


| Basic Information | |
|---|---|
| Family ID | F064536 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | IVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSAEEIARARGLG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 94.53 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.969 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF02777 | Sod_Fe_C | 14.84 |
| PF02417 | Chromate_transp | 13.28 |
| PF01699 | Na_Ca_ex | 3.12 |
| PF01925 | TauE | 2.34 |
| PF12796 | Ank_2 | 2.34 |
| PF09828 | Chrome_Resist | 2.34 |
| PF00190 | Cupin_1 | 1.56 |
| PF13857 | Ank_5 | 1.56 |
| PF04828 | GFA | 1.56 |
| PF00561 | Abhydrolase_1 | 1.56 |
| PF00106 | adh_short | 0.78 |
| PF06210 | DUF1003 | 0.78 |
| PF14226 | DIOX_N | 0.78 |
| PF13458 | Peripla_BP_6 | 0.78 |
| PF00581 | Rhodanese | 0.78 |
| PF01451 | LMWPc | 0.78 |
| PF08327 | AHSA1 | 0.78 |
| PF00005 | ABC_tran | 0.78 |
| PF01212 | Beta_elim_lyase | 0.78 |
| PF13271 | DUF4062 | 0.78 |
| PF07676 | PD40 | 0.78 |
| PF01965 | DJ-1_PfpI | 0.78 |
| PF12840 | HTH_20 | 0.78 |
| PF07883 | Cupin_2 | 0.78 |
| PF01370 | Epimerase | 0.78 |
| PF06439 | 3keto-disac_hyd | 0.78 |
| PF07586 | HXXSHH | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 14.84 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 13.28 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 3.12 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 3.12 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.34 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.56 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.56 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.78 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.78 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.78 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.78 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.78 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.78 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.78 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.78 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.78 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.78 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.78 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.78 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.97 % |
| Unclassified | root | N/A | 32.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0257095 | Not Available | 504 | Open in IMG/M |
| 3300000955|JGI1027J12803_103384705 | Not Available | 1174 | Open in IMG/M |
| 3300000956|JGI10216J12902_111456959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1187 | Open in IMG/M |
| 3300002906|JGI25614J43888_10156490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300004152|Ga0062386_100315536 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300004633|Ga0066395_10496196 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005172|Ga0066683_10573831 | Not Available | 686 | Open in IMG/M |
| 3300005175|Ga0066673_10109991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1490 | Open in IMG/M |
| 3300005175|Ga0066673_10171737 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300005181|Ga0066678_10711762 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005332|Ga0066388_104637467 | Not Available | 699 | Open in IMG/M |
| 3300005553|Ga0066695_10765280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
| 3300005557|Ga0066704_10421220 | Not Available | 884 | Open in IMG/M |
| 3300005558|Ga0066698_11049150 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005578|Ga0068854_101901058 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005713|Ga0066905_102075273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → Beijerinckia indica | 528 | Open in IMG/M |
| 3300005764|Ga0066903_100755179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1728 | Open in IMG/M |
| 3300005764|Ga0066903_101097971 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005764|Ga0066903_101917759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1135 | Open in IMG/M |
| 3300005764|Ga0066903_102108189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
| 3300005764|Ga0066903_102447791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300005764|Ga0066903_103346443 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005843|Ga0068860_100777482 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005844|Ga0068862_100863114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300006049|Ga0075417_10277521 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006797|Ga0066659_11155908 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006804|Ga0079221_10992982 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5 | 629 | Open in IMG/M |
| 3300006852|Ga0075433_10641317 | Not Available | 931 | Open in IMG/M |
| 3300006954|Ga0079219_10143655 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300007255|Ga0099791_10089570 | Not Available | 1408 | Open in IMG/M |
| 3300009137|Ga0066709_101881486 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300009137|Ga0066709_103854870 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009148|Ga0105243_12182088 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009649|Ga0105855_1263525 | Not Available | 537 | Open in IMG/M |
| 3300009792|Ga0126374_10899129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 686 | Open in IMG/M |
| 3300009792|Ga0126374_11498530 | Not Available | 553 | Open in IMG/M |
| 3300010038|Ga0126315_10962340 | Not Available | 570 | Open in IMG/M |
| 3300010043|Ga0126380_11759321 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010046|Ga0126384_10503928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300010046|Ga0126384_11001980 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010046|Ga0126384_11495901 | Not Available | 632 | Open in IMG/M |
| 3300010046|Ga0126384_12268025 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010047|Ga0126382_11245370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300010048|Ga0126373_11249443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 809 | Open in IMG/M |
| 3300010335|Ga0134063_10711619 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010360|Ga0126372_12593934 | Not Available | 558 | Open in IMG/M |
| 3300010360|Ga0126372_12835929 | Not Available | 537 | Open in IMG/M |
| 3300010361|Ga0126378_10566346 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300010361|Ga0126378_10978022 | Not Available | 951 | Open in IMG/M |
| 3300010362|Ga0126377_12641371 | Not Available | 577 | Open in IMG/M |
| 3300010366|Ga0126379_11944171 | Not Available | 691 | Open in IMG/M |
| 3300010376|Ga0126381_100554084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1629 | Open in IMG/M |
| 3300010376|Ga0126381_102500690 | Not Available | 740 | Open in IMG/M |
| 3300012096|Ga0137389_10652046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 905 | Open in IMG/M |
| 3300012198|Ga0137364_10416383 | Not Available | 1006 | Open in IMG/M |
| 3300012202|Ga0137363_11449329 | Not Available | 577 | Open in IMG/M |
| 3300012211|Ga0137377_10155534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2191 | Open in IMG/M |
| 3300012285|Ga0137370_10264175 | Not Available | 1022 | Open in IMG/M |
| 3300012951|Ga0164300_10265244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300012960|Ga0164301_10237627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1188 | Open in IMG/M |
| 3300012971|Ga0126369_12395302 | Not Available | 614 | Open in IMG/M |
| 3300012975|Ga0134110_10450029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5 | 578 | Open in IMG/M |
| 3300014968|Ga0157379_11323885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300014968|Ga0157379_12050192 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300015374|Ga0132255_104809844 | Not Available | 572 | Open in IMG/M |
| 3300016270|Ga0182036_10375745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1101 | Open in IMG/M |
| 3300016294|Ga0182041_10115814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2002 | Open in IMG/M |
| 3300016294|Ga0182041_11129132 | Not Available | 713 | Open in IMG/M |
| 3300016319|Ga0182033_11757062 | Not Available | 562 | Open in IMG/M |
| 3300016387|Ga0182040_10828941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300016404|Ga0182037_10363634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1182 | Open in IMG/M |
| 3300016445|Ga0182038_10133124 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300016445|Ga0182038_10143943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1809 | Open in IMG/M |
| 3300018469|Ga0190270_12620509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300021168|Ga0210406_10196381 | Not Available | 1675 | Open in IMG/M |
| 3300021439|Ga0213879_10239789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300021560|Ga0126371_13549197 | Not Available | 526 | Open in IMG/M |
| 3300025899|Ga0207642_10319966 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300026089|Ga0207648_10323528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5 | 1386 | Open in IMG/M |
| 3300026324|Ga0209470_1239408 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300026333|Ga0209158_1059866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
| 3300026342|Ga0209057_1099196 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300026540|Ga0209376_1304941 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031231|Ga0170824_107413721 | Not Available | 747 | Open in IMG/M |
| 3300031546|Ga0318538_10661826 | Not Available | 566 | Open in IMG/M |
| 3300031640|Ga0318555_10264921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 929 | Open in IMG/M |
| 3300031768|Ga0318509_10258002 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031770|Ga0318521_10170984 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300031771|Ga0318546_10589501 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031778|Ga0318498_10537718 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031780|Ga0318508_1053809 | Not Available | 1069 | Open in IMG/M |
| 3300031805|Ga0318497_10369304 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300031805|Ga0318497_10753171 | Not Available | 546 | Open in IMG/M |
| 3300031819|Ga0318568_10742298 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031820|Ga0307473_10344852 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300031820|Ga0307473_10429316 | Not Available | 874 | Open in IMG/M |
| 3300031820|Ga0307473_10671421 | Not Available | 724 | Open in IMG/M |
| 3300031833|Ga0310917_10782691 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031833|Ga0310917_10836582 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031833|Ga0310917_10891360 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031890|Ga0306925_11718081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300031890|Ga0306925_11951957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 556 | Open in IMG/M |
| 3300031893|Ga0318536_10249151 | Not Available | 903 | Open in IMG/M |
| 3300031893|Ga0318536_10326455 | Not Available | 778 | Open in IMG/M |
| 3300031910|Ga0306923_12552244 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031912|Ga0306921_11427657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300031912|Ga0306921_12164115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031941|Ga0310912_11378509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031946|Ga0310910_10144381 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300031947|Ga0310909_10106357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2262 | Open in IMG/M |
| 3300031954|Ga0306926_10837239 | Not Available | 1106 | Open in IMG/M |
| 3300032035|Ga0310911_10267266 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300032035|Ga0310911_10891185 | Not Available | 513 | Open in IMG/M |
| 3300032041|Ga0318549_10291780 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032042|Ga0318545_10046777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1457 | Open in IMG/M |
| 3300032052|Ga0318506_10313286 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300032059|Ga0318533_10407945 | Not Available | 993 | Open in IMG/M |
| 3300032065|Ga0318513_10158942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300032075|Ga0310890_10903343 | Not Available | 705 | Open in IMG/M |
| 3300032076|Ga0306924_10069259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3933 | Open in IMG/M |
| 3300032076|Ga0306924_10178243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2438 | Open in IMG/M |
| 3300032076|Ga0306924_10999812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 918 | Open in IMG/M |
| 3300032090|Ga0318518_10433604 | Not Available | 673 | Open in IMG/M |
| 3300032180|Ga0307471_102495845 | Not Available | 654 | Open in IMG/M |
| 3300032261|Ga0306920_100167382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3276 | Open in IMG/M |
| 3300032261|Ga0306920_101521981 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300032261|Ga0306920_103775202 | Not Available | 554 | Open in IMG/M |
| 3300033289|Ga0310914_10112598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2357 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_02570952 | 2228664022 | Soil | PFFGRPFFAGPPNTEGNLVFRALRYSAEEIARAKATAR |
| JGI1027J12803_1033847051 | 3300000955 | Soil | VWEYVNPFFGKPFFAGAPGTEGNLVFRALRYSADEIARAKATVSA* |
| JGI10216J12902_1114569591 | 3300000956 | Soil | WEYVNPFFGKPFFGGPPSSESNQVFRAIRYSEEEIARARG* |
| JGI25614J43888_101564901 | 3300002906 | Grasslands Soil | KEGGIVWEYVNPFFGKPFFGGPPSSESNQVFRALRYSPDEIARAQRSG* |
| Ga0062386_1003155361 | 3300004152 | Bog Forest Soil | EGEIVWEYMNPFFGRPFFGGPPTSESNQVFRAIRYSAEDIARARRLG* |
| Ga0066395_104961962 | 3300004633 | Tropical Forest Soil | FLRTLFRSHQRWEIVWEYVNPYFGGSPLAETNAVFRALRYSAEEISRAEATARD* |
| Ga0066683_105738312 | 3300005172 | Soil | VSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066673_101099911 | 3300005175 | Soil | EIVWEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066673_101717371 | 3300005175 | Soil | EGEIVWEYVSPFFGKPLFGGRKGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066678_107117621 | 3300005181 | Soil | WEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066388_1046374671 | 3300005332 | Tropical Forest Soil | EGEIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSAEDIARARRSG* |
| Ga0066695_107652802 | 3300005553 | Soil | IVWEYVNPFFGKPFFAGAPSTEGNLVFRALRYSAEEIARAKATART* |
| Ga0066704_104212202 | 3300005557 | Soil | FFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066698_110491502 | 3300005558 | Soil | FFGRPFFAGEPTTQGNLVFRALRYSADEIGRAKATARA* |
| Ga0068854_1019010582 | 3300005578 | Corn Rhizosphere | EGEIVWEYVNPFFGRPFFSGPPNTEGNLVFRALRYSAEEIARAKATTGA* |
| Ga0066905_1020752731 | 3300005713 | Tropical Forest Soil | NPFFGKPFFGGPPRSESNQVFRALRYSPDEIARAQRSG* |
| Ga0066903_1007551793 | 3300005764 | Tropical Forest Soil | EYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARRLAAR* |
| Ga0066903_1010979714 | 3300005764 | Tropical Forest Soil | EGEIVWEYVNPFFGKPFFGGPATSLSNQVFRAIRYSAEEIAQARGSG* |
| Ga0066903_1019177591 | 3300005764 | Tropical Forest Soil | EIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSAEDIARSRRLG* |
| Ga0066903_1021081891 | 3300005764 | Tropical Forest Soil | IVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARAR* |
| Ga0066903_1024477914 | 3300005764 | Tropical Forest Soil | IVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARAWAR* |
| Ga0066903_1033464432 | 3300005764 | Tropical Forest Soil | EIVWEYINPFFGKPFFGGPTTSESNQVFRAIRYSAEDIARARRSA* |
| Ga0068860_1007774822 | 3300005843 | Switchgrass Rhizosphere | FGRPFFAGPPSTEGNLVFRALRYSAEEIARAKATAR* |
| Ga0068862_1008631141 | 3300005844 | Switchgrass Rhizosphere | VNPFFGTPLFGGREGSESNQVFRAYRYSAEEIARARGNS* |
| Ga0075417_102775211 | 3300006049 | Populus Rhizosphere | GEIVWEYVNPFFGKPFFAGPPNTEGNLVFRALRYSAEEIARAKATTGA* |
| Ga0066659_111559082 | 3300006797 | Soil | PFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0079221_109929822 | 3300006804 | Agricultural Soil | IVWEYVNPFFGRPFFSGPPNTEGNLVFRALRYSAEEIARAKAATGA* |
| Ga0075433_106413171 | 3300006852 | Populus Rhizosphere | NPFFGKPFFGGPPTSESNQVFRALRYSAAEVARAREAG* |
| Ga0079219_101436552 | 3300006954 | Agricultural Soil | FFGRPFFAGPPTTEGNLVFRALRYSAEEIARAKASANT* |
| Ga0099791_100895701 | 3300007255 | Vadose Zone Soil | EGEIVWEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0066709_1018814861 | 3300009137 | Grasslands Soil | GEIVWEYVNPFFGRPFFAGEPTTQGNLVFRALRYSADEIGRAKATARA* |
| Ga0066709_1038548701 | 3300009137 | Grasslands Soil | GEIVWEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG* |
| Ga0105243_121820883 | 3300009148 | Miscanthus Rhizosphere | FFGKPFFAGPPTTEGNLVFRALRYSAEEIARAKATTGA* |
| Ga0105855_12635251 | 3300009649 | Permafrost Soil | GEIVWEYVNPYFGKPLFGGPPTSESNQVFRALRYSAAEISRARSLG* |
| Ga0126374_108991292 | 3300009792 | Tropical Forest Soil | FFGGPPTSESNQVFRAIRYGEEEIARARRLASSK* |
| Ga0126374_114985301 | 3300009792 | Tropical Forest Soil | KPFFAGAPGTEGNLVFRALRYSAEEIARAKATAGG* |
| Ga0126315_109623402 | 3300010038 | Serpentine Soil | VNPFFGQPFFGGPPTAESNQVFRALRYSAEEIDRARGRG* |
| Ga0126380_117593211 | 3300010043 | Tropical Forest Soil | VNPLFGKPFFGGPPNSESNQVFRAVRYGAEEIGRARSAG* |
| Ga0126384_105039283 | 3300010046 | Tropical Forest Soil | YVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG* |
| Ga0126384_110019802 | 3300010046 | Tropical Forest Soil | ESEIVWEYVNPFFGRPFFAGSPDTQGNLVFRALRYSAEEIARAKATAGTSLTGEGS* |
| Ga0126384_114959012 | 3300010046 | Tropical Forest Soil | PFFGRPFFAGSPDTQGNLVFRALRYSTEEIARAKATAG* |
| Ga0126384_122680251 | 3300010046 | Tropical Forest Soil | MNAGEIVWEYVNPFFGRPFFAGSPDTQGNLVFRALRYGVEEIARAKAMVGA* |
| Ga0126382_112453701 | 3300010047 | Tropical Forest Soil | KEGEIVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYNEEEIARARG* |
| Ga0126373_112494432 | 3300010048 | Tropical Forest Soil | EMVWEYVNPHFGKPFLAGPQTSQTNQVFKALRYSEDEIARARGLG* |
| Ga0134063_107116192 | 3300010335 | Grasslands Soil | FFGKPFFGGPPTSESNQVFRAPRYSAAEVARARGAG* |
| Ga0126372_125939342 | 3300010360 | Tropical Forest Soil | EYVNPFFGRPFFAGSPDTQGNLVFRALRYSAEEIARAKATVSA* |
| Ga0126372_128359292 | 3300010360 | Tropical Forest Soil | EVVWEYVNPHFGKPFFAGPSTSQTNQVFKALRYSEAEVARARGVN* |
| Ga0126378_105663461 | 3300010361 | Tropical Forest Soil | VNPFFGKPFFAGAPGTEGNLVFRALRYSADDIARAKTTV* |
| Ga0126378_109780222 | 3300010361 | Tropical Forest Soil | GRPFFAGSPDTQGNLVFRALRYSADEMARAKATAR* |
| Ga0126377_126413713 | 3300010362 | Tropical Forest Soil | VWEYVNPFFGKPFFGGPATSLSNQVFRAIRYSAEEIAQARGSG* |
| Ga0126379_119441711 | 3300010366 | Tropical Forest Soil | VWEYVNPFFGKPFFGGPPASESNWVFRALRYSAEEIARARGAT* |
| Ga0126381_1005540841 | 3300010376 | Tropical Forest Soil | VVWEYINPFFGKPFFGGPPTSETNQVFRAIRYSAEEIARARRSG* |
| Ga0126381_1025006901 | 3300010376 | Tropical Forest Soil | KEGEIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSTEDIARARRSG* |
| Ga0137389_106520461 | 3300012096 | Vadose Zone Soil | TAGEIVWEYVNPFFGQHLFGGPPTSESNQVFRALRYSAEEIARARG* |
| Ga0137364_104163832 | 3300012198 | Vadose Zone Soil | WEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARR* |
| Ga0137363_114493291 | 3300012202 | Vadose Zone Soil | KEGEIVWEYVNPFFGKPFFGGPPTSESNQVFRALRYGAEEIARARGSG* |
| Ga0137377_101555341 | 3300012211 | Vadose Zone Soil | GEIVWEYVNPFFGRPFFAGPPNTEGNLVFRALRYTAEEIARAKATVGEG* |
| Ga0137370_102641752 | 3300012285 | Vadose Zone Soil | VWEYVSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARR* |
| Ga0164300_102652442 | 3300012951 | Soil | VWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSEKEIARARG* |
| Ga0164301_102376271 | 3300012960 | Soil | GEIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSEKEIARARG* |
| Ga0126369_123953022 | 3300012971 | Tropical Forest Soil | PFFGKPFFGGPPGSESNWVFRTLRYSAEEIARARSAG* |
| Ga0134110_104500292 | 3300012975 | Grasslands Soil | GEIVWEYVNPFFGKPFFAGQPNTEGNLVFRALRYSAEEIARAKAATGA* |
| Ga0157379_113238853 | 3300014968 | Switchgrass Rhizosphere | VNPFFGKPFFAGPPTTEGNLVFRALRYSAEEIARAKATTGA* |
| Ga0157379_120501922 | 3300014968 | Switchgrass Rhizosphere | FFAGSSDTQGNLVFRALRYSAEDIERAKATAGARIAGS* |
| Ga0132255_1048098441 | 3300015374 | Arabidopsis Rhizosphere | GEIVWEYVNPFFGRPFFAGPPSTEGNLVFRALRYGAEEIARAKATV* |
| Ga0182036_103757451 | 3300016270 | Soil | FGKPFFAGPQTSQTNQVFKALRYSEDEIARARGLG |
| Ga0182041_101158141 | 3300016294 | Soil | PFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG |
| Ga0182041_111291321 | 3300016294 | Soil | VNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARS |
| Ga0182033_117570621 | 3300016319 | Soil | KEGEIVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG |
| Ga0182040_108289412 | 3300016387 | Soil | WEYVNPHFGKPFFAGPPTSQTNQVFRALRYSEAEIARARGVN |
| Ga0182037_103636341 | 3300016404 | Soil | KEGKIVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG |
| Ga0182038_101331244 | 3300016445 | Soil | IVWEYVNPFFGKPFFGGPPTSESNQVFRALRYSAAEVARARGAG |
| Ga0182038_101439431 | 3300016445 | Soil | NPFFGKPFFGGPPTSETNQVFRAIRYSAEEIARARRLG |
| Ga0190270_126205091 | 3300018469 | Soil | IVWEYVNPFFGKPLFGGREGSQSNQVFRAYRYSAEDIALARDTMAP |
| Ga0210406_101963812 | 3300021168 | Soil | IVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSAEEIARARGLG |
| Ga0213879_102397891 | 3300021439 | Bulk Soil | VNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARR |
| Ga0126371_135491971 | 3300021560 | Tropical Forest Soil | NPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG |
| Ga0207642_103199662 | 3300025899 | Miscanthus Rhizosphere | KPFFGRPFFAGPPNTEGNLVFRALRYSAEEIARAKATTGA |
| Ga0207648_103235281 | 3300026089 | Miscanthus Rhizosphere | YVNPFFGKPFFAGPPNTEGNLVFRALRYSAEEIARAKAATGA |
| Ga0209470_12394082 | 3300026324 | Soil | EIVWEYINPFFGKPFFAGAPSTEGNLVFRALRYSAEEIARAKATART |
| Ga0209158_10598661 | 3300026333 | Soil | VSPFFGKPLFGGREGSESNQVFRAYRYSDEEIARARRNG |
| Ga0209057_10991962 | 3300026342 | Soil | EYVNPFFGRPFFAGEPTTQGNLVFRALRYSADEIGRAKATARA |
| Ga0209376_13049412 | 3300026540 | Soil | YVNPFFGRPFFAGEPTTQGNLVFRALRYSADEIGRAKATARA |
| Ga0170824_1074137211 | 3300031231 | Forest Soil | NPFFGKPLFGGPPTSESNQIFRALRYSAEEIARARGTG |
| Ga0318538_106618261 | 3300031546 | Soil | EGEIVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYGEEEIARARRLASSK |
| Ga0318555_102649213 | 3300031640 | Soil | HFGKPFFAGPPTSQTNQVFRALRYSEAEIARARGVN |
| Ga0318509_102580021 | 3300031768 | Soil | YVNPFFGKPFFGGPATSQSNQVFRAIRYSAEEIAQARGSG |
| Ga0318521_101709842 | 3300031770 | Soil | NPFFGKPFFGGSPTSQSNQVFRALRYSPEEITRARRSG |
| Ga0318546_105895011 | 3300031771 | Soil | VNPFFGKPFFGGSPTSQSNQVFRALRYSPEEITRARRSG |
| Ga0318498_105377182 | 3300031778 | Soil | EVTNGGEIVWEYVNPFFGKPFFGGPSTSQSNQVFRALRYDAEAIARARSTG |
| Ga0318508_10538091 | 3300031780 | Soil | EIVWEYVNPFFGKPFFGGPPTSESNQVFRAIRYGEEEIARARRLASSK |
| Ga0318497_103693042 | 3300031805 | Soil | VNPFFGKPFFGGPPTSESNQVFRAIRYSAAEVARARGAG |
| Ga0318497_107531711 | 3300031805 | Soil | YVNPFFGKPFFGGPPTSESSQVFRAIRYSEEEIARARR |
| Ga0318568_107422982 | 3300031819 | Soil | NGGEIVWEYVNPFFGKPFFGGPSTSQSNQVFRALRYDAEAIARARSTGEESAHA |
| Ga0307473_103448521 | 3300031820 | Hardwood Forest Soil | IVWEYVNPFFGRPFFAGPPNTEGNLVFRALRYSAEEIARAKATTGA |
| Ga0307473_104293162 | 3300031820 | Hardwood Forest Soil | TKDGEIVWECVNPFFGKPFFAGAPNTEGNLVFRALRYSAEEIARAQATARA |
| Ga0307473_106714211 | 3300031820 | Hardwood Forest Soil | EYVNPFFGRPFFAGPPSTEGNLVFRALRYSAEEIARAKATGR |
| Ga0310917_107826912 | 3300031833 | Soil | PFFGKPFFGGPPTSESNQVFRALRYSAAEVARARGAG |
| Ga0310917_108365821 | 3300031833 | Soil | IVWEYVNPFFGKPFFGGPSTSQSNQVFRALRYDAEAIARARSTG |
| Ga0310917_108913601 | 3300031833 | Soil | EIVWEYVNPFFGKPFFGGPPTSQSNQVFRALRYSPEEITRARRSG |
| Ga0306925_117180811 | 3300031890 | Soil | FGKPFFGGPATSESNQVFRAIRYSAEEIAQARGSG |
| Ga0306925_119519571 | 3300031890 | Soil | NPFFGKPFFGGPPASESNQVFRAIRYSAEDIARARGSG |
| Ga0318536_102491512 | 3300031893 | Soil | GEIVWEYVNPFFGKPFFGGPSTSQSNQVFRALRYDAEAIARARSTG |
| Ga0318536_103264552 | 3300031893 | Soil | WEYINPFFGKPFFGGPPTSETNQVFRAIRFSAEEIARARRSG |
| Ga0306923_125522442 | 3300031910 | Soil | VWEYVNPFFGKPFFAGPPNTEGNLVFRALRYSAEEIARAKATTRA |
| Ga0306921_114276571 | 3300031912 | Soil | LEYVNPFFGTPFFGGPPDSESNQIFRALRYTADEVARARGST |
| Ga0306921_121641151 | 3300031912 | Soil | IVWEYVNPFFGGPPAAETNEVFRALRYSAEEIARASLNIS |
| Ga0310912_113785092 | 3300031941 | Soil | KEGDIVWEYVNPFFGKPFFGGPPTSESNQVFRALRYSAEEIARARRSD |
| Ga0310910_101443811 | 3300031946 | Soil | EVSKEGEIVWEYVNPFFGKPFFGGPATSQSNQVFRAIRYSSEEIAQARGSG |
| Ga0310909_101063575 | 3300031947 | Soil | FFGKPFFGGPQGSESNWVFRALSYSAEEIARARGAG |
| Ga0306926_108372393 | 3300031954 | Soil | YVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARS |
| Ga0310911_102672663 | 3300032035 | Soil | IVWEYVNPFFGKPFFGGPPSSQSNQVFRAIRYSAEEISRTGRSG |
| Ga0310911_108911851 | 3300032035 | Soil | PFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARGSG |
| Ga0318549_102917803 | 3300032041 | Soil | VWEYVNPFFGKPFFGGPPSSQSNQVFRAIRYSAEEIGRAGRSG |
| Ga0318545_100467774 | 3300032042 | Soil | TKEGEIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSEEEIARSRRLG |
| Ga0318506_103132861 | 3300032052 | Soil | EYVNPFFGKPFFGGPATSESNQVFRAIRYSSEEIAQARGSG |
| Ga0318533_104079451 | 3300032059 | Soil | NPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARGSG |
| Ga0318513_101589423 | 3300032065 | Soil | EGEIVWEYVNPFFGRPFFAGSPDTQGNLVFRALRYSAEEIARAKATAGARSAGS |
| Ga0310890_109033431 | 3300032075 | Soil | EGEIVWEYVNPFFGRPFFAGPPSTEGNLVFRALRYGAEEIARAKATVR |
| Ga0306924_100692591 | 3300032076 | Soil | VWEYVNPFFGKPFFGGPPTSQSNQVFRALRYSPEEITRARRSG |
| Ga0306924_101782436 | 3300032076 | Soil | FGKPFFGGPPTSESNQVFRAIRYSAEEIARARGLG |
| Ga0306924_109998121 | 3300032076 | Soil | WEYVNPFFGKPFFGGPPTSESNQVFRALRYSAEEIARARRSD |
| Ga0318518_104336041 | 3300032090 | Soil | YINPFFGKPFFGGPPTSETNQVFRAIRYSAEEIARARRSG |
| Ga0307471_1024958453 | 3300032180 | Hardwood Forest Soil | EGAIVWEYVNPFFGRPFFGGPPTSESNQVFRAIRYSEKEIARARG |
| Ga0306920_1001673821 | 3300032261 | Soil | NPFFGKLFFGGSPTSQSNQVFRALRYSPEEITRARRSG |
| Ga0306920_1015219811 | 3300032261 | Soil | VVWEYINPFFGKPFFGGPPTSETNQVFRAIRFSAEEIARARRSG |
| Ga0306920_1037752021 | 3300032261 | Soil | EYVNPFFGRPFFGGPPTSESNQVFRAIRYSAEDIARARRSG |
| Ga0310914_101125983 | 3300033289 | Soil | VWEYVNPFFGKPFFGGPPTSESNQVFRAIRYSEEEIARARG |
| ⦗Top⦘ |