


| Basic Information | |
|---|---|
| Family ID | F064874 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.41 % |
| % of genes near scaffold ends (potentially truncated) | 92.97 % |
| % of genes from short scaffolds (< 2000 bps) | 91.41 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.250 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (32.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.438 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.34 |
| PF00872 | Transposase_mut | 2.34 |
| PF00106 | adh_short | 1.56 |
| PF02627 | CMD | 1.56 |
| PF13359 | DDE_Tnp_4 | 1.56 |
| PF06508 | QueC | 1.56 |
| PF03050 | DDE_Tnp_IS66 | 1.56 |
| PF01609 | DDE_Tnp_1 | 1.56 |
| PF13358 | DDE_3 | 1.56 |
| PF09344 | Cas_CT1975 | 0.78 |
| PF13730 | HTH_36 | 0.78 |
| PF13592 | HTH_33 | 0.78 |
| PF14104 | DUF4277 | 0.78 |
| PF13612 | DDE_Tnp_1_3 | 0.78 |
| PF13586 | DDE_Tnp_1_2 | 0.78 |
| PF02371 | Transposase_20 | 0.78 |
| PF13518 | HTH_28 | 0.78 |
| PF08388 | GIIM | 0.78 |
| PF00264 | Tyrosinase | 0.78 |
| PF00589 | Phage_integrase | 0.78 |
| PF13005 | zf-IS66 | 0.78 |
| PF13551 | HTH_29 | 0.78 |
| PF13614 | AAA_31 | 0.78 |
| PF13613 | HTH_Tnp_4 | 0.78 |
| PF02796 | HTH_7 | 0.78 |
| PF05057 | DUF676 | 0.78 |
| PF13271 | DUF4062 | 0.78 |
| PF00691 | OmpA | 0.78 |
| PF10134 | RPA | 0.78 |
| PF12762 | DDE_Tnp_IS1595 | 0.78 |
| PF10282 | Lactonase | 0.78 |
| PF12704 | MacB_PCD | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF00884 | Sulfatase | 0.78 |
| PF03683 | UPF0175 | 0.78 |
| PF13524 | Glyco_trans_1_2 | 0.78 |
| PF00924 | MS_channel | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.34 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 2.34 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.56 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.56 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.56 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.56 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.56 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.56 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.56 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.56 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.56 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.78 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.25 % |
| All Organisms | root | All Organisms | 43.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111006|2214758282 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 850 | Open in IMG/M |
| 3300005289|Ga0065704_10342423 | Not Available | 821 | Open in IMG/M |
| 3300005294|Ga0065705_10152783 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300005294|Ga0065705_10700303 | Not Available | 653 | Open in IMG/M |
| 3300005294|Ga0065705_11142376 | Not Available | 507 | Open in IMG/M |
| 3300005295|Ga0065707_10883596 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005332|Ga0066388_100865862 | Not Available | 1487 | Open in IMG/M |
| 3300005332|Ga0066388_101171376 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300005332|Ga0066388_101463593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1192 | Open in IMG/M |
| 3300005332|Ga0066388_103438397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300005332|Ga0066388_107140945 | Not Available | 562 | Open in IMG/M |
| 3300005332|Ga0066388_107706395 | Not Available | 539 | Open in IMG/M |
| 3300005332|Ga0066388_108758581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300005447|Ga0066689_10832427 | Not Available | 573 | Open in IMG/M |
| 3300005552|Ga0066701_10149138 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005552|Ga0066701_10825492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 551 | Open in IMG/M |
| 3300005558|Ga0066698_10948187 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005562|Ga0058697_10093280 | Not Available | 1236 | Open in IMG/M |
| 3300005562|Ga0058697_10274352 | Not Available | 795 | Open in IMG/M |
| 3300005562|Ga0058697_10336667 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005562|Ga0058697_10400198 | Not Available | 680 | Open in IMG/M |
| 3300005562|Ga0058697_10629506 | Not Available | 563 | Open in IMG/M |
| 3300005568|Ga0066703_10701606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 582 | Open in IMG/M |
| 3300005764|Ga0066903_100156693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum | 3289 | Open in IMG/M |
| 3300005764|Ga0066903_100761378 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300005764|Ga0066903_101127139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea | 1449 | Open in IMG/M |
| 3300005764|Ga0066903_101470719 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300005764|Ga0066903_103388492 | Not Available | 860 | Open in IMG/M |
| 3300005764|Ga0066903_104099414 | Not Available | 780 | Open in IMG/M |
| 3300005764|Ga0066903_104299050 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005764|Ga0066903_104443412 | Not Available | 748 | Open in IMG/M |
| 3300005764|Ga0066903_104766158 | Not Available | 721 | Open in IMG/M |
| 3300005764|Ga0066903_107099940 | Not Available | 580 | Open in IMG/M |
| 3300005764|Ga0066903_107774625 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005764|Ga0066903_108977182 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006032|Ga0066696_10126692 | Not Available | 1568 | Open in IMG/M |
| 3300006049|Ga0075417_10085316 | Not Available | 1415 | Open in IMG/M |
| 3300006049|Ga0075417_10090192 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300006049|Ga0075417_10093370 | Not Available | 1357 | Open in IMG/M |
| 3300006049|Ga0075417_10170363 | Not Available | 1020 | Open in IMG/M |
| 3300006049|Ga0075417_10477249 | Not Available | 624 | Open in IMG/M |
| 3300006049|Ga0075417_10510994 | Not Available | 604 | Open in IMG/M |
| 3300006058|Ga0075432_10175129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 836 | Open in IMG/M |
| 3300006194|Ga0075427_10004815 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300006194|Ga0075427_10009284 | Not Available | 1464 | Open in IMG/M |
| 3300006194|Ga0075427_10031275 | Not Available | 874 | Open in IMG/M |
| 3300006194|Ga0075427_10036573 | Not Available | 818 | Open in IMG/M |
| 3300006844|Ga0075428_100161204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2434 | Open in IMG/M |
| 3300006844|Ga0075428_100254110 | Not Available | 1893 | Open in IMG/M |
| 3300006844|Ga0075428_100257069 | Not Available | 1881 | Open in IMG/M |
| 3300006844|Ga0075428_100358894 | Not Available | 1563 | Open in IMG/M |
| 3300006844|Ga0075428_100384132 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300006844|Ga0075428_100521962 | Not Available | 1270 | Open in IMG/M |
| 3300006844|Ga0075428_102116601 | Not Available | 582 | Open in IMG/M |
| 3300006844|Ga0075428_102209832 | Not Available | 567 | Open in IMG/M |
| 3300006845|Ga0075421_100263290 | Not Available | 2109 | Open in IMG/M |
| 3300006845|Ga0075421_100455050 | Not Available | 1528 | Open in IMG/M |
| 3300006845|Ga0075421_100577494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1324 | Open in IMG/M |
| 3300006845|Ga0075421_100627873 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300006845|Ga0075421_100980249 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300006846|Ga0075430_100130980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2090 | Open in IMG/M |
| 3300006846|Ga0075430_101119193 | Not Available | 648 | Open in IMG/M |
| 3300006846|Ga0075430_101207581 | Not Available | 622 | Open in IMG/M |
| 3300006846|Ga0075430_101602807 | Not Available | 534 | Open in IMG/M |
| 3300006847|Ga0075431_100950987 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006847|Ga0075431_101177373 | Not Available | 730 | Open in IMG/M |
| 3300006847|Ga0075431_101415999 | Not Available | 654 | Open in IMG/M |
| 3300006852|Ga0075433_10255773 | Not Available | 1553 | Open in IMG/M |
| 3300006871|Ga0075434_101803963 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006880|Ga0075429_100450688 | Not Available | 1127 | Open in IMG/M |
| 3300006880|Ga0075429_100617871 | Not Available | 950 | Open in IMG/M |
| 3300006904|Ga0075424_102067624 | Not Available | 600 | Open in IMG/M |
| 3300006969|Ga0075419_10080488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2073 | Open in IMG/M |
| 3300006969|Ga0075419_10098873 | Not Available | 1874 | Open in IMG/M |
| 3300006969|Ga0075419_10620338 | Not Available | 761 | Open in IMG/M |
| 3300009038|Ga0099829_10791001 | Not Available | 788 | Open in IMG/M |
| 3300009090|Ga0099827_11521061 | Not Available | 583 | Open in IMG/M |
| 3300009100|Ga0075418_10102911 | Not Available | 3031 | Open in IMG/M |
| 3300009100|Ga0075418_11305432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum | 787 | Open in IMG/M |
| 3300009147|Ga0114129_11991668 | Not Available | 702 | Open in IMG/M |
| 3300010047|Ga0126382_10544786 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300010145|Ga0126321_1229865 | Not Available | 898 | Open in IMG/M |
| 3300010398|Ga0126383_13049921 | Not Available | 547 | Open in IMG/M |
| 3300012199|Ga0137383_10027147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4002 | Open in IMG/M |
| 3300012210|Ga0137378_10904994 | Not Available | 795 | Open in IMG/M |
| 3300012212|Ga0150985_101569672 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1397 | Open in IMG/M |
| 3300012351|Ga0137386_11198728 | Not Available | 531 | Open in IMG/M |
| 3300012469|Ga0150984_112653882 | Not Available | 656 | Open in IMG/M |
| 3300012961|Ga0164302_11126524 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012971|Ga0126369_10271352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1681 | Open in IMG/M |
| 3300015371|Ga0132258_11803445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300015372|Ga0132256_100011312 | All Organisms → cellular organisms → Bacteria | 7739 | Open in IMG/M |
| 3300015374|Ga0132255_100009110 | All Organisms → cellular organisms → Bacteria | 11514 | Open in IMG/M |
| 3300015374|Ga0132255_100897633 | Not Available | 1325 | Open in IMG/M |
| 3300015374|Ga0132255_100997656 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300015374|Ga0132255_102067014 | Not Available | 868 | Open in IMG/M |
| 3300015374|Ga0132255_106145891 | Not Available | 508 | Open in IMG/M |
| 3300016319|Ga0182033_10202946 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1578 | Open in IMG/M |
| 3300016319|Ga0182033_11387094 | Not Available | 633 | Open in IMG/M |
| 3300016319|Ga0182033_11813834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300016371|Ga0182034_10295915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1295 | Open in IMG/M |
| 3300016404|Ga0182037_11998823 | Not Available | 520 | Open in IMG/M |
| 3300016422|Ga0182039_11028052 | Not Available | 740 | Open in IMG/M |
| 3300026312|Ga0209153_1047707 | Not Available | 1511 | Open in IMG/M |
| 3300026323|Ga0209472_1072926 | Not Available | 1412 | Open in IMG/M |
| 3300027874|Ga0209465_10032563 | Not Available | 2459 | Open in IMG/M |
| 3300028587|Ga0247828_10432524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 766 | Open in IMG/M |
| 3300028587|Ga0247828_11233499 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031572|Ga0318515_10078401 | Not Available | 1709 | Open in IMG/M |
| 3300031681|Ga0318572_10587330 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 664 | Open in IMG/M |
| 3300031682|Ga0318560_10313523 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031748|Ga0318492_10101460 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300031793|Ga0318548_10354406 | Not Available | 720 | Open in IMG/M |
| 3300031798|Ga0318523_10356437 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031833|Ga0310917_10330939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1032 | Open in IMG/M |
| 3300031912|Ga0306921_11076828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 902 | Open in IMG/M |
| 3300031941|Ga0310912_10949825 | Not Available | 660 | Open in IMG/M |
| 3300031947|Ga0310909_10155474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides | 1883 | Open in IMG/M |
| 3300031995|Ga0307409_100229222 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300031995|Ga0307409_101368667 | Not Available | 734 | Open in IMG/M |
| 3300032054|Ga0318570_10540408 | Not Available | 532 | Open in IMG/M |
| 3300032060|Ga0318505_10295240 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 764 | Open in IMG/M |
| 3300032065|Ga0318513_10630646 | Not Available | 525 | Open in IMG/M |
| 3300032180|Ga0307471_101738492 | Not Available | 777 | Open in IMG/M |
| 3300032261|Ga0306920_104325651 | Not Available | 510 | Open in IMG/M |
| 3300032261|Ga0306920_104380735 | Not Available | 506 | Open in IMG/M |
| 3300034678|Ga0314803_016774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi | 1048 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 32.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.91% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.34% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2213772827 | 2209111006 | Arabidopsis Rhizosphere | GQQMMPNNVGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVPP |
| Ga0065704_103424232 | 3300005289 | Switchgrass Rhizosphere | GYALKAGQLTYDCRYSTIHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0065705_101527834 | 3300005294 | Switchgrass Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP* |
| Ga0065705_107003031 | 3300005294 | Switchgrass Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNGVPP* |
| Ga0065705_111423762 | 3300005294 | Switchgrass Rhizosphere | LYILFDGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNG |
| Ga0065707_108835961 | 3300005295 | Switchgrass Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVIGGRGFRGLKPLWYNGVPP* |
| Ga0066388_1008658621 | 3300005332 | Tropical Forest Soil | GYLLKVGQLEYDCRYSKMHDMPVTGGRSFRSLKPLWYKGVPP* |
| Ga0066388_1011713761 | 3300005332 | Tropical Forest Soil | MGPKTGGPGYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNG |
| Ga0066388_1014635934 | 3300005332 | Tropical Forest Soil | LKAGQWTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0066388_1034383973 | 3300005332 | Tropical Forest Soil | GYPLKAGQLTYDCRYSTMHGMPVTGSRGFRGLKPLWYNGVPP* |
| Ga0066388_1069517341 | 3300005332 | Tropical Forest Soil | MEPLSPIARGEITGYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNG |
| Ga0066388_1071409451 | 3300005332 | Tropical Forest Soil | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP* |
| Ga0066388_1077063951 | 3300005332 | Tropical Forest Soil | GYPLKAGQLGYDCRYSKMHGMPVTGGRGFRGLKPWWYNSVPP* |
| Ga0066388_1087585812 | 3300005332 | Tropical Forest Soil | LKVGQLEYDCRYSKMYGMPVAGGRGFSALKPLWYKGVPP* |
| Ga0066689_108324272 | 3300005447 | Soil | GYPLKAGQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0066701_101491384 | 3300005552 | Soil | MSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGV |
| Ga0066701_108254923 | 3300005552 | Soil | QLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0066698_109481872 | 3300005558 | Soil | MSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGRGFRG |
| Ga0058697_100932801 | 3300005562 | Agave | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRALKPLWYNGVPP* |
| Ga0058697_102743523 | 3300005562 | Agave | MLTERALGQTGYPLKAGQLTYDCRYSTMHGIPVTGGRGFRGLKPLWYNSVPP* |
| Ga0058697_103366673 | 3300005562 | Agave | VHGALGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPL |
| Ga0058697_104001981 | 3300005562 | Agave | AGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP* |
| Ga0058697_106295061 | 3300005562 | Agave | LKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0066703_107016061 | 3300005568 | Soil | EGYPLKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0066903_1001566931 | 3300005764 | Tropical Forest Soil | QLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP* |
| Ga0066903_1007613783 | 3300005764 | Tropical Forest Soil | GYALKAGQLTYDCRYSTMHGMPVTGGHGFRGLKPLWYNGVPP* |
| Ga0066903_1011271391 | 3300005764 | Tropical Forest Soil | VFPGYLLKPGQLEYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV |
| Ga0066903_1014707193 | 3300005764 | Tropical Forest Soil | GYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYHSVPP* |
| Ga0066903_1033884921 | 3300005764 | Tropical Forest Soil | KAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP* |
| Ga0066903_1040994141 | 3300005764 | Tropical Forest Soil | MNTGGGPPEGYALKAGQLTYDCRYSTMHGMPVTGGHGFRGLKPLWYNGV |
| Ga0066903_1042990501 | 3300005764 | Tropical Forest Soil | GYLLKVGQLEYDCRYSKMHGMPVTGGRSFRSLKPLWYKGVPP* |
| Ga0066903_1044434121 | 3300005764 | Tropical Forest Soil | GYLLKAGQLEYDCRYSTMHGMPVTGGRGFRGLKPWWYNGVPP* |
| Ga0066903_1047661582 | 3300005764 | Tropical Forest Soil | MGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPWWYNGVPA* |
| Ga0066903_1070999401 | 3300005764 | Tropical Forest Soil | LEYDCRYSKMHGMPVTGGRGFRALKPLWYKGVPP* |
| Ga0066903_1077746251 | 3300005764 | Tropical Forest Soil | LLAGSGYLLKPGQLEYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV |
| Ga0066903_1089771821 | 3300005764 | Tropical Forest Soil | LRVRGYALKAGQLTYDCHYSAMHGMPVTGGRGFRSLKPLWYNG |
| Ga0066696_101266923 | 3300006032 | Soil | YALKAGQLTYDCRYSTMHGMPVTGGRGFRDLKPLWYNGVPP* |
| Ga0075417_100853161 | 3300006049 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP* |
| Ga0075417_100901921 | 3300006049 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP* |
| Ga0075417_100933701 | 3300006049 | Populus Rhizosphere | LTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075417_101703631 | 3300006049 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP* |
| Ga0075417_104772491 | 3300006049 | Populus Rhizosphere | MGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVP |
| Ga0075417_105109942 | 3300006049 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075432_101751293 | 3300006058 | Populus Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP* |
| Ga0075427_100048151 | 3300006194 | Populus Rhizosphere | VCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNG |
| Ga0075427_100092841 | 3300006194 | Populus Rhizosphere | VVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYN |
| Ga0075427_100312752 | 3300006194 | Populus Rhizosphere | MGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP* |
| Ga0075427_100365731 | 3300006194 | Populus Rhizosphere | MGSYSQWGYVLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075428_1001612041 | 3300006844 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGRRGFRGLKLLWYNGVPP* |
| Ga0075428_1002541104 | 3300006844 | Populus Rhizosphere | LTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP* |
| Ga0075428_1002570694 | 3300006844 | Populus Rhizosphere | MGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP |
| Ga0075428_1003588941 | 3300006844 | Populus Rhizosphere | EGYALKAGQLTYDCRYSTMHGIPVTGGRGFRGLKPLWYKASQEQ* |
| Ga0075428_1003841325 | 3300006844 | Populus Rhizosphere | YPTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075428_1005219621 | 3300006844 | Populus Rhizosphere | LTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP* |
| Ga0075428_1021166012 | 3300006844 | Populus Rhizosphere | QGYALKAGQLTYDCRYSTMHGMSVIGGRGFRGLKSLWYNGVPH* |
| Ga0075428_1022098321 | 3300006844 | Populus Rhizosphere | QLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP* |
| Ga0075421_1002632904 | 3300006845 | Populus Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRVLKPLWYNGVPP* |
| Ga0075421_1004550501 | 3300006845 | Populus Rhizosphere | VVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLW |
| Ga0075421_1005774942 | 3300006845 | Populus Rhizosphere | GYALKAGQLTYDCRYSTTHGMPVTGGRGFRGLKSLWYNGVPP* |
| Ga0075421_1006278731 | 3300006845 | Populus Rhizosphere | IGYALKAGQLTYDCRYSTIHSMLVTGGHGFRGLKPLWYKGVPP* |
| Ga0075421_1009802492 | 3300006845 | Populus Rhizosphere | MLSAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGV |
| Ga0075430_1001309803 | 3300006846 | Populus Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP* |
| Ga0075430_1011191931 | 3300006846 | Populus Rhizosphere | VCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGL |
| Ga0075430_1012075811 | 3300006846 | Populus Rhizosphere | AGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075430_1016028072 | 3300006846 | Populus Rhizosphere | LTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP* |
| Ga0075431_1009509871 | 3300006847 | Populus Rhizosphere | VGAGRPHATGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNG |
| Ga0075431_1011773732 | 3300006847 | Populus Rhizosphere | GYALKAGQLTYDCRYSTMHGMPVTGGSGFRGLKPLWYNGVPP* |
| Ga0075431_1014159992 | 3300006847 | Populus Rhizosphere | PTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075433_102557731 | 3300006852 | Populus Rhizosphere | VVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVP |
| Ga0075434_1018039631 | 3300006871 | Populus Rhizosphere | MALRVSGYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV |
| Ga0075429_1004506881 | 3300006880 | Populus Rhizosphere | LKAGQLTYDCRYSTMHGMPVTGGRGFGGLKPLWYNSVPP* |
| Ga0075429_1006178712 | 3300006880 | Populus Rhizosphere | GYALKAGQLTYDCRYSTMHGMPGTGGRGFRSLKPLWYNSVPP* |
| Ga0075424_1020676241 | 3300006904 | Populus Rhizosphere | VCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGV |
| Ga0075419_100804883 | 3300006969 | Populus Rhizosphere | GQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP* |
| Ga0075419_100988731 | 3300006969 | Populus Rhizosphere | GQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP* |
| Ga0075419_106203381 | 3300006969 | Populus Rhizosphere | RQLTYDCRYSTMHGMPVTGRRGFRGLKLLWYNGVPP* |
| Ga0099829_107910011 | 3300009038 | Vadose Zone Soil | LEYDYRYSKMHGMPVTGGRGLRGLKPLWYNGVPP* |
| Ga0099827_115210611 | 3300009090 | Vadose Zone Soil | GQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0075418_101029115 | 3300009100 | Populus Rhizosphere | KAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYKASQEQ* |
| Ga0075418_113054321 | 3300009100 | Populus Rhizosphere | SGAALTYVSFEGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0114129_119916681 | 3300009147 | Populus Rhizosphere | GQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0126382_105447862 | 3300010047 | Tropical Forest Soil | GYALKAGQLTYDCRYSTMHGMPVTDGRGFRGLQPLWYNGVSP* |
| Ga0126321_12298651 | 3300010145 | Soil | GQLTYDCRYSTMHGMPVTGGRGFRGLKALWYNGVPP* |
| Ga0126383_130499211 | 3300010398 | Tropical Forest Soil | VGQLEYDCRYSKMHGMPVTGGRGFRALKSLWYKGVPP* |
| Ga0137383_100271473 | 3300012199 | Vadose Zone Soil | MSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGHSFRGLKPLWYNGVPP* |
| Ga0137378_109049941 | 3300012210 | Vadose Zone Soil | AGQLEYDCRYSKMHGIPVTGGRGFRGLKPLWYNGVPP* |
| Ga0150985_1015696722 | 3300012212 | Avena Fatua Rhizosphere | MPDVLTGYLLKVGQLEYDCRYSKMPGMPVTGGRGFRSLKPLWYKGVPP* |
| Ga0137386_111987281 | 3300012351 | Vadose Zone Soil | QAGQLEYDCRYAKMHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0150984_1126538821 | 3300012469 | Avena Fatua Rhizosphere | MCVSLGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYN |
| Ga0164302_111265242 | 3300012961 | Soil | VSRAKWLPETGYPLKAGQLEYDCRYSTMHGMPVTGGRGFRGLKPLWYNGV |
| Ga0126369_102713522 | 3300012971 | Tropical Forest Soil | GYALKAGQLTYDCRYSTMHDMPVTGGHGFRGLKPLWYNGVPP* |
| Ga0132258_118034453 | 3300015371 | Arabidopsis Rhizosphere | QLEYDCRYSTMHGMPVTGGRGFRDLKPLGYKGVPP* |
| Ga0132256_10001131210 | 3300015372 | Arabidopsis Rhizosphere | MLYSGLSGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSV |
| Ga0132255_1000091101 | 3300015374 | Arabidopsis Rhizosphere | MLYSGLSGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVP |
| Ga0132255_1008976332 | 3300015374 | Arabidopsis Rhizosphere | GYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVPP* |
| Ga0132255_1009976561 | 3300015374 | Arabidopsis Rhizosphere | GQLEYDCRYSTMHGMPVTGGRGFRDLKPLGYKGVPP* |
| Ga0132255_1020670141 | 3300015374 | Arabidopsis Rhizosphere | GQWTYDCRYSTIHGMPVTGGRGFRGLKPLWYNGVPP* |
| Ga0132255_1061458912 | 3300015374 | Arabidopsis Rhizosphere | FEEAGYALKAGQLTYDYRYSTMHGMPVTGGRGFRALKPLRHNSVPP* |
| Ga0182033_102029461 | 3300016319 | Soil | TDIVRHLKNGYPLKVGQLEYDCRYSKMYGMPVAGGRGFSALKPLWNNGVPP |
| Ga0182033_113870943 | 3300016319 | Soil | PQLGYLLEVGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYNGVPP |
| Ga0182033_118138341 | 3300016319 | Soil | MGTGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLL |
| Ga0182034_102959153 | 3300016371 | Soil | MCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGV |
| Ga0182037_119988231 | 3300016404 | Soil | GQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0182039_110280521 | 3300016422 | Soil | MCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKG |
| Ga0209153_10477071 | 3300026312 | Soil | KMGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGIPP |
| Ga0209472_10729262 | 3300026323 | Soil | EGYPLKAGQLEYDCRYSRMHDMPFTGRRGFRGLKPL |
| Ga0209465_100325631 | 3300027874 | Tropical Forest Soil | MNGFIGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP |
| Ga0247828_104325241 | 3300028587 | Soil | MDVQWGIPPQPEHFDHGYPLKAGQLTYDCHYSTMHGMPVTGGRGFRGLKPLW |
| Ga0247828_112334991 | 3300028587 | Soil | AGQLEYDCHYSKMHGMPVTGGRSFRGLKPLWYNGVPP |
| Ga0318515_100784011 | 3300031572 | Soil | FIKFLLVRGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKSLWYNGVPP |
| Ga0318572_105873301 | 3300031681 | Soil | AGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0318560_103135231 | 3300031682 | Soil | CLFLWLMRGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP |
| Ga0318492_101014601 | 3300031748 | Soil | MVRYGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLW |
| Ga0318548_103544061 | 3300031793 | Soil | MVFLGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVP |
| Ga0318523_103564372 | 3300031798 | Soil | SGKAVAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0310917_103309392 | 3300031833 | Soil | ADVGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0306921_110768283 | 3300031912 | Soil | GHVGQIEGYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP |
| Ga0310912_109498251 | 3300031941 | Soil | MCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVP |
| Ga0310909_101554741 | 3300031947 | Soil | KAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0307409_1002292225 | 3300031995 | Rhizosphere | GYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP |
| Ga0307409_1013686672 | 3300031995 | Rhizosphere | LKAGQLEYDCRYSTMHGMPVTGSRGFRGLQPLWYNGVQP |
| Ga0318570_105404081 | 3300032054 | Soil | PHPEVMQGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0318505_102952402 | 3300032060 | Soil | GTVDVSGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP |
| Ga0318513_106306462 | 3300032065 | Soil | IGVEAHVGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP |
| Ga0307471_1017384921 | 3300032180 | Hardwood Forest Soil | LKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPWWYNGVPA |
| Ga0306920_1043256512 | 3300032261 | Soil | MGLGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGV |
| Ga0306920_1043807351 | 3300032261 | Soil | ARVFQKLKLGYLLKVGQLEYDCRYSKMHGMPVTSGRGFRSLKPL |
| Ga0314803_016774_3_149 | 3300034678 | Soil | LIMEFLGYALKAEQLTYDCRYSTMHGMLVTGGRGFRVLKPLWYNGVPP |
| ⦗Top⦘ |