


| Basic Information | |
|---|---|
| Family ID | F064855 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MGEAGGGLPGNSPRNPQMAGAGETSPPAFAAPYLQSLSRTLFVFCF |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.70 % |
| % of genes near scaffold ends (potentially truncated) | 60.16 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland (28.125 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (29.688 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 2.34 |
| PF07992 | Pyr_redox_2 | 2.34 |
| PF07690 | MFS_1 | 2.34 |
| PF00990 | GGDEF | 2.34 |
| PF02913 | FAD-oxidase_C | 2.34 |
| PF03819 | MazG | 1.56 |
| PF01568 | Molydop_binding | 1.56 |
| PF13458 | Peripla_BP_6 | 1.56 |
| PF00753 | Lactamase_B | 1.56 |
| PF00106 | adh_short | 1.56 |
| PF14332 | DUF4388 | 0.78 |
| PF09719 | C_GCAxxG_C_C | 0.78 |
| PF00582 | Usp | 0.78 |
| PF00731 | AIRC | 0.78 |
| PF01384 | PHO4 | 0.78 |
| PF00850 | Hist_deacetyl | 0.78 |
| PF03480 | DctP | 0.78 |
| PF01029 | NusB | 0.78 |
| PF14279 | HNH_5 | 0.78 |
| PF12804 | NTP_transf_3 | 0.78 |
| PF01970 | TctA | 0.78 |
| PF03706 | LPG_synthase_TM | 0.78 |
| PF12836 | HHH_3 | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF05534 | HicB | 0.78 |
| PF03972 | MmgE_PrpD | 0.78 |
| PF09339 | HTH_IclR | 0.78 |
| PF00291 | PALP | 0.78 |
| PF02719 | Polysacc_synt_2 | 0.78 |
| PF00709 | Adenylsucc_synt | 0.78 |
| PF00370 | FGGY_N | 0.78 |
| PF01370 | Epimerase | 0.78 |
| PF03450 | CO_deh_flav_C | 0.78 |
| PF02562 | PhoH | 0.78 |
| PF13662 | Toprim_4 | 0.78 |
| PF04055 | Radical_SAM | 0.78 |
| PF05015 | HigB-like_toxin | 0.78 |
| PF13510 | Fer2_4 | 0.78 |
| PF00011 | HSP20 | 0.78 |
| PF13109 | AsmA_1 | 0.78 |
| PF08669 | GCV_T_C | 0.78 |
| PF03814 | KdpA | 0.78 |
| PF00725 | 3HCDH | 0.78 |
| PF03241 | HpaB | 0.78 |
| PF00313 | CSD | 0.78 |
| PF01479 | S4 | 0.78 |
| PF01618 | MotA_ExbB | 0.78 |
| PF14602 | Hexapep_2 | 0.78 |
| PF02082 | Rrf2 | 0.78 |
| PF13370 | Fer4_13 | 0.78 |
| PF12697 | Abhydrolase_6 | 0.78 |
| PF02508 | Rnf-Nqr | 0.78 |
| PF00733 | Asn_synthase | 0.78 |
| PF13492 | GAF_3 | 0.78 |
| PF02254 | TrkA_N | 0.78 |
| PF00515 | TPR_1 | 0.78 |
| PF01455 | HupF_HypC | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| PF00365 | PFK | 0.78 |
| PF01041 | DegT_DnrJ_EryC1 | 0.78 |
| PF09335 | SNARE_assoc | 0.78 |
| PF08242 | Methyltransf_12 | 0.78 |
| PF01169 | UPF0016 | 0.78 |
| PF00109 | ketoacyl-synt | 0.78 |
| PF13607 | Succ_CoA_lig | 0.78 |
| PF13242 | Hydrolase_like | 0.78 |
| PF03063 | Prismane | 0.78 |
| PF00126 | HTH_1 | 0.78 |
| PF02604 | PhdYeFM_antitox | 0.78 |
| PF00496 | SBP_bac_5 | 0.78 |
| PF01871 | AMMECR1 | 0.78 |
| PF00534 | Glycos_transf_1 | 0.78 |
| PF00793 | DAHP_synth_1 | 0.78 |
| PF13476 | AAA_23 | 0.78 |
| PF01966 | HD | 0.78 |
| PF02801 | Ketoacyl-synt_C | 0.78 |
| PF01323 | DSBA | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF02675 | AdoMet_dc | 0.78 |
| PF10282 | Lactonase | 0.78 |
| PF00590 | TP_methylase | 0.78 |
| PF12710 | HAD | 0.78 |
| PF02684 | LpxB | 0.78 |
| PF01039 | Carboxyl_trans | 0.78 |
| PF01783 | Ribosomal_L32p | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.34 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.56 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.56 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.78 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0298 | Hydrogenase maturation factor HybG, HypC/HupF family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0333 | Ribosomal protein L32 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.78 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.78 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.78 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.78 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.78 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.78 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.78 |
| COG1151 | Hydroxylamine reductase (hybrid-cluster protein) | Energy production and conversion [C] | 0.78 |
| COG1152 | CO dehydrogenase/acetyl-CoA synthase alpha subunit | Energy production and conversion [C] | 0.78 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.78 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
| COG1347 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrD | Energy production and conversion [C] | 0.78 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.78 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.78 |
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.78 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.78 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.78 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.78 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.78 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.78 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2078 | Predicted RNA modification protein, AMMECR1 domain | General function prediction only [R] | 0.78 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.78 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.78 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.78 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.78 |
| COG2209 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE | Energy production and conversion [C] | 0.78 |
| COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.78 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.78 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.78 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.78 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.78 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.78 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.78 |
| COG4657 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit | Energy production and conversion [C] | 0.78 |
| COG4660 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfE subunit | Energy production and conversion [C] | 0.78 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.78 % |
| Unclassified | root | N/A | 24.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000231|TB_LI09_4DRAFT_10264853 | Not Available | 545 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1029254 | Not Available | 876 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1011006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2143 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1027132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1211 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1031246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1108 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1040437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 945 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1056775 | Not Available | 769 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1025975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 830 | Open in IMG/M |
| 3300001279|JGI20214J14112_1005873 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300001279|JGI20214J14112_1041166 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300001547|JGI20215J15232_1005900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1859 | Open in IMG/M |
| 3300002961|JGI11641J44799_10003805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 4605 | Open in IMG/M |
| 3300002961|JGI11641J44799_10005710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 3777 | Open in IMG/M |
| 3300002961|JGI11641J44799_10006142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 3649 | Open in IMG/M |
| 3300002961|JGI11641J44799_10012021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2597 | Open in IMG/M |
| 3300002961|JGI11641J44799_10076312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 947 | Open in IMG/M |
| 3300002961|JGI11641J44799_10090998 | Not Available | 859 | Open in IMG/M |
| 3300003432|JGI20214J51088_10005306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 8504 | Open in IMG/M |
| 3300003432|JGI20214J51088_10006712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 7597 | Open in IMG/M |
| 3300003432|JGI20214J51088_10011785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 5829 | Open in IMG/M |
| 3300003432|JGI20214J51088_10045097 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300003432|JGI20214J51088_10057905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2702 | Open in IMG/M |
| 3300003432|JGI20214J51088_10141439 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300003432|JGI20214J51088_10182979 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300003432|JGI20214J51088_10514934 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300003541|JGI20214J51650_10001339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15634 | Open in IMG/M |
| 3300003541|JGI20214J51650_10003281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10144 | Open in IMG/M |
| 3300003541|JGI20214J51650_10004990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8271 | Open in IMG/M |
| 3300003541|JGI20214J51650_10005042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 8225 | Open in IMG/M |
| 3300003541|JGI20214J51650_10012921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5303 | Open in IMG/M |
| 3300003541|JGI20214J51650_10012952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 5298 | Open in IMG/M |
| 3300003541|JGI20214J51650_10015508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4872 | Open in IMG/M |
| 3300003541|JGI20214J51650_10015604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4858 | Open in IMG/M |
| 3300003541|JGI20214J51650_10016194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 4776 | Open in IMG/M |
| 3300003541|JGI20214J51650_10357339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1017 | Open in IMG/M |
| 3300003541|JGI20214J51650_10633671 | Not Available | 750 | Open in IMG/M |
| 3300003541|JGI20214J51650_10771913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 673 | Open in IMG/M |
| 3300003910|JGI26437J51864_10001787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 4940 | Open in IMG/M |
| 3300003910|JGI26437J51864_10001973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 4697 | Open in IMG/M |
| 3300003910|JGI26437J51864_10014578 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300003910|JGI26437J51864_10113955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300004062|Ga0055500_10142800 | Not Available | 562 | Open in IMG/M |
| 3300004071|Ga0055486_10130795 | Not Available | 596 | Open in IMG/M |
| 3300004079|Ga0055514_10130506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 662 | Open in IMG/M |
| 3300004146|Ga0055495_10219022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 507 | Open in IMG/M |
| 3300004481|Ga0069718_15804151 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005145|Ga0068713_1131971 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005252|Ga0068712_1118855 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005254|Ga0068714_10015856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 5804 | Open in IMG/M |
| 3300005254|Ga0068714_10038607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2894 | Open in IMG/M |
| 3300005254|Ga0068714_10053582 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300005254|Ga0068714_10104198 | Not Available | 1383 | Open in IMG/M |
| 3300005254|Ga0068714_10226889 | Not Available | 774 | Open in IMG/M |
| 3300005254|Ga0068714_10349998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
| 3300006224|Ga0079037_100016832 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → Archaeoglobaceae → Archaeoglobus → Archaeoglobus sulfaticallidus | 5009 | Open in IMG/M |
| 3300006224|Ga0079037_100304388 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300006224|Ga0079037_100341313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1402 | Open in IMG/M |
| 3300006224|Ga0079037_100448237 | Not Available | 1231 | Open in IMG/M |
| 3300006224|Ga0079037_100461460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1213 | Open in IMG/M |
| 3300006224|Ga0079037_100591567 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006224|Ga0079037_100600263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1067 | Open in IMG/M |
| 3300006224|Ga0079037_100741675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 961 | Open in IMG/M |
| 3300006224|Ga0079037_100821127 | Not Available | 913 | Open in IMG/M |
| 3300006224|Ga0079037_101330517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 715 | Open in IMG/M |
| 3300006224|Ga0079037_101479935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 677 | Open in IMG/M |
| 3300006224|Ga0079037_101492700 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006224|Ga0079037_101896993 | Not Available | 595 | Open in IMG/M |
| 3300006224|Ga0079037_101984489 | Not Available | 581 | Open in IMG/M |
| 3300006224|Ga0079037_102249132 | Not Available | 544 | Open in IMG/M |
| 3300006930|Ga0079303_10048510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1493 | Open in IMG/M |
| 3300006930|Ga0079303_10080370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1202 | Open in IMG/M |
| 3300006930|Ga0079303_10160472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300006930|Ga0079303_10320820 | Not Available | 643 | Open in IMG/M |
| 3300007072|Ga0073932_1002950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 24454 | Open in IMG/M |
| 3300007072|Ga0073932_1008361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9590 | Open in IMG/M |
| 3300007072|Ga0073932_1012692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6754 | Open in IMG/M |
| 3300009037|Ga0105093_10114077 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300009078|Ga0105106_10607615 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin412 | 783 | Open in IMG/M |
| 3300009081|Ga0105098_10255278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 828 | Open in IMG/M |
| 3300009087|Ga0105107_11164842 | Not Available | 538 | Open in IMG/M |
| 3300009091|Ga0102851_10540490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1206 | Open in IMG/M |
| 3300009091|Ga0102851_11163084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfarculales → Desulfarculaceae → Desulfarculus → unclassified Desulfarculus → Desulfarculus sp. | 847 | Open in IMG/M |
| 3300009111|Ga0115026_11502712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 561 | Open in IMG/M |
| 3300009146|Ga0105091_10153661 | Not Available | 1080 | Open in IMG/M |
| 3300009153|Ga0105094_10472645 | Not Available | 728 | Open in IMG/M |
| 3300009153|Ga0105094_10871348 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009167|Ga0113563_12556999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-23 | 616 | Open in IMG/M |
| 3300009168|Ga0105104_10055332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2156 | Open in IMG/M |
| 3300009168|Ga0105104_10087299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1679 | Open in IMG/M |
| 3300009179|Ga0115028_11540624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300009179|Ga0115028_11902133 | Not Available | 521 | Open in IMG/M |
| 3300011340|Ga0151652_10892362 | Not Available | 518 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10238079 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300014266|Ga0075359_1108677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 576 | Open in IMG/M |
| 3300014321|Ga0075353_1093567 | Not Available | 693 | Open in IMG/M |
| 3300018029|Ga0187787_10106750 | Not Available | 905 | Open in IMG/M |
| 3300018029|Ga0187787_10370577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 557 | Open in IMG/M |
| 3300019732|Ga0194014_1058892 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025560|Ga0210108_1061212 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300026464|Ga0256814_1011918 | Not Available | 864 | Open in IMG/M |
| 3300026477|Ga0256807_1086545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 543 | Open in IMG/M |
| 3300027693|Ga0209704_1092195 | Not Available | 856 | Open in IMG/M |
| 3300027715|Ga0208665_10141881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 750 | Open in IMG/M |
| 3300027818|Ga0209706_10191795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 994 | Open in IMG/M |
| 3300027871|Ga0209397_10568144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 566 | Open in IMG/M |
| 3300027887|Ga0208980_10350482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300033414|Ga0316619_12024366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 525 | Open in IMG/M |
| 3300033416|Ga0316622_101906135 | Not Available | 691 | Open in IMG/M |
| 3300033418|Ga0316625_100592494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 902 | Open in IMG/M |
| 3300033418|Ga0316625_100935589 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300033419|Ga0316601_100522672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1142 | Open in IMG/M |
| 3300033419|Ga0316601_100600974 | Not Available | 1069 | Open in IMG/M |
| 3300033433|Ga0326726_11864927 | Not Available | 585 | Open in IMG/M |
| 3300033433|Ga0326726_12428670 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300033480|Ga0316620_10226932 | Not Available | 1580 | Open in IMG/M |
| 3300033481|Ga0316600_10590859 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300033483|Ga0316629_10679020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 776 | Open in IMG/M |
| 3300033483|Ga0316629_11394556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 567 | Open in IMG/M |
| 3300033486|Ga0316624_12001039 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300033486|Ga0316624_12042165 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300033493|Ga0316631_10233331 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300033513|Ga0316628_100350845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → unclassified Pelotomaculum → Pelotomaculum sp. PtaU1.Bin065 | 1857 | Open in IMG/M |
| 3300033513|Ga0316628_103225512 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300033521|Ga0316616_101134643 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300033521|Ga0316616_102586811 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300033557|Ga0316617_101433589 | Not Available | 694 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 28.12% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 14.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.59% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 6.25% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.69% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.91% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.12% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.34% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.56% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.78% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.78% |
| Wetland | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland | 0.78% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300000309 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000311 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000917 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail | Environmental | Open in IMG/M |
| 3300001279 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300001547 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005145 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG | Engineered | Open in IMG/M |
| 3300005252 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG | Engineered | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300026477 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5 | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_102648532 | 3300000231 | Groundwater | MGEAGGGLLGNMTERTLHGDTGQTSPPAFAAPYLHGLSRSLFVFCFE |
| WSSedA1BaDRAFT_10292541 | 3300000309 | Wetland | KLQVMGEAGGGLPRNSPRNAQLAGAGETLVAFAAPYLQSLSRTLFVFCF* |
| WSSedA1Ba3DRAFT_10110062 | 3300000311 | Wetland | MGEAGGGLPGNSPHHTQLAGGGETSPPAFAAPYRQSLSRTLFVFCF* |
| WSSedA1Ba3DRAFT_10271321 | 3300000311 | Wetland | NGKLQAMGEAGGGLPENSPRHPWLAGASDTTPPAFAAPYLQSLSRILFVFCF* |
| WSSedA1Ba3DRAFT_10312463 | 3300000311 | Wetland | MGEAGGGLPGNSPRKTQLAGTGETSPPAFAAPCLQSLSRTLFVFCF* |
| WSSedA1Ba3DRAFT_10404373 | 3300000311 | Wetland | KTPHLSGKLQVMGEAGGGLPRNSPRNAQLAGAGETSPPAFAAPYLQSLSRTLFVFCF* |
| WSSedA1Ba3DRAFT_10567752 | 3300000311 | Wetland | EAGGGLIGNSPSNTQLTGVGETSPPAFAASYLPSLSRTLFVFCF* |
| WSSedA2C3DRAFT_10259752 | 3300000917 | Wetland | GGGLPVNSPRPTQLAGAGETSPPAFAAPDLHSLARTLFVFCF* |
| JGI20214J14112_10058731 | 3300001279 | Wetland | MGEAGGGLLGNSPRHTQLAGADETSPPAFAAPYLQGLS |
| JGI20214J14112_10411661 | 3300001279 | Wetland | LPGNSPRNPQLAGAGETSPPAVAAPYLQSLSRTLFVFCF* |
| JGI20215J15232_10059002 | 3300001547 | Wetland | MGEAGGGLPGNLPRHTQRAGAGDTAPPAVAAPYLQSLSRTLFVFCF* |
| JGI11641J44799_100038051 | 3300002961 | Wetland | GGGLIGNSPSNTQLTGVGETSPPAFAASYLPSLSRTLFVFCF* |
| JGI11641J44799_100057106 | 3300002961 | Wetland | MGEAGGGLPGNSPRNPQMAGAGETSPPAFAAPYLQSLSRTLFVFCF* |
| JGI11641J44799_100061423 | 3300002961 | Wetland | MGEAGGGLPENSPRHPWLAGASDTTPPAFAAPYLQSLSRILFVFCF* |
| JGI11641J44799_100120211 | 3300002961 | Wetland | MGEAGGGLQGNSPRHTQLDGAGETSPPAFAAPYLQSLSRTLFVFCF* |
| JGI11641J44799_100763122 | 3300002961 | Wetland | MGEAGGGLRENSPSEAPLAGAGETSPPAFAAPYLXRLSRILFVFCF* |
| JGI11641J44799_100909981 | 3300002961 | Wetland | MGEAGGGLPGNSPRNTPLAGADETSPPAFTVPYLQSLSRTLFVFCF* |
| JGI20214J51088_100053068 | 3300003432 | Wetland | MGEAGGGLPGNSPRHTQLAGAGDTSPPAFAAPYLRGLSRTLFVFCF* |
| JGI20214J51088_100067128 | 3300003432 | Wetland | MGEAGGGLPGKSPDKTLLAGAGETSPPAFAAPCLRGFSRLLFVFCFERDPHGLFL* |
| JGI20214J51088_100117859 | 3300003432 | Wetland | MGEAGGGLPGNSPQHTQLAGAGETPPPAFAAPYLQSLSRTLFVFCF* |
| JGI20214J51088_100450972 | 3300003432 | Wetland | MGETGGGLPGNSPRNTQLAGAGETSPPAFAATYLQGLSRTLFVFCF* |
| JGI20214J51088_100579052 | 3300003432 | Wetland | MGEAGGGLPGNSPRNTQMAGGGETSPPAFAAPYLQSLSRTLFVFCF* |
| JGI20214J51088_101414392 | 3300003432 | Wetland | MGEAGGGLPGNSPRNPQMAGAGETSPPAVAAPYLQSLSRTLFVFCF* |
| JGI20214J51088_101829793 | 3300003432 | Wetland | MGMAGGGLPRNLPSETLQAGAGETSPPAFAASYLHSLSRILFVFC |
| JGI20214J51088_105149341 | 3300003432 | Wetland | MGEAGGGLPRNSPRHSQLAGAGEISPPAFAAPYLQSLSRTLFVFCF |
| JGI20214J51650_1000133915 | 3300003541 | Wetland | MGEAGGGLSGNSPIETLLAGAGETSPPAFAAPYLRSLSRIPFVFCF* |
| JGI20214J51650_100032818 | 3300003541 | Wetland | MGEAGGGLPGNSPSAILQAGAGETSPPAFAAVYPHSLSRTLFVFCF* |
| JGI20214J51650_100049904 | 3300003541 | Wetland | MGEAGGGLPGNSPRNTQLAGADETSPPAFAVPYLQSLSLTLFVFCL* |
| JGI20214J51650_100050426 | 3300003541 | Wetland | MGEAGGGLPRNSPSKTLHGGAGETSPPAFAASYLRSFSRLLFVFCFEGDPHGLFL* |
| JGI20214J51650_100129215 | 3300003541 | Wetland | MGEAGGGLPGNSPAKTVHGGSGETSPPAFAAPYLRSSSRILFVFCF* |
| JGI20214J51650_100129526 | 3300003541 | Wetland | MGEAGGGLLENLPDKTLHGSAGETSPPAFAASYLRIIPRSLFVFCFERDSHGLFL* |
| JGI20214J51650_100155083 | 3300003541 | Wetland | MGEAGGGLPGNSPRHPQLAGAGETSPPAFAAPCLQSLSRTLFVFCF* |
| JGI20214J51650_100156047 | 3300003541 | Wetland | MGEAGGGLPGTSPRHTHLAGAGETSPPAFAAPDLQFLSRTLFVFCF* |
| JGI20214J51650_100161945 | 3300003541 | Wetland | MGEAGGGLVGNSPSNTQLTGAGETSPPAFAASYLPSLFRTLFVFCF* |
| JGI20214J51650_103573392 | 3300003541 | Wetland | MGEAGGGLLGNLPRPTQLAGAGETSPPAFAAPDLQSLSRTLFVFCF* |
| JGI20214J51650_106336711 | 3300003541 | Wetland | MGMAGGGLPRNLPSETLQAGAGETSPPAFAASYLHSLSRILFVFCFERDPHGLLL* |
| JGI20214J51650_107719131 | 3300003541 | Wetland | MGEAGGGLPGNSSSKTPLAGAGETSPPAFAAPYLHSLSRTLFVFCF* |
| JGI26437J51864_100017878 | 3300003910 | Freshwater Lake Sediment | MREAGGGLPGNSPRYPHLTGAGDTSPPAFAAPYVQSLSRTLFVLFLEG |
| JGI26437J51864_100019731 | 3300003910 | Freshwater Lake Sediment | MGEAGGGLPGNSPSKILPAGAGETSPPAFAAPCLHSLSRTLFVFCF* |
| JGI26437J51864_100145781 | 3300003910 | Freshwater Lake Sediment | EAGGGLPGNSPRYPHLTGAGDTSPPAFAAPYVQSLSRTLFVFCF* |
| JGI26437J51864_101139551 | 3300003910 | Freshwater Lake Sediment | VGEAGGGLPRNSPRNAQLAGAGETSPPAFAAPYLQSLSRTLFVFCF |
| Ga0055500_101428001 | 3300004062 | Natural And Restored Wetlands | MGDAGGGLPGNSLRNTQLAGTGETSPPAFAAPYLQSLSRTLFV |
| Ga0055484_100210181 | 3300004066 | Natural And Restored Wetlands | KKPHSSVQLQAMGEAGGGLLGNSPSETPLAGAGETSPPAFAAPCLQSLSRILFVFCF* |
| Ga0055486_101307951 | 3300004071 | Natural And Restored Wetlands | MGEAGGGLLENLPWKTLHGGAGEAAPPAFAAPSLRCFSRSLFVFCFERDP |
| Ga0055514_101305061 | 3300004079 | Natural And Restored Wetlands | MGEAGGMLPEKSPRNTQLAGAGETSPPAFAAPYLQSLSRTLFVFCF |
| Ga0055495_102190221 | 3300004146 | Natural And Restored Wetlands | MGEAGGGLRGDPPCHTQLAGAGDNSPPAFAAPYLQSLSRTLFV |
| Ga0069718_158041512 | 3300004481 | Sediment | MGEAGGGLPGNSPTKTSLAGAGETSPPAFAAPYLHSLSLLL |
| Ga0068713_11319712 | 3300005145 | Enrichment Culture | MGEAGGGLPGDLPAKTLHGGDGETSPPAFAAPYLQSLSRILFVFLF* |
| Ga0068712_11188553 | 3300005252 | Enrichment Culture | MGEAGGGLQGNSPCKTLRAGANETSPPAFAGPYLRSFSRSLFVFC |
| Ga0068714_100158565 | 3300005254 | Enrichment Culture | MGEAGGGLPGNLPSKIMQAGTGETSPPAFAAPYLRGFSRTLFVFCF* |
| Ga0068714_100386072 | 3300005254 | Enrichment Culture | MPHHNGQLWAMGEAGGGLPGNSPSNPQLTGTEETSPPAFVTPSLHGLSRTLFVFCF* |
| Ga0068714_100535823 | 3300005254 | Enrichment Culture | MGEAGGGLLRDSLSGILQACAGETSPPAFAASYLRSSSRSLFVFCFEGDPHGLLL* |
| Ga0068714_101041982 | 3300005254 | Enrichment Culture | MGEAGGGLPEDSPRYTQLAGAGEASPPAFAAPCLQSLPRTLFVFRF* |
| Ga0068714_102268891 | 3300005254 | Enrichment Culture | MGEAGGGLPGNSPRHTQLAGAGDTSPPAFAAPYLQSLSRTLF |
| Ga0068714_103499982 | 3300005254 | Enrichment Culture | MGEAGGGLPGNSSSKPLLAGAGETSPPAFAAPYLRDLSRSLFVFQF* |
| Ga0079037_1000168323 | 3300006224 | Freshwater Wetlands | MGEAGGGLLGNLPAKTLHGGAGETSPPAFAVPYLRNVS* |
| Ga0079037_1003043884 | 3300006224 | Freshwater Wetlands | MGEAGGELPGISPSNTLLAGAGETSPPAFAAPYLLGLSCILFVFCF* |
| Ga0079037_1003413133 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGTSPRHTHLAGAGETSPPAFAAPDLLSLSRTLFVFCF* |
| Ga0079037_1004482371 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGNSPCNTPLAGAGETSPPAFAAPYLQSLSRT |
| Ga0079037_1004614601 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGDTPRNPQLAGGGDTSPPAFAAPYLQRLSRTLFVFCF* |
| Ga0079037_1005915672 | 3300006224 | Freshwater Wetlands | MGEAGGGLAGNSPSNTQLTGAGETSPPAFAASYLPSLSLTLFVFCF* |
| Ga0079037_1006002633 | 3300006224 | Freshwater Wetlands | MGEAGGALPGNSPSKTLHGGAGETSPPAFAASYLR |
| Ga0079037_1007416752 | 3300006224 | Freshwater Wetlands | MGEAGGGLQGNSPSAIRQAGAGETSPPAFAAPYLHSLSRLLFVFCF* |
| Ga0079037_1008211271 | 3300006224 | Freshwater Wetlands | GNSSPHSQLAGAGDISPPAFAAPYLQSLSRPLFVFCF* |
| Ga0079037_1013305172 | 3300006224 | Freshwater Wetlands | MGEAGGGLPWNSPHHTQLTGTGKTSPPAFAAPYLQSLSRPLFVFCF* |
| Ga0079037_1014799352 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGNPPCNTPLAVAGETSPPAFAAPYLQGLSRTLFVFCF* |
| Ga0079037_1014927001 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGNSPSKALQAGAGETSPPAFAAPHLQSPSRTLFVFCF* |
| Ga0079037_1018969932 | 3300006224 | Freshwater Wetlands | TGEAGGGLLGNSPRSIQLTGAGETSPPAFAAPYQQSLSRTLFVFCF* |
| Ga0079037_1019844892 | 3300006224 | Freshwater Wetlands | MGEAGGGLLGNLPAKTLHGGAGESSPPAFAAPYLRSVSRSLFVFCFERDPHGL |
| Ga0079037_1022491322 | 3300006224 | Freshwater Wetlands | MGEAGGGLPGNSPRNTQLAGPGETSPPAFAALYLQSLSRKLFVFCF* |
| Ga0079303_100485102 | 3300006930 | Deep Subsurface | MGEAGGGLPGNSPRHTQLAGAGDTSPPAFAAPYLRSLSRILFVFYF* |
| Ga0079303_100803702 | 3300006930 | Deep Subsurface | MGEAGGGLAGNSPSSTQLTGAGETSPPAFAASYLPSLSRTLFVFCF* |
| Ga0079303_101604722 | 3300006930 | Deep Subsurface | MGEAGGGLPEDSPRHTQLASAGETSPPAFAAPYLQSPSRTLFVFCF* |
| Ga0079303_103208201 | 3300006930 | Deep Subsurface | MAQAMGEAGGGLPGNSPRPTQLAGAGYTSPPAFAAPDLQSLFRTLFVFCF* |
| Ga0073932_100295023 | 3300007072 | Hot Spring Sediment | MPHHDGRLWATGEAGGGLPGNSPRHPQLAGAGETSPPAFAAPYLQSLSRTLFVFCF* |
| Ga0073932_10083611 | 3300007072 | Hot Spring Sediment | MGEAGGGLPGNSSPHPQLAGAGGLSPPAFAAPYLQSLSRPLFVFCF* |
| Ga0073932_10126923 | 3300007072 | Hot Spring Sediment | MPHPLGWLWAMGEAGGGPPGNSPWNPQRTGTEETTPPAFATPCLRSLSRTLFVFCF* |
| Ga0105093_101140771 | 3300009037 | Freshwater Sediment | MGEAGGGLPANSPTNTQLTGAGEISPPAFAAHYLESLSRTLFVFCFERDPHGSF |
| Ga0105106_106076151 | 3300009078 | Freshwater Sediment | RCVQLWAMGEAGGGLPGNSPDKTLYAGAGETSPPAFAAAYLRSFSRSLFVFCFERDPHGLFL* |
| Ga0105098_102552781 | 3300009081 | Freshwater Sediment | MGEAGGGLLGNSPRNTQLAGAGETSPPAFAAPYLQSLSLTL |
| Ga0105107_111648421 | 3300009087 | Freshwater Sediment | QLWAMGEAGGGLPGNSPDKTLRAGAGETSPPAFAAPYLRS* |
| Ga0102851_105404901 | 3300009091 | Freshwater Wetlands | MGEAGGGLPGNPPRHSQLAGAGETSPPAFAAPYLQ |
| Ga0102851_111630842 | 3300009091 | Freshwater Wetlands | MGEAGGRLPGNSPSKTLLADAGEASPPAFAAPYLH |
| Ga0115026_115027122 | 3300009111 | Wetland | MGEAGGGLLENLPSKTLHGGAGETSPPAFAASYLRDISRSIFVFCFERDPHDLLL* |
| Ga0105091_101536611 | 3300009146 | Freshwater Sediment | MGEAGGGLAGNLPRNTHLAGAGETSPPAFAAPYLRS |
| Ga0105094_104726451 | 3300009153 | Freshwater Sediment | MGEAGGGLPENSPCHTQLAGAGETSPPAFAAPHLPSLSRTLFVFCF |
| Ga0105094_108713482 | 3300009153 | Freshwater Sediment | MGEAGGGLSGNSPGETLLAGAGETLPPAFVAPYLRSLSRILFVFCF* |
| Ga0113563_125569992 | 3300009167 | Freshwater Wetlands | QLWAMGEAGGGLPGNSPGKTFSAGAGETSPPAFAAPCLRGISRSLFVFCFERDLHGLFL* |
| Ga0105104_100553323 | 3300009168 | Freshwater Sediment | PHINGKLWVMGEAGGGLAGNLPRNTHLAGAGKTAPPAFAAPYLRRLFRTLFGFCF* |
| Ga0105104_100872991 | 3300009168 | Freshwater Sediment | SPRNTQMASGGETSPPAFAAPDLQSLSRTLFVFCF* |
| Ga0115028_115406241 | 3300009179 | Wetland | RFSQIWAMGEAGGGLLGNLPAKTLHGGAGETPPPAFAAPYLRSISRSLFVFSF* |
| Ga0115028_119021331 | 3300009179 | Wetland | GEAGGGLPGNSPCNTQLAGAGETSPPAFAAPYLQSLFRTLFVFCF* |
| Ga0151652_108923621 | 3300011340 | Wetland | MGEAGGGLLMNLPAKILHGGAGETSPPAFAASYLHSLS |
| (restricted) Ga0172371_102380793 | 3300013138 | Freshwater | MGEAGGGLPGNSPRHTQLAGAGETAPPAFAAPYLQSLSRTLFVFCFW |
| Ga0075359_11086771 | 3300014266 | Natural And Restored Wetlands | MGEAGGGLSGNSPIETLLAGAGETSPPAFAAPYLRSLSRIPFVFC |
| Ga0075353_10935673 | 3300014321 | Natural And Restored Wetlands | MGEAGGGLPGNSPDKTLRAGAGEPSPPAFAAPCLRGITRSLFVFGFERDPHGLFL |
| Ga0187787_101067502 | 3300018029 | Tropical Peatland | MGEAGGGLLENLPAKTLDGGASETSPPAFTPPYLRD |
| Ga0187787_103705772 | 3300018029 | Tropical Peatland | YLVAAKGLHWAMGEAGGGLPGNSPPKALQAGAGETSPPAFAAPYLRSLSCTLFVFCF |
| Ga0172286_13627311 | 3300019252 | Wetland | KKPHRCVQLWAMGEAGGGLPENSPDKALGAGAGETSPPAFAAPYLRS |
| Ga0194014_10588922 | 3300019732 | Sediment | MGEAGGGLPGNSPSKLLQAGAGETSPPAFAAPYLHGLTRILFVFCFERDPHGLVL |
| Ga0210108_10612122 | 3300025560 | Natural And Restored Wetlands | MGEAGGGLLENLPAETLHGGAGETSPPAFAAPYLRSISR |
| Ga0256814_10119181 | 3300026464 | Sediment | MGEAGGGLPGNSPRHTQLAGVGETSPPAFAAPDLQSLSRT |
| Ga0256807_10865452 | 3300026477 | Sediment | MGEAGGGLPGNSLRYTQLAGACDNSPPAFAAPYLQSPFS |
| Ga0209704_10921953 | 3300027693 | Freshwater Sediment | SSRNTQLAGAGETSPPAFAAPYLQSLSRPLFVFCF |
| Ga0208665_101418811 | 3300027715 | Deep Subsurface | MGEAGGGLLGNLPAKILHGGAGETPPPAFAAPYLRSISRSLF |
| Ga0209706_101917951 | 3300027818 | Freshwater Sediment | MGEAGGGLPGNLPAKILHGGAGETSPPAFAAPYLRSVSRSLFVFCFETDPHGL |
| Ga0209397_105681441 | 3300027871 | Wetland | MGEAGGGLPGNSLRYTQLAGAGDNSPPAFAAPYLQSLSCTLFV |
| Ga0208980_103504821 | 3300027887 | Wetland | MGEAGGGLPRNSPNINVYAGAGETSPPAFAAYYLRVFSRSLFVFCFEGDPHGLFLKQ |
| Ga0316619_120243662 | 3300033414 | Soil | VGEAGGGLPRNSPDEALQEGAGETSPPAFAASCLR |
| Ga0316622_1019061352 | 3300033416 | Soil | MGEAGGGPPENSPRHTQLAGAGETSPPAFAAPYLQSL |
| Ga0316625_1005924942 | 3300033418 | Soil | MGEAGGMLPENSPRNTQLAGAGETSPPAFAAPYLL |
| Ga0316625_1009355891 | 3300033418 | Soil | KPHHIVQLWAMGEAGGGLLGNLPAKILHGGAGETPPPAFAAPYLRSISRSLFVFSF |
| Ga0316601_1005226722 | 3300033419 | Soil | EAGGGLPGNSPRNTQLACADETSPPAFAVPYLQSLSLTLFVFCF |
| Ga0316601_1006009742 | 3300033419 | Soil | HRVQLYATGETGGGLLENLPAKSLHGGAGETSPPAIAAPYLRDISRSLFVFCF |
| Ga0326726_118649271 | 3300033433 | Peat Soil | MGEAGEGLPGNLPAKTLHGGAGEAPPPAFAASCLRS |
| Ga0326726_124286702 | 3300033433 | Peat Soil | MGEAGGGLLGNSPGETLLAGAGETSPPAFAAPYLRSLSRTLF |
| Ga0316620_102269321 | 3300033480 | Soil | VKLWVMGEAGGGLLENLPEKTLHGSAGETSPPAFAAPCLHGFSRILFVFCF |
| Ga0316600_105908591 | 3300033481 | Soil | MGEAGGGLPKNSSAETQQAGAGETSPPAFPAPCLRNLS |
| Ga0316629_106790202 | 3300033483 | Soil | MLPENSPRNTQLAGAGETSPPAFAAPYLLSLPLTLFVF |
| Ga0316629_113945561 | 3300033483 | Soil | MGEAGGGLPGNSLRYTKMAGAGDNSPPAFAAPYLQ |
| Ga0316624_120010392 | 3300033486 | Soil | MGEAGGRLPGDSPSKVLHGGAGETSPPAFAAPHLRIIYRSLFVFSFERDPHGLFLGLFQK |
| Ga0316624_120421651 | 3300033486 | Soil | MGEAGGGLPETSPSKTLQGGAGETSPPAFAASYLRSISLSLL |
| Ga0316631_102333312 | 3300033493 | Soil | MGEAGGELLGNSPRSIQLTGAGETSPPAFAAPYLQTLSR |
| Ga0316628_1003508451 | 3300033513 | Soil | MGEAGGGLQGNLPAKILDGGAGETSPPAFAASYLRSLS |
| Ga0316628_1032255122 | 3300033513 | Soil | MGEAGGGLLGNLPAKTVHGGVGEASPPAFAAPYLRSI |
| Ga0316616_1011346431 | 3300033521 | Soil | MAEAMGEAGGGLQGNSPSAILQAGAGETSPPAFAAYYLRSFS |
| Ga0316616_1025868111 | 3300033521 | Soil | MGEAGGELPGISPSNTLLAGAGETSPPAFAAPYLLGLSCILFVFCF |
| Ga0316617_1014335891 | 3300033557 | Soil | MGEAGGGLPGNVPAKTLHGGAGEASPPAFAASYLHSVSRMLFVFC |
| ⦗Top⦘ |