


| Basic Information | |
|---|---|
| Family ID | F064707 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAERP |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (48.438 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (17.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.469 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 4.65% Coil/Unstructured: 95.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00685 | Sulfotransfer_1 | 1.56 |
| PF13469 | Sulfotransfer_3 | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.06 % |
| Unclassified | root | N/A | 35.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109884099 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300005074|Ga0070431_1098268 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300006561|Ga0101389_1001843 | Not Available | 887 | Open in IMG/M |
| 3300006735|Ga0098038_1063948 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300006735|Ga0098038_1076364 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300006735|Ga0098038_1119854 | Not Available | 895 | Open in IMG/M |
| 3300006737|Ga0098037_1128984 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 860 | Open in IMG/M |
| 3300006737|Ga0098037_1129823 | Not Available | 857 | Open in IMG/M |
| 3300006737|Ga0098037_1205217 | Not Available | 644 | Open in IMG/M |
| 3300006749|Ga0098042_1054552 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300006867|Ga0075476_10230129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B11WGA-EpuloA1 | 666 | Open in IMG/M |
| 3300006868|Ga0075481_10094582 | Not Available | 1114 | Open in IMG/M |
| 3300006928|Ga0098041_1143027 | Not Available | 770 | Open in IMG/M |
| 3300007344|Ga0070745_1070628 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300007541|Ga0099848_1126355 | Not Available | 963 | Open in IMG/M |
| 3300007541|Ga0099848_1141777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 894 | Open in IMG/M |
| 3300007863|Ga0105744_1100358 | Not Available | 715 | Open in IMG/M |
| 3300009056|Ga0102860_1233485 | Not Available | 531 | Open in IMG/M |
| 3300009550|Ga0115013_10307163 | Not Available | 984 | Open in IMG/M |
| 3300010148|Ga0098043_1047891 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300010297|Ga0129345_1078144 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300010299|Ga0129342_1080546 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300010299|Ga0129342_1176137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 769 | Open in IMG/M |
| 3300010300|Ga0129351_1097358 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300012920|Ga0160423_10336668 | Not Available | 1036 | Open in IMG/M |
| 3300012928|Ga0163110_10182911 | All Organisms → Viruses → Predicted Viral | 1475 | Open in IMG/M |
| 3300012936|Ga0163109_10238350 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300012936|Ga0163109_10312961 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300012936|Ga0163109_10553604 | Not Available | 842 | Open in IMG/M |
| 3300012953|Ga0163179_11387311 | Not Available | 628 | Open in IMG/M |
| 3300012954|Ga0163111_10354441 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300012954|Ga0163111_10378392 | Not Available | 1279 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10214459 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10247258 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300017706|Ga0181377_1031445 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300017708|Ga0181369_1035936 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300017713|Ga0181391_1024203 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300017713|Ga0181391_1042734 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300017713|Ga0181391_1075707 | Not Available | 772 | Open in IMG/M |
| 3300017714|Ga0181412_1040236 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300017714|Ga0181412_1086844 | Not Available | 747 | Open in IMG/M |
| 3300017728|Ga0181419_1033263 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300017730|Ga0181417_1015681 | All Organisms → Viruses → Predicted Viral | 1918 | Open in IMG/M |
| 3300017741|Ga0181421_1182449 | Not Available | 539 | Open in IMG/M |
| 3300017748|Ga0181393_1046523 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300017749|Ga0181392_1068308 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300017749|Ga0181392_1208226 | Not Available | 560 | Open in IMG/M |
| 3300017752|Ga0181400_1040911 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300017755|Ga0181411_1052305 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300017755|Ga0181411_1148656 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 674 | Open in IMG/M |
| 3300017756|Ga0181382_1085312 | Not Available | 868 | Open in IMG/M |
| 3300017756|Ga0181382_1095515 | Not Available | 809 | Open in IMG/M |
| 3300017763|Ga0181410_1127818 | Not Available | 723 | Open in IMG/M |
| 3300017770|Ga0187217_1138291 | Not Available | 819 | Open in IMG/M |
| 3300017782|Ga0181380_1129109 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 867 | Open in IMG/M |
| 3300017788|Ga0169931_10278014 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300017952|Ga0181583_10309654 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300017956|Ga0181580_10258740 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300017956|Ga0181580_10287432 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300017967|Ga0181590_10291759 | Not Available | 1189 | Open in IMG/M |
| 3300017969|Ga0181585_10337845 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300018416|Ga0181553_10684293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 537 | Open in IMG/M |
| 3300018421|Ga0181592_10811374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 615 | Open in IMG/M |
| 3300018426|Ga0181566_10869929 | Not Available | 612 | Open in IMG/M |
| 3300018876|Ga0181564_10689326 | Not Available | 538 | Open in IMG/M |
| 3300020051|Ga0181555_1330978 | Not Available | 519 | Open in IMG/M |
| 3300020074|Ga0194113_10318567 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300020074|Ga0194113_10354559 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300020083|Ga0194111_10745873 | Not Available | 596 | Open in IMG/M |
| 3300020084|Ga0194110_10232521 | Not Available | 1359 | Open in IMG/M |
| 3300020109|Ga0194112_10926161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 558 | Open in IMG/M |
| 3300020190|Ga0194118_10198311 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300020190|Ga0194118_10200943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 1131 | Open in IMG/M |
| 3300020198|Ga0194120_10164617 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300020200|Ga0194121_10147311 | Not Available | 1371 | Open in IMG/M |
| 3300020200|Ga0194121_10170932 | Not Available | 1220 | Open in IMG/M |
| 3300020214|Ga0194132_10216196 | Not Available | 1071 | Open in IMG/M |
| 3300020221|Ga0194127_10235243 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300020221|Ga0194127_10278227 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300020222|Ga0194125_10246895 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300020258|Ga0211529_1019396 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300020258|Ga0211529_1029003 | Not Available | 945 | Open in IMG/M |
| 3300020325|Ga0211507_1033141 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300020325|Ga0211507_1060387 | Not Available | 749 | Open in IMG/M |
| 3300020385|Ga0211677_10059029 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300020414|Ga0211523_10133765 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300020414|Ga0211523_10345842 | Not Available | 606 | Open in IMG/M |
| 3300020421|Ga0211653_10116279 | Not Available | 1186 | Open in IMG/M |
| 3300020442|Ga0211559_10148961 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300020519|Ga0208223_1023442 | Not Available | 834 | Open in IMG/M |
| 3300020578|Ga0194129_10191073 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300021092|Ga0194122_10151117 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 1247 | Open in IMG/M |
| 3300021356|Ga0213858_10120974 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300021356|Ga0213858_10135177 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300021356|Ga0213858_10178861 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300021356|Ga0213858_10185920 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300021368|Ga0213860_10290482 | Not Available | 715 | Open in IMG/M |
| 3300021376|Ga0194130_10193032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 1210 | Open in IMG/M |
| 3300021960|Ga0222715_10174514 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300021960|Ga0222715_10266359 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300021962|Ga0222713_10267570 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300021962|Ga0222713_10387484 | All Organisms → Viruses → environmental samples → uncultured virus | 864 | Open in IMG/M |
| 3300021962|Ga0222713_10802122 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 525 | Open in IMG/M |
| 3300023180|Ga0255768_10416508 | Not Available | 707 | Open in IMG/M |
| 3300025101|Ga0208159_1029343 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300025120|Ga0209535_1076678 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300025127|Ga0209348_1030913 | All Organisms → Viruses → Predicted Viral | 1922 | Open in IMG/M |
| 3300025151|Ga0209645_1062710 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300025151|Ga0209645_1063428 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300025151|Ga0209645_1076432 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300025168|Ga0209337_1317978 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025483|Ga0209557_1043688 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300025671|Ga0208898_1067751 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300025671|Ga0208898_1084378 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300025889|Ga0208644_1222605 | Not Available | 801 | Open in IMG/M |
| 3300027121|Ga0255074_1018520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Athens0714_16 | 892 | Open in IMG/M |
| 3300027810|Ga0209302_10162915 | Not Available | 1085 | Open in IMG/M |
| 3300027859|Ga0209503_10117895 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300027906|Ga0209404_10810208 | Not Available | 636 | Open in IMG/M |
| 3300028196|Ga0257114_1103661 | Not Available | 1154 | Open in IMG/M |
| 3300028196|Ga0257114_1165399 | Not Available | 841 | Open in IMG/M |
| 3300028197|Ga0257110_1174955 | All Organisms → Viruses → environmental samples → uncultured virus | 847 | Open in IMG/M |
| 3300029318|Ga0185543_1034765 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300029319|Ga0183748_1128472 | Not Available | 535 | Open in IMG/M |
| 3300031519|Ga0307488_10288476 | Not Available | 1063 | Open in IMG/M |
| 3300031565|Ga0307379_10447278 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300031565|Ga0307379_10537237 | Not Available | 1085 | Open in IMG/M |
| 3300034374|Ga0348335_067119 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.19% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.28% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.03% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 5.47% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.34% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.78% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.78% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.78% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300006561 | Marine microbial communities from the Black Sea in Odessa region - Od_1 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1098840993 | 3300002408 | Freshwater | MSEFKSSSFRNEDNSGAPDIVGVSTFTSPYYFVPPSGTTAERPSGDGLAP |
| Ga0070431_10982681 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MSEFKASGFRDEFGSGGPDLVGITTMTSPYYFVPPSGSTAER |
| Ga0101389_10018432 | 3300006561 | Marine | MSEFKSPNFTNEDNSGGPDLVGVTTFTSPYYFVPPSG |
| Ga0098038_10639481 | 3300006735 | Marine | MSEFKTAGFSDEFGGGPDLVGITAMTSPYYFVPPSGSTAE |
| Ga0098038_10763642 | 3300006735 | Marine | MSEFKAAGFSDEFGGGPDIVGITTFTSPYYFVPPSG |
| Ga0098038_11198542 | 3300006735 | Marine | MSEFKSAGFSDEFGGGPDIVGLTTFTSPYYFVPPS |
| Ga0098037_11289841 | 3300006737 | Marine | MSEFKAAGFSDEFGGGPDIVGITTMTSSYYFVPPSGSTAERPQSAPPGMLRF |
| Ga0098037_11298231 | 3300006737 | Marine | MSEFKAAGFSDEFNGGPDLVGITTFTSPYYFVPPSGSTAERPQSAPPG |
| Ga0098037_12052172 | 3300006737 | Marine | MSEFKAAGFSDEFGGGPDIVGITTFTSPYYFVPPSGSTAERP |
| Ga0098042_10545522 | 3300006749 | Marine | MSEFKAAGFSDEFGSGPDLVGITTMTSSYYFVPPSGSTAERPQS |
| Ga0075476_102301291 | 3300006867 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAER |
| Ga0075481_100945822 | 3300006868 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTA |
| Ga0098041_11430271 | 3300006928 | Marine | MSEFKSAGFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAERPQSAPPGMLR |
| Ga0070745_10706281 | 3300007344 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGMLRFNT |
| Ga0099848_11263552 | 3300007541 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLA |
| Ga0099848_11417771 | 3300007541 | Aqueous | MSEFKSSSFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGL |
| Ga0105744_11003581 | 3300007863 | Estuary Water | MSEFKASSFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAERPSSP |
| Ga0102860_12334852 | 3300009056 | Estuarine | MSEFKSSSFRNEDNSGAPDIVGVTSFTSPFYFVPPSGTTAQRP |
| Ga0115013_103071632 | 3300009550 | Marine | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSG |
| Ga0098043_10478911 | 3300010148 | Marine | MSEFKAAGFSDEFGSGPDLVGITTMTSSYYFVPPSGSTAERPQSAPPG |
| Ga0129345_10781441 | 3300010297 | Freshwater To Marine Saline Gradient | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAE |
| Ga0129342_10805462 | 3300010299 | Freshwater To Marine Saline Gradient | MSEFKSSNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGL |
| Ga0129342_11761371 | 3300010299 | Freshwater To Marine Saline Gradient | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGL |
| Ga0129351_10973582 | 3300010300 | Freshwater To Marine Saline Gradient | MSEFKSSNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGD |
| Ga0160423_103366682 | 3300012920 | Surface Seawater | MSEFKASGFRDEFGNAGPDLVGITTFTSPYYFVPP |
| Ga0163110_101829113 | 3300012928 | Surface Seawater | MSEFKSAGFSDEFSGGPDLVGITTFTSPYYFVPPSGSTAE |
| Ga0163109_102383501 | 3300012936 | Surface Seawater | MSEFKVSGFRNEFGNAGPDLVGITTFTSPYYFVPPSGSTAERPSNPPPGML |
| Ga0163109_103129612 | 3300012936 | Surface Seawater | MSEFKVSGFRDEFGNAGPDLVGITTFTSPYYFVPPSGSTAERPSNPPPGML |
| Ga0163109_105536042 | 3300012936 | Surface Seawater | MSEFKAAGFSDEFNGGPDLVGITTFTSPYYFVPPSGSTAERPQS |
| Ga0163179_113873112 | 3300012953 | Seawater | MSEFKASGFRDEFGSGPDIVGLTTFTSPYYFVPPSGSTAERPSSPPP |
| Ga0163111_103544412 | 3300012954 | Surface Seawater | MSEFKVSGFRDEFGNAGPDLVGVTTMTSPYYFVPPSGSTAER |
| Ga0163111_103783921 | 3300012954 | Surface Seawater | MSEFKSAGFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAERPQSAP |
| (restricted) Ga0172373_102144592 | 3300013131 | Freshwater | MSNTKFSNFKSEDGSTGPDLVGITSFTSPYYFVPPSGTTAQRPSNAVP |
| (restricted) Ga0172373_102472582 | 3300013131 | Freshwater | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTAQRPSNAVP |
| Ga0181377_10314452 | 3300017706 | Marine | MSEFKASGFGDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAE |
| Ga0181369_10359361 | 3300017708 | Marine | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAERPSSPPPGML |
| Ga0181391_10242033 | 3300017713 | Seawater | MSEFKASSFSDEFGGGPDLVGITTMTSPYYFVPPSGSTAERPSSPPPG |
| Ga0181391_10427341 | 3300017713 | Seawater | MSEFKASGFSDEFGGGPDLVGITTFTSPYYFVPPSGST |
| Ga0181391_10757071 | 3300017713 | Seawater | MSEFKASGFSDEFGGGPDLVGITTMTSPYYFVPPSGSTAERPSSPPPG |
| Ga0181412_10402362 | 3300017714 | Seawater | MSEFKASGFSDEFGSSGPDIVGITTFTSPYYFVPPSGSTAERPSSPPPG |
| Ga0181412_10868441 | 3300017714 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQRPSSP |
| Ga0181419_10332633 | 3300017728 | Seawater | MSEFKASGFSDEFGGGPDLVGITTMTSPYYFVPPSGSTAERPQSPPP |
| Ga0181417_10156813 | 3300017730 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAERP |
| Ga0181421_11824491 | 3300017741 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPS |
| Ga0181393_10465232 | 3300017748 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQ |
| Ga0181392_10683081 | 3300017749 | Seawater | MSEFKASSFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAQRPSSPSPGMLRFI |
| Ga0181392_12082262 | 3300017749 | Seawater | MSEFKASGFRDEFGGGPDLVGITTFTSPYYFVPPSGSTAERPSS |
| Ga0181400_10409111 | 3300017752 | Seawater | MSEFKASGFSDEFGGGPDLVGITTMTSPYYFVPPSGSTAERPS |
| Ga0181411_10523051 | 3300017755 | Seawater | MSEFKASSFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQRPSSPPP |
| Ga0181411_11486561 | 3300017755 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQRPSSPPP |
| Ga0181382_10853122 | 3300017756 | Seawater | MSEFKASGFSDEFGGGPDLVGITTFTSPYYFVPPSGSTAQRPGSPPPG |
| Ga0181382_10955151 | 3300017756 | Seawater | MSEFKASGFRDEFGSGPDIVGLTTFTSPYYFVPPSGSTAER |
| Ga0181410_11278182 | 3300017763 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGS |
| Ga0187217_11382912 | 3300017770 | Seawater | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAE |
| Ga0181380_11291092 | 3300017782 | Seawater | MSEFKAAGFSDEFGGGPDIVGLTTFTSPYYFVPPSGS |
| Ga0169931_102780142 | 3300017788 | Freshwater | MSNTKFSNYKSEDGSTGPDLVGITSFTSPYYFVPPSGTTAQRPSNAVP |
| Ga0181583_103096542 | 3300017952 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSG |
| Ga0181580_102587401 | 3300017956 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGT |
| Ga0181580_102874321 | 3300017956 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERP |
| Ga0181590_102917591 | 3300017967 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGMLR |
| Ga0181585_103378452 | 3300017969 | Salt Marsh | MPEFKSPNYRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLA |
| Ga0181553_106842932 | 3300018416 | Salt Marsh | MSEFKTSGFRDEFGSGGPDLVGLTTMTSPYYFVPPSGST |
| Ga0181592_108113742 | 3300018421 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPP |
| Ga0181566_108699292 | 3300018426 | Salt Marsh | MSEFKAAGFSDEFGSGGPDLVGITTMTSPYYFVPPSGSTA |
| Ga0181564_106893262 | 3300018876 | Salt Marsh | MSEFNASGFRDEFGSGGPDLVGITTMTSPYYFVPPSGSTAE |
| Ga0181555_13309781 | 3300020051 | Salt Marsh | MSEFKASGFRDEFGSGGPDLVGLTTMTSPYYFVPPSGSTAERP |
| Ga0194113_103185672 | 3300020074 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTAQRPSGEGLTPG |
| Ga0194113_103545592 | 3300020074 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPS |
| Ga0194111_107458731 | 3300020083 | Freshwater Lake | MSEFKAGNFRNQQGSNGPDLVGVTTFTSPYYFVPPSGTTADRPSNPVPGMLR |
| Ga0194110_102325211 | 3300020084 | Freshwater Lake | MSNTKFSNFKSEDGSTGPDLVGITTFTSPYYFVPPSGTTAQRPSGEGLTP |
| Ga0194112_109261611 | 3300020109 | Freshwater Lake | MSEIKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTAQRPSGE |
| Ga0194118_101983111 | 3300020190 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTA |
| Ga0194118_102009432 | 3300020190 | Freshwater Lake | MSEFKAGNFRNQQGSNGPDLVGVTTFTSPYYFVPPSGTTADRPPNPV |
| Ga0194120_101646171 | 3300020198 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTAQRPSGEG |
| Ga0194121_101473112 | 3300020200 | Freshwater Lake | MSEFKAGNFRNQQGSNGPDLVGVTTFTSPYYFVPPSGTTAD |
| Ga0194121_101709321 | 3300020200 | Freshwater Lake | MSEFKAGNFRNQQGSNGPDLVGVTTFTSPYYFVPPSG |
| Ga0194132_102161961 | 3300020214 | Freshwater Lake | MSEIKFSNFKSEDGSTGPDLVGITTFTSPYYFVPPSG |
| Ga0194127_102352431 | 3300020221 | Freshwater Lake | MSNTKFSNFKSEDGSTGPDLVGITTFTSPYYFVPPSGTTAQRPSGEG |
| Ga0194127_102782272 | 3300020221 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITTFTSPYYFVPPSGTTAQRPSGEGL |
| Ga0194125_102468951 | 3300020222 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPP |
| Ga0211529_10193962 | 3300020258 | Marine | MSEFKASGFRDEFGNAGPDLVGITTMTSPYYFVPPSGSTAERPQSPPPGM |
| Ga0211529_10290032 | 3300020258 | Marine | MSEFKASGFRDEFGNGGPDLVGITTMTSPYYFVPPSGSTAERP |
| Ga0211507_10331412 | 3300020325 | Marine | MSEFKASGFRDEFGSGGPDLVGITTMTSPYYFVPPSGSTAERPSSPPPGMLRF |
| Ga0211507_10603872 | 3300020325 | Marine | MSEFKASGFSDEFGSGGPDLVGITTMTSPYYFVPPSGSTAERP |
| Ga0211677_100590293 | 3300020385 | Marine | MSEFKASGFGDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAERPSSP |
| Ga0211523_101337651 | 3300020414 | Marine | MSEFKASGFRDEFGNAGPDLVGITTMTSPYYFVPPSGSTAERP |
| Ga0211523_103458421 | 3300020414 | Marine | MSEFKASNFRDEFGNAGPDLVGITTMTSPYYFVPPSG |
| Ga0211653_101162791 | 3300020421 | Marine | MSEFKASGFRDEFGNAGPDIVGLTTFTSPYYFVPPSGSTAERPSSPPPG |
| Ga0211559_101489611 | 3300020442 | Marine | MSEFKASGFSDEFGNGGPDLVGITTMTSPYYFVPPSGSTAERP |
| Ga0208223_10234422 | 3300020519 | Freshwater | MSEFKSSSFRNEDNSGAPDIVGVSTFTSPYYFVPPSGTT |
| Ga0194129_101910731 | 3300020578 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITTFTSPYYFVPPSGTTAQRPSGEGLTPGMLRFNT |
| Ga0194122_101511172 | 3300021092 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGVTSFTSPYYFVPPSGTTAQRPSGEGLTPGML |
| Ga0213858_101209741 | 3300021356 | Seawater | MSEFKASGFRDEFGSGGPDLVGITTMTSPYYFVPPSGS |
| Ga0213858_101351772 | 3300021356 | Seawater | MSEFKASGFRDEFGSSGPDLVGITTMTSPYYFVPPSGSTAERPSSPPPG |
| Ga0213858_101788611 | 3300021356 | Seawater | MSEFKASGFRDEFGSGGPDLVGITTMTSPYYFVPP |
| Ga0213858_101859202 | 3300021356 | Seawater | MSEFKASGFRDEFGSAGPDLVGITTLTSPYYFVPPSGTTNERPQSPPPGM |
| Ga0213860_102904821 | 3300021368 | Seawater | MSEFKAAGFSDEFGSAGPDLVGITTMTSPYYFVPPSG |
| Ga0194130_101930322 | 3300021376 | Freshwater Lake | MSNTKFSNFKSEDGNTGPDLVGITSFTSPYYFVPPSGTTAQRPSGEGLTPGM |
| Ga0222715_101745141 | 3300021960 | Estuarine Water | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPS |
| Ga0222715_102663591 | 3300021960 | Estuarine Water | MSEFKSSNFRNEDGSGGPDIVGLTTFTSPYYFVPPSGTTAE |
| Ga0222713_102675701 | 3300021962 | Estuarine Water | MSEVKFSNFINEDGSNGPDLVGVTTFTSPYYFVPPSGTTA |
| Ga0222713_103874842 | 3300021962 | Estuarine Water | MSEFKSSNFRNEDGSGGPDIVGLTTFTSPYYFVPPSGTTA |
| Ga0222713_108021221 | 3300021962 | Estuarine Water | MSEIKFSNFINEDGSNGPDLVGVTTFTSPYYFVPPSGT |
| Ga0255768_104165082 | 3300023180 | Salt Marsh | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAP |
| Ga0208159_10293432 | 3300025101 | Marine | MSEFKAAGFSDEFGSGPDLVGITTMTSSYYFVPPSGSTAERPQSA |
| Ga0209535_10766782 | 3300025120 | Marine | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTA |
| Ga0209348_10309131 | 3300025127 | Marine | MSEFKASSFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAERPSSPPPGMLRF |
| Ga0209645_10627102 | 3300025151 | Marine | MSEFKASGFRDEFGNAGPDLVGITTLTSPYYFVPPSGS |
| Ga0209645_10634281 | 3300025151 | Marine | MSEFKSSGFRDEFGNAGPDLVGITTLTSPYYFVPPSGS |
| Ga0209645_10764321 | 3300025151 | Marine | MSEFKAAGFSDEFGSGGPDLVGITTMTSPHYFVPPSGSTAERPSSPPP |
| Ga0209337_13179782 | 3300025168 | Marine | MSEFKASGFGDEFGSSGPNIVGLTTFTSPYYFVPPSGSTA |
| Ga0209557_10436882 | 3300025483 | Marine | MSEFKASSFSDEFGGGPDIVGLTTFTSPYYFVPPSGSTAQRPSSPPPG |
| Ga0208898_10677511 | 3300025671 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGMLRFN |
| Ga0208898_10843782 | 3300025671 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGML |
| Ga0208644_12226051 | 3300025889 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGMLRF |
| Ga0255074_10185202 | 3300027121 | Freshwater | MSEFKSSSFRNEDNSGAPDIVGVTSFTSPFYFVPPSGTTAQRPSGDG |
| Ga0209302_101629152 | 3300027810 | Marine | MSEFKANSFCNENNDSAPDLVGITTFTSPYYFVPPSG |
| Ga0209503_101178952 | 3300027859 | Marine | MSEFKSAGFSDEFGGGPDLVGITTMTSPYYFVPPSGSTAERPQN |
| Ga0209404_108102082 | 3300027906 | Marine | MSEFKASGFSDEFGNAGPDLVGITTMTSPYYFVPPSGTTAQRPSSPPP |
| Ga0257114_11036611 | 3300028196 | Marine | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQRPSS |
| Ga0257114_11653991 | 3300028196 | Marine | MSELKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQRPSS |
| Ga0257110_11749552 | 3300028197 | Marine | MSEFKASGFSDEFGSSGPDIVGLTTFTSPYYFVPPSGSTAQR |
| Ga0185543_10347651 | 3300029318 | Marine | MSEFKASGFRDEFGSGGPDLVGITTMTSPYYFVPPSGSTAERP |
| Ga0183748_11284722 | 3300029319 | Marine | MSEFKSSGFRDEFGNAGPDLVGITTLTSPYYFVPPSGTTAERP |
| Ga0307488_102884761 | 3300031519 | Sackhole Brine | MSEFKASGFSDEFGSSGPNIVGLTTFTSPYYFVPPSGSTAERP |
| Ga0307379_104472781 | 3300031565 | Soil | MSETKFSNFTNEDGSTGPDLVGITSFTSPYYFVPPSGTTA |
| Ga0307379_105372372 | 3300031565 | Soil | MSNTKFSNYKSEDGSTGPDLVGITSFTSPYYFVPPSGTTAQRPSNAIPGQL |
| Ga0348335_067119_1123_1278 | 3300034374 | Aqueous | MSEFKSPNFRNEDGSAAPDIVGVTTFTSPYYFVPPSGTTAERPSGDGLAPGM |
| ⦗Top⦘ |