


| Basic Information | |
|---|---|
| Family ID | F064599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RLKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPTGK |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.60 % |
| % of genes near scaffold ends (potentially truncated) | 67.97 % |
| % of genes from short scaffolds (< 2000 bps) | 82.81 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.969 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.656 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00221 | Lyase_aromatic | 32.81 |
| PF03734 | YkuD | 12.50 |
| PF14534 | DUF4440 | 7.03 |
| PF02774 | Semialdhyde_dhC | 3.91 |
| PF01175 | Urocanase | 2.34 |
| PF03572 | Peptidase_S41 | 0.78 |
| PF04234 | CopC | 0.78 |
| PF07715 | Plug | 0.78 |
| PF02464 | CinA | 0.78 |
| PF11104 | PilM_2 | 0.78 |
| PF00211 | Guanylate_cyc | 0.78 |
| PF13407 | Peripla_BP_4 | 0.78 |
| PF07837 | FTCD_N | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 32.81 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 12.50 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 12.50 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 3.91 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 3.91 |
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 2.34 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.78 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.78 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.78 |
| COG3643 | Glutamate formiminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.97 % |
| Unclassified | root | N/A | 7.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|F0B48LX02JZEWC | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 2170459013|GO6OHWN02JD2SV | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10824650 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100790049 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100790973 | Not Available | 797 | Open in IMG/M |
| 3300000955|JGI1027J12803_101243898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1638 | Open in IMG/M |
| 3300000955|JGI1027J12803_101925447 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300002909|JGI25388J43891_1027328 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300004016|Ga0058689_10064823 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 707 | Open in IMG/M |
| 3300004114|Ga0062593_102987266 | Not Available | 541 | Open in IMG/M |
| 3300005186|Ga0066676_10667664 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005332|Ga0066388_100392101 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300005355|Ga0070671_100765490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 839 | Open in IMG/M |
| 3300005445|Ga0070708_101731862 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005447|Ga0066689_10057477 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300005468|Ga0070707_100045952 | All Organisms → cellular organisms → Bacteria | 4178 | Open in IMG/M |
| 3300005536|Ga0070697_101965046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300005554|Ga0066661_10136708 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300005554|Ga0066661_10903338 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005559|Ga0066700_10067580 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300005566|Ga0066693_10146997 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005568|Ga0066703_10156018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1372 | Open in IMG/M |
| 3300005576|Ga0066708_10210755 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005586|Ga0066691_10476789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 746 | Open in IMG/M |
| 3300005587|Ga0066654_10137855 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005598|Ga0066706_10331283 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005764|Ga0066903_100435877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2180 | Open in IMG/M |
| 3300005764|Ga0066903_102076013 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005764|Ga0066903_103178880 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 888 | Open in IMG/M |
| 3300005985|Ga0081539_10011078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7205 | Open in IMG/M |
| 3300006032|Ga0066696_11115200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300006047|Ga0075024_100046267 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300006791|Ga0066653_10025117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2283 | Open in IMG/M |
| 3300006796|Ga0066665_11679157 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006797|Ga0066659_10007143 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 5748 | Open in IMG/M |
| 3300009088|Ga0099830_10279551 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300009137|Ga0066709_100543012 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1645 | Open in IMG/M |
| 3300009137|Ga0066709_103213585 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009665|Ga0116135_1119844 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300010048|Ga0126373_12058733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
| 3300010301|Ga0134070_10339937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300010358|Ga0126370_12437226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300010359|Ga0126376_12098453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300010359|Ga0126376_13095323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| 3300010360|Ga0126372_10604806 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010361|Ga0126378_11611445 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010376|Ga0126381_101023586 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300010376|Ga0126381_101268922 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300010397|Ga0134124_13107657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300010398|Ga0126383_10284566 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300010866|Ga0126344_1144219 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012096|Ga0137389_10002844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 10600 | Open in IMG/M |
| 3300012200|Ga0137382_10364596 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012212|Ga0150985_112555451 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012351|Ga0137386_11268726 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012354|Ga0137366_10632773 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012356|Ga0137371_10135567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1928 | Open in IMG/M |
| 3300012356|Ga0137371_11081826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300012357|Ga0137384_10012472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6898 | Open in IMG/M |
| 3300012359|Ga0137385_10069569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 3133 | Open in IMG/M |
| 3300012360|Ga0137375_11216608 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012469|Ga0150984_101399086 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012509|Ga0157334_1073338 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012885|Ga0157287_1122227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300012922|Ga0137394_10593063 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012927|Ga0137416_10205009 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300012957|Ga0164303_10408947 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300012977|Ga0134087_10023826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2263 | Open in IMG/M |
| 3300014968|Ga0157379_11202693 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017659|Ga0134083_10188339 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300018027|Ga0184605_10449634 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018032|Ga0187788_10313091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 639 | Open in IMG/M |
| 3300018060|Ga0187765_10487695 | Not Available | 777 | Open in IMG/M |
| 3300018431|Ga0066655_10003298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6288 | Open in IMG/M |
| 3300018431|Ga0066655_11386419 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018482|Ga0066669_10339307 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300019789|Ga0137408_1192720 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300019877|Ga0193722_1022031 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300020015|Ga0193734_1002385 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3329 | Open in IMG/M |
| 3300021168|Ga0210406_11073096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 595 | Open in IMG/M |
| 3300021418|Ga0193695_1107276 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300021445|Ga0182009_10076389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1482 | Open in IMG/M |
| 3300021475|Ga0210392_10338331 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300022504|Ga0242642_1026294 | Not Available | 820 | Open in IMG/M |
| 3300022525|Ga0242656_1045321 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. SCGC AG-212-E16 | 749 | Open in IMG/M |
| 3300022694|Ga0222623_10335437 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300022713|Ga0242677_1017497 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300022714|Ga0242671_1037999 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300022722|Ga0242657_1185131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
| 3300022756|Ga0222622_11030166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| 3300024254|Ga0247661_1013688 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300025922|Ga0207646_10693215 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300025939|Ga0207665_10403769 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1041 | Open in IMG/M |
| 3300025972|Ga0207668_10672588 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300026023|Ga0207677_10528183 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300026121|Ga0207683_10932703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 806 | Open in IMG/M |
| 3300026306|Ga0209468_1185808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300026315|Ga0209686_1202456 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300026316|Ga0209155_1297360 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026324|Ga0209470_1024192 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
| 3300026327|Ga0209266_1224514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300026331|Ga0209267_1157682 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300026343|Ga0209159_1036744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2544 | Open in IMG/M |
| 3300026497|Ga0257164_1021224 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026524|Ga0209690_1022750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3136 | Open in IMG/M |
| 3300026529|Ga0209806_1344324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300026536|Ga0209058_1282487 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026538|Ga0209056_10481276 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026551|Ga0209648_10124327 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300027846|Ga0209180_10800332 | Not Available | 505 | Open in IMG/M |
| 3300027903|Ga0209488_10812291 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028536|Ga0137415_10246183 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300028536|Ga0137415_11137526 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300028673|Ga0257175_1009627 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300030967|Ga0075399_11315324 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031057|Ga0170834_110774790 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. SCGC AG-212-E16 | 656 | Open in IMG/M |
| 3300031231|Ga0170824_109817815 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031446|Ga0170820_17159066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 789 | Open in IMG/M |
| 3300031912|Ga0306921_12410277 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 549 | Open in IMG/M |
| 3300031942|Ga0310916_10257004 | Not Available | 1473 | Open in IMG/M |
| 3300032180|Ga0307471_100427279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1459 | Open in IMG/M |
| 3300032205|Ga0307472_100319533 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300032211|Ga0310896_10853781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300033412|Ga0310810_10843181 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300033551|Ga0247830_11609279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027457 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-D (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_00299650 | 2170459002 | Grass Soil | LKFLKMIVVMAVLVTALGVGACAQHKEVVVPPAPKGGK |
| N57_08317790 | 2170459013 | Grass Soil | RDRLKFLKMIVVVAVLVTALGLGACAQHKEVVVPPAPKSGK |
| ICChiseqgaiiFebDRAFT_108246502 | 3300000363 | Soil | MKFLKAIMIVAVIVTALGLGACAQHKEAVVTAPAPMGK* |
| INPhiseqgaiiFebDRAFT_1007900491 | 3300000364 | Soil | RLKFLKMIMIVALLTTALGLGACAQHKEVVTPAPAPMGK* |
| INPhiseqgaiiFebDRAFT_1007909733 | 3300000364 | Soil | LKFVKMIMIVXVLVTALGLGACAQKKEEVVTPAPKSXK* |
| JGI1027J12803_1012438981 | 3300000955 | Soil | LKLLKTIMVVAVLVTALGLGACAQQHKEVVTPPPAPTGK* |
| JGI1027J12803_1019254471 | 3300000955 | Soil | RRDGLKFLKMIMIVAVAVTVLGLGACAQHKEVAPAPAGKTSAK* |
| JGI25388J43891_10273282 | 3300002909 | Grasslands Soil | MKFLKAIMIVAXLVSALGLGACAQHKEAVVTAPAPKGGK* |
| Ga0058689_100648232 | 3300004016 | Agave | LKFLKMIMVVAVLATALELGACAQQHKEAVAPAAPTTAK* |
| Ga0062593_1029872662 | 3300004114 | Soil | LKILKAIMIVAVAASALSLGACAQHKEVVAPAPAHTYSK* |
| Ga0062592_1021363681 | 3300004480 | Soil | LKILKAIVIVAVAASALSLGACAQHKEVVAPAPAHTYSK* |
| Ga0066676_106676641 | 3300005186 | Soil | MKFVKMMMIVAILVSALGLGACAQHKEAVVTAPAPKGGK* |
| Ga0066388_1003921013 | 3300005332 | Tropical Forest Soil | LKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPKGGK* |
| Ga0070671_1007654903 | 3300005355 | Switchgrass Rhizosphere | RLKFLKMIMMVAVLATALGLGACASPTQQHAETVAPAPKGGK* |
| Ga0070708_1017318621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRDGLKFLKMIMIVAVLATALGLGACAQHKEVAPAPAGKTSAK* |
| Ga0066689_100574772 | 3300005447 | Soil | MKFLKAIMIVAILVSALGLGACAQHKEAVVTAPAPKGGK* |
| Ga0070707_1000459522 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLKMIMIVAVLVTALELGACAQHKEAVVTAPAPKGGK* |
| Ga0070697_1019650462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RDRVKFMKTIMIVALLVTALGLGACAQHKEVVAPPPTTYGK* |
| Ga0066661_101367084 | 3300005554 | Soil | MIMIVAVLATALGLGACAQHKEVAPAPAGKTSAK* |
| Ga0066661_109033381 | 3300005554 | Soil | LKTIMIVAVMVTALGLGACAQHKEVVTPPMGKTGK* |
| Ga0066700_100675804 | 3300005559 | Soil | MRFFKMIMIVAVLVTALGLGACAQHKEVVTPVPSKTGK* |
| Ga0066693_101469971 | 3300005566 | Soil | DRLKFLKMIVVVAVLVTALGLGACAQHKEVVVPPTPKGGK* |
| Ga0066703_101560181 | 3300005568 | Soil | KMIMIVAVLVTALGLGACAQHKEVVTPAPAPMGK* |
| Ga0066708_102107551 | 3300005576 | Soil | ERRRDRVKFVKMIMIVALLVTALGLGACAQHKEVVAPAPTTYGK* |
| Ga0066691_104767893 | 3300005586 | Soil | MKFLKAIMIVAMLVSALGLGACAQHKEAVVTAPAPKGGK* |
| Ga0066654_101378552 | 3300005587 | Soil | LKFLKMIMVMAVAVTALGLGACAQHKEVAAPPMGKTSAK* |
| Ga0066706_103312832 | 3300005598 | Soil | MIVVVAVLVTALGLGACAQHKEVVAPAPAPKGGK* |
| Ga0066903_1004358772 | 3300005764 | Tropical Forest Soil | MKFLKRIMIVAVLVTALGLGACAQQHKEVVTPPPAPAGK* |
| Ga0066903_1020760132 | 3300005764 | Tropical Forest Soil | LKFVKMIMIVAVAVTALGLGACAQHKEVAPAPAGKTSAK* |
| Ga0066903_1031788802 | 3300005764 | Tropical Forest Soil | LKFLKMIMIVAVLVTALGLGACAQHKEVAAPAPAPKGGK* |
| Ga0081539_100110783 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LKLLKMIMVMTVLVTALGLGACAQHKEVVTPPMGKSAAK* |
| Ga0066696_111152002 | 3300006032 | Soil | DERRRDRLKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPMGK* |
| Ga0075024_1000462671 | 3300006047 | Watersheds | LKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPAGK* |
| Ga0066653_100251174 | 3300006791 | Soil | LKFLKMIMIVAVLVTALELGACAQHKEVVAPAPAP |
| Ga0066665_116791572 | 3300006796 | Soil | LKFLKMIVVVAVLVTALGLGACAQHKEVVAPAPAP |
| Ga0066659_100071435 | 3300006797 | Soil | MRFFKMIMIVAVLVTALGLGACAQRKEVVTPAPAYSGK* |
| Ga0099830_102795511 | 3300009088 | Vadose Zone Soil | MKFLKMIMIVAVLVTTLELGACAQHKEAVVTAPAPKGGK* |
| Ga0066709_1005430121 | 3300009137 | Grasslands Soil | KMIMIMAVLVTALELGACAQHKEVVAPAPAPTGK* |
| Ga0066709_1032135852 | 3300009137 | Grasslands Soil | KFVKMIMIVALLVTALGLGACAQHKEVVAPAPTTYGK* |
| Ga0116135_11198442 | 3300009665 | Peatland | DRLKFLKKIMIMAILLTALGLGACAQHKEVVTPPPPAPAGK* |
| Ga0126373_120587332 | 3300010048 | Tropical Forest Soil | RDGLKFLKMIMVVALLVTALGLGACAQHKEEVAPAPAPKGGK* |
| Ga0134070_103399372 | 3300010301 | Grasslands Soil | MIMIVAVLVTALGLGACAQHKEVVTPAPAPKGGK* |
| Ga0126370_124372261 | 3300010358 | Tropical Forest Soil | KFLKMIMIVAVLATALGLGACAQHKETVASPPASTAK* |
| Ga0126376_120984531 | 3300010359 | Tropical Forest Soil | RLKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPTGK* |
| Ga0126376_130953231 | 3300010359 | Tropical Forest Soil | RTIMIVAVLVTALGLGACAQRKEVVTPAPAPAGK* |
| Ga0126372_106048061 | 3300010360 | Tropical Forest Soil | RRRDGLKFLKMIMIVAVLVTALGLGACAQHKEVAPPPAGKTSAK* |
| Ga0126378_116114452 | 3300010361 | Tropical Forest Soil | LKMIVVMAVLVTASGLGACAQHKEVVVPPTPKGGK* |
| Ga0126381_1010235861 | 3300010376 | Tropical Forest Soil | MIMIVAVLVTALGLGACAQHKQVVTPAPAPKGGK* |
| Ga0126381_1012689221 | 3300010376 | Tropical Forest Soil | RRDRLKILKKIMIMAVVLTALGLGACSQHKEVVTPAPAPTGK* |
| Ga0134124_131076571 | 3300010397 | Terrestrial Soil | NERRRDRLKFMKKIMIMAILLSALGLGACTQHKEVVAPPPPAPTGK* |
| Ga0126383_102845662 | 3300010398 | Tropical Forest Soil | GLKFLKMIMIVAVLVTALGLGACAQRKEVVTPAPAPAGK* |
| Ga0126344_11442191 | 3300010866 | Boreal Forest Soil | DRLKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPTGK* |
| Ga0137389_100028443 | 3300012096 | Vadose Zone Soil | MKFLKTIMIVAVLVTALELGACAQHKEAVVTAPAPKGGK* |
| Ga0137382_103645962 | 3300012200 | Vadose Zone Soil | LKMIMIVAVLVTALGLGACAQHKEVVTPAPAPKGGK* |
| Ga0150985_1125554512 | 3300012212 | Avena Fatua Rhizosphere | DRLKFLKMIVVMAVLVTGLGLGACAQHKEVVVPPAPKGGK* |
| Ga0137386_112687261 | 3300012351 | Vadose Zone Soil | DRLKFLKMIMIMAVLVTALELGACAQHKEVVAPAPAPTGK* |
| Ga0137366_106327732 | 3300012354 | Vadose Zone Soil | LKLLKTIMVVAVMVTALGLGACAQHKEVVTPPPAPMGK |
| Ga0137371_101355672 | 3300012356 | Vadose Zone Soil | MKFLKAIMIVAIIVTALGLGACAQHKEAVVTAPAPMGK* |
| Ga0137371_110818261 | 3300012356 | Vadose Zone Soil | RRDRLKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPMGK* |
| Ga0137384_100124724 | 3300012357 | Vadose Zone Soil | MRFFKMIMIVAVLVTALGLGACAQHKEVVTPAPAYSGK* |
| Ga0137385_100695693 | 3300012359 | Vadose Zone Soil | MKFLKAIMIVAVLVTALGLGACAQHKEVVAPAPTTYGK* |
| Ga0137375_112166081 | 3300012360 | Vadose Zone Soil | VKFIKMIMIVALLVTALGLGACAQKKEVVAPAPTTYGK |
| Ga0150984_1013990861 | 3300012469 | Avena Fatua Rhizosphere | LKFLKLIVISAFLVTACGLGACAQHKEVAAPAPAPMAK* |
| Ga0157334_10733382 | 3300012509 | Soil | VKFVKTIMIVAVAASALGLGACAQHKEAPPPAPAPA |
| Ga0157287_11222272 | 3300012885 | Soil | ERRRDRLKFLKMIMIVAVLATALGLGACAQHKEAAAPAPAPMGK* |
| Ga0137394_105930632 | 3300012922 | Vadose Zone Soil | RRRFRLKLLKTMMVVAVLVTALGLGACAQHKEVVTPPMGKTGK* |
| Ga0137416_102050092 | 3300012927 | Vadose Zone Soil | LKLLKTIMIVTVMVTALGLGACAQHKEVVTPPMGKTGK* |
| Ga0164303_104089472 | 3300012957 | Soil | LKFLKMIVVMAVLVTGLGLGACAQHKEVVVPPAPKGGK* |
| Ga0134087_100238261 | 3300012977 | Grasslands Soil | RRMKFLKAIMIVAILVSALGLGACAQHKEAVVTAPAPKGGK* |
| Ga0157379_112026931 | 3300014968 | Switchgrass Rhizosphere | KMIVVMAVLVTGLGLGACAQHKEVVVPPAPKGGK* |
| Ga0134083_101883392 | 3300017659 | Grasslands Soil | VKFVKMIMIVALLVTALGLGACAQHKEVVAPAPTTYGK |
| Ga0184605_104496342 | 3300018027 | Groundwater Sediment | LKLLKTIMIMAVLVTALGLGACAQHKEVTPPPSTYGK |
| Ga0187788_103130912 | 3300018032 | Tropical Peatland | LKFVKTIMVVALLVTALGFGACAQHKEVMPPPQKTGKK |
| Ga0187765_104876951 | 3300018060 | Tropical Peatland | ERRRYRLKFLKMIMIVAVLFTAVGLGACSSQHKETPVPASTGK |
| Ga0184619_103647731 | 3300018061 | Groundwater Sediment | LLKTIMIMAVLVTALGLGACAQHKEVTPPPRTYGK |
| Ga0066655_100032983 | 3300018431 | Grasslands Soil | MKFLKAIMIVAILVSALGLGACAQHKEAVVTAPAPKGGK |
| Ga0066655_113864191 | 3300018431 | Grasslands Soil | RLKFLKMIMIVAVLVTALELGACAQHKEVVAPAPAPTGK |
| Ga0066669_103393072 | 3300018482 | Grasslands Soil | RDGLKFLKMIMIVAVTVTALGLGACAQHKEIAPPPAGKTSAK |
| Ga0137408_11927202 | 3300019789 | Vadose Zone Soil | MKFLKTIMIVAVLVTTLGLGACAQHKEAVVTAPAPMGK |
| Ga0193722_10220311 | 3300019877 | Soil | MKFLKAIMIVAVIVTALGLGACAQHKEAVVTAPAPMGK |
| Ga0193734_10023852 | 3300020015 | Soil | MKFLKAIMIVAVLVTALGLGACAQHKEAVVTAPAPMGK |
| Ga0210406_110730962 | 3300021168 | Soil | MKFLKMIMITAVLFTALGLGACAQHKEVVAPAPAPTG |
| Ga0193695_11072762 | 3300021418 | Soil | LLKTIMIVAVMVTALGLGACAQHKEVVTPPMGKTGK |
| Ga0182009_100763891 | 3300021445 | Soil | LKFLKMIMIVGVLVTALGLGACATQHKEVVAPAPTTA |
| Ga0210392_103383312 | 3300021475 | Soil | FLKKVMIMAILLTALGLGACTQHKEVVTPPPPAPTGK |
| Ga0242642_10262941 | 3300022504 | Soil | KKIMIMAILLTALGLGACTQHKEVVTPPPPAPAGK |
| Ga0242656_10453211 | 3300022525 | Soil | ERRRDRLKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPAGK |
| Ga0222623_103354372 | 3300022694 | Groundwater Sediment | DRVKFVKMIMIVALLVTALGLGACAQHKEVVAPPPSTYSK |
| Ga0242677_10174971 | 3300022713 | Soil | RDRLKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPTGK |
| Ga0242671_10379991 | 3300022714 | Soil | RDRLKFLKKIMIMAVLLTALGLGACTQHKEVVTPPPPAPAGK |
| Ga0242657_11851311 | 3300022722 | Soil | RLKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPAGK |
| Ga0222622_110301661 | 3300022756 | Groundwater Sediment | VKFVKMIMIVALLVTALGLGACAQHKEVVAPPPSTY |
| Ga0247661_10136881 | 3300024254 | Soil | FLKMIMIVAVLVTALEVGACAQHKEVVTPAPAPMGK |
| Ga0207646_106932151 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ERRRDGLKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAPKGGK |
| Ga0207665_104037692 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFLKMIMIVAVLVTALGLGACAQHKEVVTPAPAP |
| Ga0207668_106725882 | 3300025972 | Switchgrass Rhizosphere | LKFLKMIVVMAVLVTGLGLGACAQHKEVVVPPAPKG |
| Ga0207677_105281832 | 3300026023 | Miscanthus Rhizosphere | LKFLKMIVVMAVLVSALGLGACAQHKEVVVPPAPK |
| Ga0207683_109327032 | 3300026121 | Miscanthus Rhizosphere | RRKEVDRLKFLKMIMVMAVLATALGLGACAQHKEAAAPAPAPMGK |
| Ga0209468_11858082 | 3300026306 | Soil | RRDRVKFVKMIMIVALLVTALGLGACAQHKEVVAPAPTTYGK |
| Ga0209686_12024562 | 3300026315 | Soil | RLKFLKMIMIMAVLVTALELGACAQHKEVVAPAPAPTGK |
| Ga0209155_12973602 | 3300026316 | Soil | LKFIKAIMIMAVLAGALSLGACAQHKEAAAPAPTT |
| Ga0209470_10241923 | 3300026324 | Soil | MRFFKMIMIVAVLVTALGLGACAQRKEVVTPAPAYSGK |
| Ga0209266_12245141 | 3300026327 | Soil | MKFLKAIMIVAVLVTALGLGACAQHKEVVAPAPTTYGK |
| Ga0209267_11576821 | 3300026331 | Soil | VKFVKMIMIVTLLVTALGLGACAQHKEVVAPAPTTYGK |
| Ga0209159_10367443 | 3300026343 | Soil | RDRVKFVKMIMIVALLVTALGLGACAQHKEVVAPAPTTYGK |
| Ga0257164_10212242 | 3300026497 | Soil | VKFMKTIMIVALLVTALGLGACAQHKEVVAPAPTTY |
| Ga0209690_10227504 | 3300026524 | Soil | LKFLKMIMIVAVLVTALELGACAQHKEVVAPAPAPTGK |
| Ga0209806_13443241 | 3300026529 | Soil | RLKFLKMIMIMAVLVTALELGACAQHKEVVAPAPAPMGK |
| Ga0209058_12824872 | 3300026536 | Soil | LKLLNTIVVVAVLVSALGLGACAQHKEVVTPPMGKTGK |
| Ga0209056_104812761 | 3300026538 | Soil | RLKFFKAIMIMAVLASALSFGACAQRKQEIVTPAPAYSGK |
| Ga0209648_101243273 | 3300026551 | Grasslands Soil | MKFLKTIMIVAVLVTALELGACAQHKEAVVTAPAPKGGK |
| Ga0207625_1020632 | 3300027457 | Soil | MIMIVAVLATGLGLGACAQHKEVVVPPPQKKGYGK |
| Ga0209180_108003322 | 3300027846 | Vadose Zone Soil | MKFLKTIMIVALLVTALELGACAQHKEAVVTAPAPKGGK |
| Ga0209488_108122911 | 3300027903 | Vadose Zone Soil | RRDRVKFMKTIMIVALLATALGLGACAQHKEAVVTAPAPMGK |
| Ga0137415_102461832 | 3300028536 | Vadose Zone Soil | LKLLKTIMIVTVMVTALGLGACAQHKEVVTPPMGKTGK |
| Ga0137415_111375262 | 3300028536 | Vadose Zone Soil | LKMIVVMAVLVTALGVGACAQHKEVVVPPAPKGGK |
| Ga0257175_10096272 | 3300028673 | Soil | FLKTIMIVALLVTALELGACAQHKEAVVTAPAPKGGK |
| Ga0075399_113153241 | 3300030967 | Soil | LKFLKMIVVMAVLVTALGLGACAQHKEVVVPPAPKGGK |
| Ga0170834_1107747901 | 3300031057 | Forest Soil | RDRLKFLKKIMIMAILLTALGLGACTQHKEVVTPPPPAPAGK |
| Ga0170824_1098178152 | 3300031231 | Forest Soil | VKFVKMIMIAAVAASALGLGACAQHKEAPPPAPAPAY |
| Ga0170820_171590661 | 3300031446 | Forest Soil | FLKMIMIVAVLVTALELGACAQHKEVVAPAPAPTGK |
| Ga0306921_124102773 | 3300031912 | Soil | MKFLKMIMIVAVLVAALGFGACAQHKEVVTPPPAPAGK |
| Ga0310916_102570042 | 3300031942 | Soil | LKKIMIMAILLTALGLGACAQHKEVVTPPPPAPAGK |
| Ga0307471_1004272791 | 3300032180 | Hardwood Forest Soil | ILKFLKMIMIVAVLVTALELGACAQHKEVVAPAPAPMGK |
| Ga0307472_1003195332 | 3300032205 | Hardwood Forest Soil | RLKFLKMIMIVAVLVTALELGACAQHKEVVTPAPAPMGK |
| Ga0310896_108537811 | 3300032211 | Soil | LKFLKMIVVMAVLVSALGLGACAQHKEVVVPPTPKGG |
| Ga0310810_108431812 | 3300033412 | Soil | LKMIMIVAVLVTALELGACAQHKEVVTPAPAPMGK |
| Ga0247830_116092791 | 3300033551 | Soil | LKFLKMIVVVTVLVTALGLGACAQHKEVVVPPAPKGG |
| ⦗Top⦘ |