


| Basic Information | |
|---|---|
| Family ID | F064861 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKD |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.09 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.41 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.375 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.281 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.30% β-sheet: 23.40% Coil/Unstructured: 38.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 16.41 |
| PF00296 | Bac_luciferase | 10.16 |
| PF12146 | Hydrolase_4 | 7.03 |
| PF13343 | SBP_bac_6 | 5.47 |
| PF00903 | Glyoxalase | 5.47 |
| PF01979 | Amidohydro_1 | 1.56 |
| PF12695 | Abhydrolase_5 | 1.56 |
| PF14470 | bPH_3 | 1.56 |
| PF03401 | TctC | 0.78 |
| PF08240 | ADH_N | 0.78 |
| PF00266 | Aminotran_5 | 0.78 |
| PF13646 | HEAT_2 | 0.78 |
| PF02738 | MoCoBD_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 10.16 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10850718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300003321|soilH1_10098613 | All Organisms → cellular organisms → Bacteria | 5733 | Open in IMG/M |
| 3300003991|Ga0055461_10074810 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300003999|Ga0055469_10002623 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
| 3300004463|Ga0063356_102244383 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300004463|Ga0063356_103054711 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005169|Ga0066810_10127120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300005180|Ga0066685_11118815 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005183|Ga0068993_10056262 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005294|Ga0065705_10019617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1862 | Open in IMG/M |
| 3300005294|Ga0065705_10128595 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300005328|Ga0070676_11441218 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005333|Ga0070677_10559938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 628 | Open in IMG/M |
| 3300005340|Ga0070689_101167720 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005467|Ga0070706_101024116 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005536|Ga0070697_102062318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300005545|Ga0070695_100336545 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005586|Ga0066691_10545576 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005617|Ga0068859_101571793 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006196|Ga0075422_10258563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 734 | Open in IMG/M |
| 3300006797|Ga0066659_11842223 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006806|Ga0079220_10398362 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006845|Ga0075421_101760444 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006845|Ga0075421_102401506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300006847|Ga0075431_100979848 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006852|Ga0075433_10203397 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300006871|Ga0075434_100309326 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300006881|Ga0068865_100182732 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300009100|Ga0075418_11971839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 636 | Open in IMG/M |
| 3300009792|Ga0126374_10310700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1062 | Open in IMG/M |
| 3300009801|Ga0105056_1023866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300010304|Ga0134088_10011965 | All Organisms → cellular organisms → Bacteria | 3731 | Open in IMG/M |
| 3300010366|Ga0126379_12931702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300010373|Ga0134128_10412884 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300010373|Ga0134128_10429601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1474 | Open in IMG/M |
| 3300010399|Ga0134127_10026858 | All Organisms → cellular organisms → Bacteria | 4545 | Open in IMG/M |
| 3300010400|Ga0134122_12789028 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010400|Ga0134122_12826604 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011409|Ga0137323_1047161 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300011434|Ga0137464_1101944 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300011435|Ga0137426_1005034 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300011435|Ga0137426_1237858 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300011437|Ga0137429_1100252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300012129|Ga0137345_1017189 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012179|Ga0137334_1115031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300012208|Ga0137376_10109723 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
| 3300012208|Ga0137376_10742045 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012353|Ga0137367_11093630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300012357|Ga0137384_10117454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2223 | Open in IMG/M |
| 3300012360|Ga0137375_10758770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 785 | Open in IMG/M |
| 3300012494|Ga0157341_1025999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300012517|Ga0157354_1025727 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012582|Ga0137358_11082529 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012923|Ga0137359_10934679 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012930|Ga0137407_11256858 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300013297|Ga0157378_11931727 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300013306|Ga0163162_10574008 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300013308|Ga0157375_11095433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300013308|Ga0157375_11256018 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300014263|Ga0075324_1000117 | All Organisms → cellular organisms → Bacteria | 13271 | Open in IMG/M |
| 3300014270|Ga0075325_1128229 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300014321|Ga0075353_1240687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300014969|Ga0157376_10241935 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300015358|Ga0134089_10175357 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300015372|Ga0132256_101620277 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300015374|Ga0132255_101002867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1252 | Open in IMG/M |
| 3300015374|Ga0132255_103018122 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300015374|Ga0132255_105499561 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300016357|Ga0182032_10396693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1115 | Open in IMG/M |
| 3300016445|Ga0182038_10694670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 885 | Open in IMG/M |
| 3300018027|Ga0184605_10202895 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300018054|Ga0184621_10086271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300018056|Ga0184623_10426478 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300018074|Ga0184640_10323919 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018076|Ga0184609_10350698 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018082|Ga0184639_10367887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300018422|Ga0190265_11117135 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300018476|Ga0190274_10356822 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300018476|Ga0190274_10753989 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300019254|Ga0184641_1054306 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300019356|Ga0173481_10233514 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300019885|Ga0193747_1128122 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300019886|Ga0193727_1092231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 904 | Open in IMG/M |
| 3300020060|Ga0193717_1191023 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300020200|Ga0194121_10172588 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300020579|Ga0210407_11352969 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021081|Ga0210379_10328234 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021081|Ga0210379_10366490 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021082|Ga0210380_10033623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2197 | Open in IMG/M |
| 3300021184|Ga0196959_10081850 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021560|Ga0126371_11287591 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10328141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300025160|Ga0209109_10110894 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300025917|Ga0207660_10733220 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300025917|Ga0207660_10924448 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300025920|Ga0207649_11617011 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025921|Ga0207652_10523507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300025925|Ga0207650_11197101 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025927|Ga0207687_11180379 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300025930|Ga0207701_10171544 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300025931|Ga0207644_11167969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300025936|Ga0207670_11804330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300025938|Ga0207704_10154830 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300025972|Ga0207668_10398594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1163 | Open in IMG/M |
| 3300026023|Ga0207677_10506792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300026029|Ga0208002_1001871 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300026095|Ga0207676_12587562 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026325|Ga0209152_10301642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300026335|Ga0209804_1231448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300027252|Ga0209973_1014937 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300028381|Ga0268264_12315629 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300030006|Ga0299907_10587698 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300030619|Ga0268386_10782835 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031820|Ga0307473_10377279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 921 | Open in IMG/M |
| 3300031824|Ga0307413_10796217 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031908|Ga0310900_10120487 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300031962|Ga0307479_10553402 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031962|Ga0307479_11328200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300031965|Ga0326597_11902461 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032144|Ga0315910_11640765 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032180|Ga0307471_100164815 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300032180|Ga0307471_102705092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300033004|Ga0335084_10306463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1641 | Open in IMG/M |
| 3300033412|Ga0310810_10708960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300033481|Ga0316600_10194213 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300033551|Ga0247830_11220402 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300034354|Ga0364943_0396690 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300034690|Ga0364923_0077359 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.12% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.78% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_108507181 | 3300000550 | Soil | MKIGLFTEFSYVGKSERQAYAEILEQIALADQLGYDFFSTTESFGKDEFSSSPF |
| soilH1_100986136 | 3300003321 | Sugarcane Root And Bulk Soil | MKVGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSTTESYGKDLFS |
| Ga0055461_100748102 | 3300003991 | Natural And Restored Wetlands | MKIGLFTEFSYPGKSEHRLYAEVLEQIAVADQLGYDFFSI |
| Ga0055469_100026231 | 3300003999 | Natural And Restored Wetlands | LKIGLFTEFSYPGKTEQQTYAEVLEQIALADESGYDFFSITESYGKDLFSCSPFPLGLYV |
| Ga0063356_1022443831 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLY |
| Ga0063356_1030547112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKIGLFTEFSYPGKSEQQTYADVLAQIALADELGYDFFSITESYGK |
| Ga0066810_101271201 | 3300005169 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAEADELGYDFFSITESYGKDLFSCSPF |
| Ga0066685_111188151 | 3300005180 | Soil | MKIGLFTEFSYPGKSEHQTYTEVLEQIAVADELGFDFFSTTESYGKDLFSCSPFPLGL |
| Ga0068993_100562621 | 3300005183 | Natural And Restored Wetlands | MKIGLFTEFSYPGKSEQQTYADVLEQLAVADALGYDFFSITESYGKDLFSCSPFPLGLYV |
| Ga0065705_100196171 | 3300005294 | Switchgrass Rhizosphere | MKIGLFTEFSYVGKSERQAYAEILEQIALADQLGYDFFSTTESFGKDEFSCSPF |
| Ga0065705_101285951 | 3300005294 | Switchgrass Rhizosphere | MKIGLFTEFSYPGKSEHQTYADVLEQIAVADGLGYDFFSITESYGKDLFSC |
| Ga0070676_114412182 | 3300005328 | Miscanthus Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSLTESYGKDLFSCS |
| Ga0070677_105599382 | 3300005333 | Miscanthus Rhizosphere | MLRPYVRRGILKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKD |
| Ga0070689_1011677201 | 3300005340 | Switchgrass Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKDLFSCSPF |
| Ga0070706_1010241162 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGLFTEFSYPGKSERQTYAEVLEQIAVADELGYDFFSTTES |
| Ga0070697_1020623182 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYDFFSTTESFGKDDVSCSP |
| Ga0070695_1003365452 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGLFTEFSYPNKSEEQTYAEVLEQIALADELGYDFFSTTESYGRDLF |
| Ga0066691_105455762 | 3300005586 | Soil | MKIGLFTEFSYPGKSERQTYVDVLEQIALADELGYDFFSTTESYG |
| Ga0068859_1015717931 | 3300005617 | Switchgrass Rhizosphere | MKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITESYGKDLFSCSPFPLGLY |
| Ga0075422_102585632 | 3300006196 | Populus Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSITESYGKDLFSC |
| Ga0066659_118422231 | 3300006797 | Soil | MKIGLFTEFSYPEKSERQTYVDVLEQIALADELGYDFFSTTESYGKDLFSCSPFP |
| Ga0079220_103983621 | 3300006806 | Agricultural Soil | LKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDF |
| Ga0075421_1017604442 | 3300006845 | Populus Rhizosphere | MKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPF |
| Ga0075421_1024015061 | 3300006845 | Populus Rhizosphere | MKIGLFTEFSYPGKSEQQTYADVSEQIALADALGYDFFSITESYGKDLFSCSPFPL |
| Ga0075431_1009798481 | 3300006847 | Populus Rhizosphere | MKIGLFTEFSYPGKSERQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPL |
| Ga0075433_102033973 | 3300006852 | Populus Rhizosphere | LKIGLFTEFSYPGKSQQQTYAEVLEQIALADELGYDFFSTT |
| Ga0075434_1003093261 | 3300006871 | Populus Rhizosphere | MKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYGRDLFSCS |
| Ga0068865_1001827321 | 3300006881 | Miscanthus Rhizosphere | MLRPYVRRGILKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESY |
| Ga0075418_119718391 | 3300009100 | Populus Rhizosphere | MKIGLFTEFSYVGKSERQAYAEVLEQIALADRLGYDFFSTTES |
| Ga0126374_103107001 | 3300009792 | Tropical Forest Soil | LGLFTEFSYPEKSERQAYAEILEQIVLADRLGYDFF |
| Ga0105056_10238662 | 3300009801 | Groundwater Sand | MKIGLFTEFSYVGKSERQAYAEILQQIALADQLGYDFFSTTESFGKDEFSCSPFPLGLYVAAAQ |
| Ga0134088_100119655 | 3300010304 | Grasslands Soil | MKIGLFTEFSYPGKSERQIYNEVLEQITLADELGYDFFSTTESFGKDVIS |
| Ga0126379_129317021 | 3300010366 | Tropical Forest Soil | FMKIGLFTEFSYPEKSERQAYAEILEQIVLADSPRL* |
| Ga0134128_104128841 | 3300010373 | Terrestrial Soil | LIEKMKIGLFTEFSYPDKSEQQTYAEVLEQIALAD |
| Ga0134128_104296013 | 3300010373 | Terrestrial Soil | LIEKMKIGLFTEFSYPDKSEQQTYAEVLEQIALADEL* |
| Ga0134127_100268586 | 3300010399 | Terrestrial Soil | LKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGYDFFSTTESYG |
| Ga0134122_127890282 | 3300010400 | Terrestrial Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESY |
| Ga0134122_128266042 | 3300010400 | Terrestrial Soil | MKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSITE |
| Ga0137323_10471611 | 3300011409 | Soil | MKIGLFTEFSYPGKSEQQTYADVLAQIAVADELGYDFF |
| Ga0137464_11019442 | 3300011434 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESYGKDLFSCSPF |
| Ga0137426_10050341 | 3300011435 | Soil | MKIGLFTEFSYPGKSEQQTYADVLEQIAAADELGFDF |
| Ga0137426_12378581 | 3300011435 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAAADELGYDFYSITESFGKDLFSC |
| Ga0137429_11002522 | 3300011437 | Soil | MKMGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESY |
| Ga0137345_10171892 | 3300012129 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESFG |
| Ga0137334_11150312 | 3300012179 | Soil | MKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLY |
| Ga0137376_101097234 | 3300012208 | Vadose Zone Soil | MKIGLFTEFSYPEKSERQTYVDVLEQIALADELGY |
| Ga0137376_107420452 | 3300012208 | Vadose Zone Soil | MKLGLFTEFSYPGKSEHQTYAEVLEQIALADELGYDFFSTTESYGKDLF |
| Ga0137367_110936301 | 3300012353 | Vadose Zone Soil | MKIGLFTEFSYPEKSELQTYSEVLEQIAVADELGFDFFSTTESYGKDLFSCSPFPLGLY |
| Ga0137384_101174541 | 3300012357 | Vadose Zone Soil | MKIGLFTEFSYPGKSERQAYAEVLEQISLADELGYDFFSTTESFGKDEVSCSPFPLGL |
| Ga0137375_107587702 | 3300012360 | Vadose Zone Soil | MKIGLFTEFSYVGKSERQAYAEILEQIALAYQLGYDFFST |
| Ga0157341_10259992 | 3300012494 | Arabidopsis Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFF |
| Ga0157354_10257271 | 3300012517 | Unplanted Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDFFSTTES |
| Ga0137358_110825291 | 3300012582 | Vadose Zone Soil | MKIGLFTEFSYPGKSEPQTYAEVLEQIALADALGYDFFSITESYGKDLFSCSPFPLGL |
| Ga0137359_109346792 | 3300012923 | Vadose Zone Soil | MKIGLFTEFSYPGKSERQTYAEVLEQIALADELGYDFFSTTESYGK |
| Ga0137407_112568582 | 3300012930 | Vadose Zone Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQISLADALGYDFFSITESYGKDLF |
| Ga0157378_119317272 | 3300013297 | Miscanthus Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSI |
| Ga0163162_105740081 | 3300013306 | Switchgrass Rhizosphere | LKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFPL |
| Ga0157375_110954332 | 3300013308 | Miscanthus Rhizosphere | LKIGLFTEFSSPGKSEEQTYSEVLEQIALADELGY |
| Ga0157375_112560183 | 3300013308 | Miscanthus Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFS |
| Ga0075324_10001171 | 3300014263 | Natural And Restored Wetlands | MKIGLFTEFSYPGKSEQQTYAEVWQQIALADELGYD |
| Ga0075325_11282292 | 3300014270 | Natural And Restored Wetlands | MKIGLFTEFSYPGKSEQQTYREVFEQISVADELGFDYSSTTESYGKDLFSCSPFPLGLYVAAGQ |
| Ga0075353_12406872 | 3300014321 | Natural And Restored Wetlands | LFHLRDMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELG |
| Ga0157376_102419353 | 3300014969 | Miscanthus Rhizosphere | LKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYG |
| Ga0134089_101753572 | 3300015358 | Grasslands Soil | MKIGLFTEFSYPGKSEHQTYAEVLEQIAVADELGYDFFSTTEGY |
| Ga0132256_1016202771 | 3300015372 | Arabidopsis Rhizosphere | MKIGLFTEFSYPGKSEHRTYADVLEQIAVADELGYDF |
| Ga0132255_1010028671 | 3300015374 | Arabidopsis Rhizosphere | MKIGLFTEFSYPGKSEQQTYVEVLEQIALADELGYDFFSTTESYGRDLFSC |
| Ga0132255_1030181222 | 3300015374 | Arabidopsis Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQISLADALGYDFFSITESYGKDLFSCSPFPLGLYVGAAQQA |
| Ga0132255_1054995611 | 3300015374 | Arabidopsis Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSITESYGKDLFSCS |
| Ga0182032_103966931 | 3300016357 | Soil | MLRPAQNGASLKIGLFTEFSYPGKSEQQTYTEVLEQISLADELGYDFFSTTEGYGKD |
| Ga0182038_106946702 | 3300016445 | Soil | MKIGLFTEFSYPGKSERQTYTEVLEQIALADELGY |
| Ga0184605_102028951 | 3300018027 | Groundwater Sediment | MKIGLFTEFSYPEKSEQQTYAEVLEQITVADELEFDFFSTTESYGKDLFSCSPFPLGLYVAAA |
| Ga0184621_100862711 | 3300018054 | Groundwater Sediment | MKIGLFTEFSYPEKSEQQTYAEVLEQIAVADKLGYDFFSTTESYGKDLFSCSPFPLGLY |
| Ga0184623_104264781 | 3300018056 | Groundwater Sediment | MKIGLFTEFSYPGKSEQQTYADVLAQIAVADELGYDFFSITESYGKD |
| Ga0184640_103239192 | 3300018074 | Groundwater Sediment | MKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGK |
| Ga0184609_103506981 | 3300018076 | Groundwater Sediment | MKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYNFFSITESFGKDLFSCSPFPLGLYVAAAQRA |
| Ga0184639_103678871 | 3300018082 | Groundwater Sediment | MKIGLFTEFSYPGKSEHQTYADVLEQIAVADELGYDFFSTTESYGKDLFSCSPFPLGLYV |
| Ga0190265_111171351 | 3300018422 | Soil | MKVGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGK |
| Ga0190274_103568221 | 3300018476 | Soil | MKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSPFP |
| Ga0190274_107539892 | 3300018476 | Soil | MDDMKIGLFTEFSYPGKSEHQLYAEVLEQIAVADALGYDFFSITE |
| Ga0184641_10543061 | 3300019254 | Groundwater Sediment | MKIGLFTEFSYPGKSEQQTYTEVLEQIAVADALGYDFFSITESYGKDLFSCSPFP |
| Ga0173481_102335142 | 3300019356 | Soil | MLRPYVRRGILKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITE |
| Ga0193747_11281221 | 3300019885 | Soil | MKIGLFTEFSYPGKSERQTYAEVLEQIAVADELGYDFFSTTESYGKDSFSCSPFPL |
| Ga0193727_10922311 | 3300019886 | Soil | MKIGLFTEFSYVGKSERQAYAEVLEQIALADRLGYDFFSTTESYGKDEFS |
| Ga0193717_11910232 | 3300020060 | Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKDLFSC |
| Ga0194121_101725881 | 3300020200 | Freshwater Lake | MKIGLFTEFSYPGKTEQQLYAEVLEQIALADQLGYDFFSITESFGKDLFSCSP |
| Ga0210407_113529691 | 3300020579 | Soil | MKIGLFTEFSYPGKSERQTYAEVLEQIAVADSLGYDFFSTTESFGKDEFSCSPFPL |
| Ga0210379_103282341 | 3300021081 | Groundwater Sediment | MKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITESYGKDLFSCS |
| Ga0210379_103664902 | 3300021081 | Groundwater Sediment | MKIGLFTEFSYPGKSEQQTYADVLEQIAVADELGYDF |
| Ga0210380_100336234 | 3300021082 | Groundwater Sediment | MKIGLFTEFSYPAKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFSCSP |
| Ga0196959_100818502 | 3300021184 | Soil | MKIGLFTEFSYPGKSERQTYAEVLEQIAAADALGFDFFSTTESYGKDLFSCSPFPLGLY |
| Ga0126371_112875911 | 3300021560 | Tropical Forest Soil | MKIGLFTEFSYPGKSEQQTYTEVLEQIALADELGYDFFSTTESYGKDLFSCSPF |
| (restricted) Ga0255056_103281412 | 3300024521 | Seawater | MKVGLFTEFSYPGKSEQQTYTEVLEQIAVADELGYDFFSTTESYGKDLFSCSPFPLGLYTAAAQTA |
| Ga0209109_101108942 | 3300025160 | Soil | MKVGLFTEFSYPGKSEEQTYAEVLEQLAVADELGYDFFSITESYGRDLFSCSPFPLGLYVEQEKR |
| Ga0207660_107332201 | 3300025917 | Corn Rhizosphere | LKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGK |
| Ga0207660_109244481 | 3300025917 | Corn Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDFFSTTE |
| Ga0207649_116170112 | 3300025920 | Corn Rhizosphere | MKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYGRDLF |
| Ga0207652_105235071 | 3300025921 | Corn Rhizosphere | MKIGLFTEFSYPDKSERRAYAEVLEQIAVADELGYDFFSTTESYGEDLF |
| Ga0207650_111971011 | 3300025925 | Switchgrass Rhizosphere | MKIGLFTEFSYPDKSEQQTYAEVLEQIALADELGYDFFSTTESYG |
| Ga0207687_111803791 | 3300025927 | Miscanthus Rhizosphere | MLRPYVRRGILKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFRSISRN |
| Ga0207701_101715441 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADALGYDFFSI |
| Ga0207644_111679692 | 3300025931 | Switchgrass Rhizosphere | MKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITE |
| Ga0207670_118043301 | 3300025936 | Switchgrass Rhizosphere | MKVGLFTEFSYPGKTEQQLYAEVLEQISLADELGYDFFSITESYGKDLF |
| Ga0207704_101548301 | 3300025938 | Miscanthus Rhizosphere | MLRPYVRRGILKIGLFTEFSSPGKSEEQTYREVLEQIALADELGYDFFSTTESYGK |
| Ga0207668_103985942 | 3300025972 | Switchgrass Rhizosphere | MLRPYVRRGILKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCSPFPLGL |
| Ga0207677_105067922 | 3300026023 | Miscanthus Rhizosphere | LKIGLFTEFSYPGKSEEQTYSEVLEQIALADELGYDFFSTTESYGKDLFSCS |
| Ga0208002_10018713 | 3300026029 | Natural And Restored Wetlands | MKIGLFTEFSYPGKSEQQTYAEVWQQIALADELGYDFFSTT |
| Ga0207676_125875622 | 3300026095 | Switchgrass Rhizosphere | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADELGYDFFSITESYGKD |
| Ga0209152_103016421 | 3300026325 | Soil | MKIGLFTEFSYPGKSERQAYAEVLAQISLADELGYDFFSTTESFGKDEVSCSPFPLGLY |
| Ga0209804_12314481 | 3300026335 | Soil | MKIGLFTEFSYPGKSERQAYAEVLAQISLADELGYDFFSTTESFGKDEVSCSPFPLGLYIAAAQRA |
| Ga0209973_10149371 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MKIGLFTEFSYPGKSERQTYDEVFEQILLADGLGY |
| Ga0268264_123156292 | 3300028381 | Switchgrass Rhizosphere | MKIGLFTEFSYPAKSEQQTYADVLEQIAVADELGYDFFSITESYGKDLFS |
| Ga0299907_105876982 | 3300030006 | Soil | MKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDF |
| Ga0268386_107828352 | 3300030619 | Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQIAVADQLGFDFFSITESYGKDEFSCSPFPLGLYV |
| Ga0307473_103772791 | 3300031820 | Hardwood Forest Soil | MKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYDFFSTTE |
| Ga0307413_107962172 | 3300031824 | Rhizosphere | MKIGLFTEFSYPGKSEHQLYSEVLEQIAVADELGYDFFSITESYGKDLFSCSPFPLGLYVAAAQ |
| Ga0310900_101204873 | 3300031908 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITESYGKDLFS |
| Ga0307479_105534022 | 3300031962 | Hardwood Forest Soil | MKIGLFTEFSYPGKSERQIYAEVLEQIALADELGYD |
| Ga0307479_113282002 | 3300031962 | Hardwood Forest Soil | MKIGLFTEFSYPGKFERQIYAEVLEQIALADELDYDFFSTTESFGKDDVSCSPFPLGLYVAAAQR |
| Ga0326597_119024612 | 3300031965 | Soil | MKIGLFTEFSYPGKSEQQTYREVLEQIAVADGLGYDFFAITESYG |
| Ga0315910_116407651 | 3300032144 | Soil | MKIGLFTEFSYPGKSEQQTYAEVLEQIALADELGYDF |
| Ga0307471_1001648151 | 3300032180 | Hardwood Forest Soil | MKIGLFTEFSYPGKSERQTYAEVLEQIAVADSLGYDFFST |
| Ga0307471_1027050922 | 3300032180 | Hardwood Forest Soil | MKIGLFTEFSYPGKFERQIYAEVLEQIALADELDYDFFSTTESF |
| Ga0335084_103064631 | 3300033004 | Soil | MKIGLFTEFSYPGKSEQQTYHDVFEQIYLADQLGYDFFSITESYGKDLFSCSPFPLG |
| Ga0310810_107089601 | 3300033412 | Soil | LKIGLFTEFSYPGKSEQQTYSEVLEQIALADELGYDFFSTTESYGKDLFSC |
| Ga0316600_101942132 | 3300033481 | Soil | MKIGLFTEFSYPGKSEHQLYAEVLEQIAVADELGYDFFSITES |
| Ga0247830_112204022 | 3300033551 | Soil | MKIGLFTEFSYPGKTEQQTYAEVLEQIAVADELSYDFFSVTESYGR |
| Ga0364943_0396690_396_533 | 3300034354 | Sediment | MKIGLFTEFSYPGKSEQQTYADVLEQIAAADELGFDFFSITESYGK |
| Ga0364923_0077359_1_126 | 3300034690 | Sediment | MKIGLFTEFSYPGKSEQQTYREVLEQIAVADELGYDFFSITE |
| ⦗Top⦘ |