


| Basic Information | |
|---|---|
| Family ID | F064778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDL |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.36 % |
| % of genes near scaffold ends (potentially truncated) | 59.38 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.406 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.656 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF04380 | BMFP | 32.81 |
| PF14693 | Ribosomal_TL5_C | 25.00 |
| PF01790 | LGT | 21.88 |
| PF01386 | Ribosomal_L25p | 10.16 |
| PF02636 | Methyltransf_28 | 4.69 |
| PF01195 | Pept_tRNA_hydro | 3.12 |
| PF01575 | MaoC_dehydratas | 0.78 |
| PF06071 | YchF-GTPase_C | 0.78 |
| PF02578 | Cu-oxidase_4 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2960 | Ubiquinone biosynthesis accessory factor UbiK | Coenzyme transport and metabolism [H] | 32.81 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 21.88 |
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 10.16 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 4.69 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 3.12 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.41 % |
| Unclassified | root | N/A | 33.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0727473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7100 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10024244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1656 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10123530 | Not Available | 541 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1013335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 864 | Open in IMG/M |
| 3300001915|JGI24741J21665_1022783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 969 | Open in IMG/M |
| 3300002070|JGI24750J21931_1001636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2749 | Open in IMG/M |
| 3300003911|JGI25405J52794_10087702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 687 | Open in IMG/M |
| 3300003995|Ga0055438_10090870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 851 | Open in IMG/M |
| 3300004070|Ga0055488_10032405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1051 | Open in IMG/M |
| 3300004798|Ga0058859_10694086 | Not Available | 504 | Open in IMG/M |
| 3300005163|Ga0066823_10063589 | Not Available | 694 | Open in IMG/M |
| 3300005183|Ga0068993_10121073 | Not Available | 858 | Open in IMG/M |
| 3300005204|Ga0068997_10019153 | Not Available | 1107 | Open in IMG/M |
| 3300005204|Ga0068997_10019720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
| 3300005218|Ga0068996_10038069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 885 | Open in IMG/M |
| 3300005288|Ga0065714_10457582 | Not Available | 549 | Open in IMG/M |
| 3300005293|Ga0065715_10043139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1080 | Open in IMG/M |
| 3300005293|Ga0065715_10148517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1758 | Open in IMG/M |
| 3300005328|Ga0070676_10015055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4261 | Open in IMG/M |
| 3300005329|Ga0070683_100281939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1580 | Open in IMG/M |
| 3300005332|Ga0066388_100319133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2199 | Open in IMG/M |
| 3300005332|Ga0066388_101259546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1271 | Open in IMG/M |
| 3300005332|Ga0066388_105930337 | Not Available | 617 | Open in IMG/M |
| 3300005332|Ga0066388_106347118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300005332|Ga0066388_107841601 | Not Available | 534 | Open in IMG/M |
| 3300005332|Ga0066388_108346928 | Not Available | 516 | Open in IMG/M |
| 3300005336|Ga0070680_100192344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1719 | Open in IMG/M |
| 3300005339|Ga0070660_100172944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1745 | Open in IMG/M |
| 3300005339|Ga0070660_101388989 | Not Available | 596 | Open in IMG/M |
| 3300005458|Ga0070681_10590887 | Not Available | 1024 | Open in IMG/M |
| 3300005547|Ga0070693_100132926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1558 | Open in IMG/M |
| 3300005764|Ga0066903_102503166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
| 3300005764|Ga0066903_102910258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300005764|Ga0066903_103380760 | Not Available | 861 | Open in IMG/M |
| 3300005764|Ga0066903_107507613 | Not Available | 562 | Open in IMG/M |
| 3300005843|Ga0068860_101770764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300006057|Ga0075026_100282311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 901 | Open in IMG/M |
| 3300006353|Ga0075370_10037259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2734 | Open in IMG/M |
| 3300006603|Ga0074064_11588704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 516 | Open in IMG/M |
| 3300006914|Ga0075436_100188824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1458 | Open in IMG/M |
| 3300006954|Ga0079219_10240252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300009092|Ga0105250_10192420 | Not Available | 859 | Open in IMG/M |
| 3300009545|Ga0105237_10034469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5125 | Open in IMG/M |
| 3300010043|Ga0126380_10350919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1074 | Open in IMG/M |
| 3300010046|Ga0126384_10130646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1906 | Open in IMG/M |
| 3300010046|Ga0126384_11266228 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010046|Ga0126384_11741999 | Not Available | 590 | Open in IMG/M |
| 3300010362|Ga0126377_10207558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
| 3300010373|Ga0134128_12022750 | Not Available | 634 | Open in IMG/M |
| 3300010376|Ga0126381_100894482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1278 | Open in IMG/M |
| 3300010396|Ga0134126_10117535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3253 | Open in IMG/M |
| 3300012357|Ga0137384_10525840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 970 | Open in IMG/M |
| 3300012477|Ga0157336_1024679 | Not Available | 567 | Open in IMG/M |
| 3300012505|Ga0157339_1059015 | Not Available | 527 | Open in IMG/M |
| 3300012507|Ga0157342_1010613 | Not Available | 944 | Open in IMG/M |
| 3300012515|Ga0157338_1002056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1536 | Open in IMG/M |
| 3300012893|Ga0157284_10009966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1653 | Open in IMG/M |
| 3300012893|Ga0157284_10336929 | Not Available | 506 | Open in IMG/M |
| 3300012896|Ga0157303_10059837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300012960|Ga0164301_10096623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
| 3300012971|Ga0126369_10343684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1511 | Open in IMG/M |
| 3300012971|Ga0126369_10567362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1201 | Open in IMG/M |
| 3300012971|Ga0126369_11822808 | Not Available | 697 | Open in IMG/M |
| 3300012985|Ga0164308_10002945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 8915 | Open in IMG/M |
| 3300012986|Ga0164304_10329860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1058 | Open in IMG/M |
| 3300012987|Ga0164307_10006163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5621 | Open in IMG/M |
| 3300012989|Ga0164305_11289925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 638 | Open in IMG/M |
| 3300013102|Ga0157371_10393071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1014 | Open in IMG/M |
| 3300013105|Ga0157369_10834923 | Not Available | 946 | Open in IMG/M |
| 3300013105|Ga0157369_11078365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
| 3300015077|Ga0173483_10776539 | Not Available | 550 | Open in IMG/M |
| 3300015373|Ga0132257_101563293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 843 | Open in IMG/M |
| 3300015374|Ga0132255_100536404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1723 | Open in IMG/M |
| 3300017947|Ga0187785_10039796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1731 | Open in IMG/M |
| 3300017959|Ga0187779_10679488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 695 | Open in IMG/M |
| 3300017974|Ga0187777_10271767 | Not Available | 1154 | Open in IMG/M |
| 3300019361|Ga0173482_10119706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300019361|Ga0173482_10289074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300021344|Ga0193719_10133650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1075 | Open in IMG/M |
| 3300022889|Ga0247785_1031962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 619 | Open in IMG/M |
| 3300022893|Ga0247787_1005112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1492 | Open in IMG/M |
| 3300022901|Ga0247788_1052040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300023062|Ga0247791_1007119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1649 | Open in IMG/M |
| 3300023062|Ga0247791_1024637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 908 | Open in IMG/M |
| 3300025900|Ga0207710_10001206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 13122 | Open in IMG/M |
| 3300025913|Ga0207695_10199839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1914 | Open in IMG/M |
| 3300025921|Ga0207652_10020801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5408 | Open in IMG/M |
| 3300025921|Ga0207652_11078749 | Not Available | 703 | Open in IMG/M |
| 3300025924|Ga0207694_10174373 | Not Available | 1742 | Open in IMG/M |
| 3300025926|Ga0207659_11811461 | Not Available | 518 | Open in IMG/M |
| 3300025938|Ga0207704_10375584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1114 | Open in IMG/M |
| 3300025957|Ga0210089_1054237 | Not Available | 518 | Open in IMG/M |
| 3300026067|Ga0207678_10198766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1714 | Open in IMG/M |
| 3300026116|Ga0207674_10815083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 900 | Open in IMG/M |
| 3300026142|Ga0207698_12107842 | Not Available | 577 | Open in IMG/M |
| 3300026715|Ga0207604_100713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 816 | Open in IMG/M |
| 3300026731|Ga0207523_100559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 815 | Open in IMG/M |
| 3300026765|Ga0207590_101470 | Not Available | 555 | Open in IMG/M |
| 3300026995|Ga0208761_1021332 | Not Available | 619 | Open in IMG/M |
| 3300027288|Ga0208525_1011681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 968 | Open in IMG/M |
| 3300027364|Ga0209967_1001836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2728 | Open in IMG/M |
| 3300027474|Ga0207457_101881 | Not Available | 546 | Open in IMG/M |
| 3300027543|Ga0209999_1042789 | Not Available | 850 | Open in IMG/M |
| 3300027775|Ga0209177_10350742 | Not Available | 578 | Open in IMG/M |
| 3300027787|Ga0209074_10115236 | Not Available | 926 | Open in IMG/M |
| 3300028713|Ga0307303_10182497 | Not Available | 515 | Open in IMG/M |
| 3300028755|Ga0307316_10179326 | Not Available | 760 | Open in IMG/M |
| 3300028811|Ga0307292_10214132 | Not Available | 794 | Open in IMG/M |
| 3300028824|Ga0307310_10318910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 759 | Open in IMG/M |
| 3300031573|Ga0310915_10000056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 56530 | Open in IMG/M |
| 3300031595|Ga0265313_10008643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6735 | Open in IMG/M |
| 3300031720|Ga0307469_10839891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 846 | Open in IMG/M |
| 3300031751|Ga0318494_10119205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1469 | Open in IMG/M |
| 3300031820|Ga0307473_11215134 | Not Available | 561 | Open in IMG/M |
| 3300031846|Ga0318512_10184407 | Not Available | 1017 | Open in IMG/M |
| 3300031854|Ga0310904_10426136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 874 | Open in IMG/M |
| 3300031892|Ga0310893_10001989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4864 | Open in IMG/M |
| 3300031913|Ga0310891_10018554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1709 | Open in IMG/M |
| 3300032017|Ga0310899_10072267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1326 | Open in IMG/M |
| 3300032174|Ga0307470_11017366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 660 | Open in IMG/M |
| 3300032180|Ga0307471_100740693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1148 | Open in IMG/M |
| 3300032205|Ga0307472_100559139 | Not Available | 1000 | Open in IMG/M |
| 3300032205|Ga0307472_100721549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 899 | Open in IMG/M |
| 3300032205|Ga0307472_100731126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 894 | Open in IMG/M |
| 3300032211|Ga0310896_10318233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 809 | Open in IMG/M |
| 3300033433|Ga0326726_10213625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1785 | Open in IMG/M |
| 3300033513|Ga0316628_102659287 | Not Available | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.03% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.12% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 3.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026715 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026731 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026765 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A1-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027474 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09.2A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_07274735 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MEKGGFFAACARGKPPGVPGAANGAGYSGSFPKGQENRADP* |
| AF_2010_repII_A1DRAFT_100242443 | 3300000597 | Forest Soil | MEKGGFFAACARGKPPGVPGTANGAGYSGSFPKGQENRADP* |
| AF_2010_repII_A001DRAFT_101235302 | 3300000793 | Forest Soil | MEKGGFFAACARGKPPGVPGTANGAGYNGSFPKGQE |
| AF_2010_repII_A10DRAFT_10133352 | 3300000816 | Forest Soil | MEKGDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADP* |
| JGI24741J21665_10227833 | 3300001915 | Corn Rhizosphere | FSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| JGI24750J21931_10016362 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSXDGRKGQEITDLGR* |
| JGI25405J52794_100877022 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MEKAAFSAACERGKPPGVPGAANGPGYSDDRRKGQETTDRGR* |
| Ga0055438_100908703 | 3300003995 | Natural And Restored Wetlands | TNGKGGFSAACERGKPPGVPGAANEAGYSDDGRKGQEITDLGR* |
| Ga0055488_100324052 | 3300004070 | Natural And Restored Wetlands | MEKAASAACERGKPPGVPGAANEAGYSDDGRKGQEITDLGR* |
| Ga0058859_106940861 | 3300004798 | Host-Associated | MEKGGFFAACARGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0066823_100635891 | 3300005163 | Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT* |
| Ga0068993_101210731 | 3300005183 | Natural And Restored Wetlands | MEKAAFFAARVRGKPPGVPGAANRAGYSGGVRKGQEIRVR |
| Ga0068997_100191531 | 3300005204 | Natural And Restored Wetlands | MEKAAFFAAGVRGKPPGVPGAANRAGYSGGVRKGQEIRVRP |
| Ga0068997_100197202 | 3300005204 | Natural And Restored Wetlands | MEKAASAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR* |
| Ga0068996_100380692 | 3300005218 | Natural And Restored Wetlands | MEGGFSAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR* |
| Ga0065714_104575821 | 3300005288 | Miscanthus Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0065715_100431393 | 3300005293 | Miscanthus Rhizosphere | PMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0065715_101485171 | 3300005293 | Miscanthus Rhizosphere | PSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0070676_100150556 | 3300005328 | Miscanthus Rhizosphere | LNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0070683_1002819391 | 3300005329 | Corn Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0066388_1003191332 | 3300005332 | Tropical Forest Soil | MEKAAFSAACERGKPPGVPGAANGPGYSDGGRKGQETTDQAR* |
| Ga0066388_1012595462 | 3300005332 | Tropical Forest Soil | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQETTGLGR* |
| Ga0066388_1059303372 | 3300005332 | Tropical Forest Soil | MEKGGFFAACARGKPPGVPGTANGAGYSGSFPKGQENHADP* |
| Ga0066388_1063471182 | 3300005332 | Tropical Forest Soil | MEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETTDLGR* |
| Ga0066388_1078416012 | 3300005332 | Tropical Forest Soil | MEKGGFFAACARGKPPGVPGAANGAGYSVSIPKGQENRADP* |
| Ga0066388_1083469282 | 3300005332 | Tropical Forest Soil | MEKGGFFAACARGKPPGVPGTANGAGYNGSFPKGQENRTDP* |
| Ga0070680_1001923444 | 3300005336 | Corn Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDGH* |
| Ga0070660_1001729441 | 3300005339 | Corn Rhizosphere | EKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0070660_1013889892 | 3300005339 | Corn Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDL |
| Ga0070681_105908872 | 3300005458 | Corn Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGRMTSPQ |
| Ga0070693_1001329261 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT* |
| Ga0066903_1025031662 | 3300005764 | Tropical Forest Soil | MEKGGFFAAYERGKPPGVPGAANGAGYSGSIAKGQEKPADA* |
| Ga0066903_1029102582 | 3300005764 | Tropical Forest Soil | MEKGGFFADCARGKPPGVPGAANGAGYSGTIRKGQENRPDP* |
| Ga0066903_1033807601 | 3300005764 | Tropical Forest Soil | MEKAAFSAACERGKPPGVPGAANAAGYSGGGRKEQGTTPLS |
| Ga0066903_1075076132 | 3300005764 | Tropical Forest Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQESRADP* |
| Ga0068860_1017707643 | 3300005843 | Switchgrass Rhizosphere | KPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0075026_1002823111 | 3300006057 | Watersheds | MEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTGH* |
| Ga0075370_100372594 | 3300006353 | Populus Endosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADRSP* |
| Ga0074064_115887042 | 3300006603 | Soil | MFESSFKPMEKAAFFAAYERGKPPGVPGAANGAGYSGSIPKGQENRADT* |
| Ga0075436_1001888242 | 3300006914 | Populus Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQETTGLRR* |
| Ga0079219_102402523 | 3300006954 | Agricultural Soil | MEKAAFSAACERGKPPGVPGTANAAVYSGGSAKGQETGGRRNGR* |
| Ga0105250_101924201 | 3300009092 | Switchgrass Rhizosphere | MEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSG |
| Ga0105237_100344695 | 3300009545 | Corn Rhizosphere | MEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT* |
| Ga0126380_103509193 | 3300010043 | Tropical Forest Soil | NPSSKSMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRPDL* |
| Ga0126384_101306464 | 3300010046 | Tropical Forest Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQETAQT |
| Ga0126384_112662281 | 3300010046 | Tropical Forest Soil | ACERGKPPGVPGAANGPGYSDDGRKGQETADLGR* |
| Ga0126384_117419991 | 3300010046 | Tropical Forest Soil | KGGFFAACARGKPPGVPGAANGAGYSGSIPKGQESRADP* |
| Ga0126377_102075584 | 3300010362 | Tropical Forest Soil | MEKDGFFAACARGKPPGVPGAANGAGYSGSIPKGQETAQ |
| Ga0134128_120227503 | 3300010373 | Terrestrial Soil | EKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0126381_1008944822 | 3300010376 | Tropical Forest Soil | MEKGGFFAACERGKPPGVPGAANAAGYSGEGRKGQEIRASWR* |
| Ga0134126_101175355 | 3300010396 | Terrestrial Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSLPKGQENRADT* |
| Ga0137384_105258402 | 3300012357 | Vadose Zone Soil | MFESSFKPMEKAAFFAAYERGKPPGVPGAANGAGYSGGGRKGQEIHKRCR* |
| Ga0157336_10246792 | 3300012477 | Arabidopsis Rhizosphere | SAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0157339_10590151 | 3300012505 | Arabidopsis Rhizosphere | WTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0157342_10106132 | 3300012507 | Arabidopsis Rhizosphere | MEKGGFFAACARGKPPGVPGAANGAGYSGGIPKGQENRADT* |
| Ga0157338_10020563 | 3300012515 | Arabidopsis Rhizosphere | MEKSDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT* |
| Ga0157284_100099662 | 3300012893 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLNR* |
| Ga0157284_103369291 | 3300012893 | Soil | KSMEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADRSP* |
| Ga0157303_100598373 | 3300012896 | Soil | LNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0164301_100966234 | 3300012960 | Soil | MEKGGFFAAYARGKPPGVPGAADGAGYSGSIAKGQENRTDP* |
| Ga0126369_103436841 | 3300012971 | Tropical Forest Soil | AACERGKPPGVPGAANAAGYSGGGRKEQGTTPLSKTV* |
| Ga0126369_105673621 | 3300012971 | Tropical Forest Soil | KSMEKGGFFAACARGKPPGVPGAANGAVYTGEEGKGQEIRASR* |
| Ga0126369_118228081 | 3300012971 | Tropical Forest Soil | MEKAAFSAACERGKPPGVPGAANGAGYSGSFPKGQENR |
| Ga0164308_1000294511 | 3300012985 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSYDGRKGQEITDLGR* |
| Ga0164304_103298601 | 3300012986 | Soil | NPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0164307_100061639 | 3300012987 | Soil | SLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0164305_112899251 | 3300012989 | Soil | PMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0157371_103930711 | 3300013102 | Corn Rhizosphere | WTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0157369_108349232 | 3300013105 | Corn Rhizosphere | MEKGGFFAACARGKPPGVPGAANGAGYSGDGRKGQEIT |
| Ga0157369_110783651 | 3300013105 | Corn Rhizosphere | MEKAAFSAASERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ* |
| Ga0173483_107765392 | 3300015077 | Soil | MGKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITD |
| Ga0132257_1015632933 | 3300015373 | Arabidopsis Rhizosphere | DPSSKSMEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADQSL* |
| Ga0132255_1005364044 | 3300015374 | Arabidopsis Rhizosphere | SKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR* |
| Ga0187785_100397964 | 3300017947 | Tropical Peatland | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADP |
| Ga0187779_106794882 | 3300017959 | Tropical Peatland | MEKAAFSAARERGKPPGVPGAANAAGYSGGGCKGQETAALTAS |
| Ga0187777_102717672 | 3300017974 | Tropical Peatland | MEKAAIFAACERGKPPGVPGAANGAVYSGEVCKGQEIKDEAAVMAIQRS |
| Ga0173482_101197062 | 3300019361 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0173482_102890743 | 3300019361 | Soil | LNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0193719_101336503 | 3300021344 | Soil | MEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTGH |
| Ga0247785_10319621 | 3300022889 | Soil | SSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0247787_10051122 | 3300022893 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0247788_10520403 | 3300022901 | Soil | PSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0247791_10071193 | 3300023062 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEIT |
| Ga0247791_10246371 | 3300023062 | Soil | SWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0207710_100012063 | 3300025900 | Switchgrass Rhizosphere | MEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0207695_101998394 | 3300025913 | Corn Rhizosphere | SAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0207652_100208017 | 3300025921 | Corn Rhizosphere | SKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0207652_110787491 | 3300025921 | Corn Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDGPLMTS |
| Ga0207694_101743734 | 3300025924 | Corn Rhizosphere | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRAD |
| Ga0207659_118114612 | 3300025926 | Miscanthus Rhizosphere | KPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0207704_103755842 | 3300025938 | Miscanthus Rhizosphere | MEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0210089_10542371 | 3300025957 | Natural And Restored Wetlands | GKGGFSAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR |
| Ga0207678_101987661 | 3300026067 | Corn Rhizosphere | LNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0207674_108150833 | 3300026116 | Corn Rhizosphere | GGFFATCARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0207698_121078421 | 3300026142 | Corn Rhizosphere | SKPMEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0207604_1007131 | 3300026715 | Soil | VAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0207523_1005591 | 3300026731 | Soil | SLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0207590_1014702 | 3300026765 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITN |
| Ga0208761_10213321 | 3300026995 | Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGVFGRALGPLAGFFGLGF |
| Ga0208525_10116813 | 3300027288 | Soil | LSKPMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0209967_10018364 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITGLGR |
| Ga0208637_10008874 | 3300027401 | Soil | ISWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0207457_1018812 | 3300027474 | Soil | SKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ |
| Ga0209999_10427892 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKAQEITGLGR |
| Ga0209177_103507422 | 3300027775 | Agricultural Soil | SWTVAISKSSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0209074_101152361 | 3300027787 | Agricultural Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGVFGRA |
| Ga0307303_101824971 | 3300028713 | Soil | MEKAAFFAACVRGKPPGVPGAADGAGYSGGIPKGQENRA |
| Ga0307316_101793262 | 3300028755 | Soil | MEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTG |
| Ga0307292_102141321 | 3300028811 | Soil | MEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENR |
| Ga0307310_103189101 | 3300028824 | Soil | MEKAAFFAACVRGKPPGVPGAADGAGYSGGIPKGQENRAVRSQRVSSG |
| Ga0310915_1000005632 | 3300031573 | Soil | MEKGGFFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP |
| Ga0265313_100086431 | 3300031595 | Rhizosphere | MEKAAFSAASNRGKPPGVPGAADGRVYSGGVLKGQ |
| Ga0307469_108398911 | 3300031720 | Hardwood Forest Soil | KPMEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETTDLGR |
| Ga0318494_101192051 | 3300031751 | Soil | GGFFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP |
| Ga0307473_112151342 | 3300031820 | Hardwood Forest Soil | SKPMEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETRDLGR |
| Ga0318512_101844071 | 3300031846 | Soil | FFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP |
| Ga0310904_104261361 | 3300031854 | Soil | SSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0310893_100019897 | 3300031892 | Soil | MEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEI |
| Ga0310891_100185543 | 3300031913 | Soil | MEKSDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0310899_100722673 | 3300032017 | Soil | SWTVAILNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0307470_110173662 | 3300032174 | Hardwood Forest Soil | MEKAAFSAACERGKPPGVPGAANGAGYSDDGSKGQEITDLGR |
| Ga0307471_1007406931 | 3300032180 | Hardwood Forest Soil | MEKAALSAAHERGKPPGVLGAANAAGYTGGGGKGQETAIIAQKV |
| Ga0307472_1005591392 | 3300032205 | Hardwood Forest Soil | MEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGLF |
| Ga0307472_1007215492 | 3300032205 | Hardwood Forest Soil | MLKSSSKPMEKAALSAAHERGKPPGVPGAANAAGYSGGGRKGQETAIIAQKV |
| Ga0307472_1007311263 | 3300032205 | Hardwood Forest Soil | PMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT |
| Ga0310896_103182331 | 3300032211 | Soil | KPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR |
| Ga0326726_102136251 | 3300033433 | Peat Soil | AIVNPSSNPMEKAAFSAACERGKPPGVPGAATGAGYSGGRHKGQENHISGRKRA |
| Ga0316628_1026592872 | 3300033513 | Soil | MEKAAFSAACERGKPPGVPGAANAPGYSGGGRKGQEIRTDP |
| ⦗Top⦘ |