | Soil | GYTRALIELGYRDAMEARSALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0318492_107881902 | 3300031748 | Soil | YLTFEAGYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318494_105704131 | 3300031751 | Soil | IELGYRDAMEARSALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0307477_111295701 | 3300031753 | Hardwood Forest Soil | FEAGYTRALIELGYRDAMEARSALLAFMSGARLPAVLTAPGVAQAT |
| Ga0307475_110341131 | 3300031754 | Hardwood Forest Soil | EAGYTRALIELGYRDAMEARSALGAFMGGEKLPQVMTAAGVAQAT |
| Ga0318526_102731452 | 3300031769 | Soil | GYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318498_105163482 | 3300031778 | Soil | ERGYTRALIELGYRDAMEARSALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0318498_105428622 | 3300031778 | Soil | GYTRAHIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318576_100692683 | 3300031796 | Soil | LIELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT |
| Ga0318523_100399081 | 3300031798 | Soil | IELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318497_103929632 | 3300031805 | Soil | IELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT |
| Ga0318568_106526592 | 3300031819 | Soil | TRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0307478_103567711 | 3300031823 | Hardwood Forest Soil | YTRELIELGYHDAMEARDALLAFMHGERTPQVVESVPGVVAQAT |
| Ga0318517_105360522 | 3300031835 | Soil | ELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318511_101306242 | 3300031845 | Soil | GYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318551_100109991 | 3300031896 | Soil | LIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318551_106462031 | 3300031896 | Soil | LIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318520_105422631 | 3300031897 | Soil | GYTRALIELGYRDAMEARAALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0306923_101064035 | 3300031910 | Soil | FEAGYTRALIELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT |
| Ga0310912_107076081 | 3300031941 | Soil | TFEGGYTRALIELGYRDAMEARAALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0307479_106771202 | 3300031962 | Hardwood Forest Soil | LIELGYKDAMEARAAIMAFMSGEKLPPMLTSPGVAQAT |
| Ga0318558_101377541 | 3300032044 | Soil | TRALIELGYRDAMEARSALVAFMGGEKLPQVMTAAGVAQAT |
| Ga0318558_103536791 | 3300032044 | Soil | FEAGYTRALIELGYRDAMEARTALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318570_102817232 | 3300032054 | Soil | SSAGYTRELIELGYRDAMEVQPALLAFMSGERSPPVLTAPVVAQST |
| Ga0318513_100454461 | 3300032065 | Soil | LTFEAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0318513_101566861 | 3300032065 | Soil | TRALIELGYRDAMEARAALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0318513_105531592 | 3300032065 | Soil | LGYRDAMEARSALMAFMGGEKLPQVMTAAGVAQAT |
| Ga0308173_115845122 | 3300032074 | Soil | FEGEYTRELIELGYKDAMEARTALLAFIEGETLPNVLTSPGVAQAT |
| Ga0318577_105979552 | 3300032091 | Soil | YLTFEAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0335078_100042111 | 3300032805 | Soil | FEAAYTRALIELGYRDAMEARAALAAFMSGAQLPPLMTAPGVAQAT |
| Ga0335078_114266462 | 3300032805 | Soil | RELIELGYRDAMEARHALVAFVSGEQLPPVLATPGVAQAT |
| Ga0335075_101436481 | 3300032896 | Soil | IELGYRDAMEARTALVAFMSGERLPSVLAASGVAQAT |
| Ga0335075_107776442 | 3300032896 | Soil | LGYRDAMEARTALVAFMNGERLPPLMTAAGVAQAT |
| Ga0335075_112304231 | 3300032896 | Soil | MFEAGYTRELIALGYRDAMEARTALVAFMSGERLPPVLTAPGVAQAT |
| Ga0335076_105680352 | 3300032955 | Soil | TRELIELGYRDAMDARAALLAFMEGERLPPVLTSPGVAQAT |
| Ga0335077_121477842 | 3300033158 | Soil | FESGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0310914_105251771 | 3300033289 | Soil | EAGYTRALIELGYRDAMEARSALMAFMSGEKLPQVMTAAGVAQAT |
| Ga0334854_002994_4001_4126 | 3300033829 | Soil | YTRELIELGYRDAMDARVALMAFMRGETLPAFVTAAGVTQA |
| ⦗Top⦘ |