


| Basic Information | |
|---|---|
| Family ID | F064233 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIDKFMYTLFGAIDKFFDTFIPNAYERLKNNRIFSSKKRKRK |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.29 % |
| % of genes near scaffold ends (potentially truncated) | 34.88 % |
| % of genes from short scaffolds (< 2000 bps) | 57.36 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (35.659 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (38.760 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.512 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.744 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 45.74 |
| PF02675 | AdoMet_dc | 0.78 |
| PF03237 | Terminase_6N | 0.78 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 45.74 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.34 % |
| Unclassified | root | N/A | 35.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10004063 | Not Available | 8237 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10037862 | Not Available | 2265 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10044377 | Not Available | 2018 | Open in IMG/M |
| 3300001419|JGI11705J14877_10024282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2366 | Open in IMG/M |
| 3300001419|JGI11705J14877_10104404 | All Organisms → Viruses → environmental samples → uncultured virus | 829 | Open in IMG/M |
| 3300001419|JGI11705J14877_10165081 | All Organisms → Viruses → environmental samples → uncultured virus | 590 | Open in IMG/M |
| 3300001748|JGI11772J19994_1005495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 | 2398 | Open in IMG/M |
| 3300001748|JGI11772J19994_1017759 | All Organisms → Viruses → environmental samples → uncultured virus | 1076 | Open in IMG/M |
| 3300001748|JGI11772J19994_1023546 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300001748|JGI11772J19994_1034552 | All Organisms → Viruses → environmental samples → uncultured virus | 647 | Open in IMG/M |
| 3300001748|JGI11772J19994_1041277 | All Organisms → Viruses → environmental samples → uncultured virus | 569 | Open in IMG/M |
| 3300003427|JGI26084J50262_1005309 | Not Available | 5880 | Open in IMG/M |
| 3300005214|Ga0069002_10099854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300005512|Ga0074648_1020084 | Not Available | 3785 | Open in IMG/M |
| 3300005512|Ga0074648_1030678 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300005512|Ga0074648_1039489 | Not Available | 2216 | Open in IMG/M |
| 3300005512|Ga0074648_1102456 | Not Available | 1000 | Open in IMG/M |
| 3300005611|Ga0074647_1005226 | All Organisms → cellular organisms → Bacteria | 3092 | Open in IMG/M |
| 3300005613|Ga0074649_1006440 | Not Available | 9662 | Open in IMG/M |
| 3300005613|Ga0074649_1016636 | Not Available | 4501 | Open in IMG/M |
| 3300005613|Ga0074649_1024411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3272 | Open in IMG/M |
| 3300005613|Ga0074649_1131542 | Not Available | 843 | Open in IMG/M |
| 3300006025|Ga0075474_10006163 | Not Available | 4792 | Open in IMG/M |
| 3300006025|Ga0075474_10024175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2180 | Open in IMG/M |
| 3300006025|Ga0075474_10202372 | All Organisms → Viruses → environmental samples → uncultured virus | 608 | Open in IMG/M |
| 3300006027|Ga0075462_10066491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1136 | Open in IMG/M |
| 3300006029|Ga0075466_1013608 | Not Available | 2734 | Open in IMG/M |
| 3300006734|Ga0098073_1023876 | Not Available | 895 | Open in IMG/M |
| 3300006810|Ga0070754_10401387 | All Organisms → Viruses → environmental samples → uncultured virus | 600 | Open in IMG/M |
| 3300006869|Ga0075477_10334013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300006916|Ga0070750_10458216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300006919|Ga0070746_10549335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300006920|Ga0070748_1345101 | All Organisms → Viruses → environmental samples → uncultured virus | 525 | Open in IMG/M |
| 3300007276|Ga0070747_1143570 | Not Available | 861 | Open in IMG/M |
| 3300007539|Ga0099849_1132009 | All Organisms → Viruses → environmental samples → uncultured virus | 976 | Open in IMG/M |
| 3300007539|Ga0099849_1367527 | All Organisms → Viruses → environmental samples → uncultured virus | 509 | Open in IMG/M |
| 3300007542|Ga0099846_1207038 | All Organisms → Viruses → environmental samples → uncultured virus | 690 | Open in IMG/M |
| 3300007542|Ga0099846_1262916 | All Organisms → Viruses → environmental samples → uncultured virus | 597 | Open in IMG/M |
| 3300007725|Ga0102951_1113308 | Not Available | 767 | Open in IMG/M |
| 3300007764|Ga0102950_1266713 | All Organisms → Viruses → environmental samples → uncultured virus | 529 | Open in IMG/M |
| 3300010299|Ga0129342_1242291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300010368|Ga0129324_10393987 | All Organisms → Viruses → environmental samples → uncultured virus | 535 | Open in IMG/M |
| 3300010389|Ga0136549_10320627 | Not Available | 640 | Open in IMG/M |
| 3300017824|Ga0181552_10029154 | Not Available | 3380 | Open in IMG/M |
| 3300017949|Ga0181584_10074738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2349 | Open in IMG/M |
| 3300017949|Ga0181584_10135395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
| 3300017950|Ga0181607_10086390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2012 | Open in IMG/M |
| 3300017950|Ga0181607_10100962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1823 | Open in IMG/M |
| 3300017950|Ga0181607_10692575 | All Organisms → Viruses → environmental samples → uncultured virus | 530 | Open in IMG/M |
| 3300017956|Ga0181580_10785344 | All Organisms → Viruses → environmental samples → uncultured virus | 600 | Open in IMG/M |
| 3300017963|Ga0180437_10142254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1954 | Open in IMG/M |
| 3300017964|Ga0181589_10197108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1403 | Open in IMG/M |
| 3300017964|Ga0181589_10253172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1204 | Open in IMG/M |
| 3300017967|Ga0181590_10348925 | All Organisms → Viruses → environmental samples → uncultured virus | 1063 | Open in IMG/M |
| 3300017968|Ga0181587_10645827 | Not Available | 672 | Open in IMG/M |
| 3300017989|Ga0180432_10072692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3081 | Open in IMG/M |
| 3300018041|Ga0181601_10116616 | Not Available | 1694 | Open in IMG/M |
| 3300018041|Ga0181601_10322207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300018080|Ga0180433_10698837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300018416|Ga0181553_10008870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8120 | Open in IMG/M |
| 3300018416|Ga0181553_10128806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1529 | Open in IMG/M |
| 3300018417|Ga0181558_10068417 | Not Available | 2308 | Open in IMG/M |
| 3300018420|Ga0181563_10723633 | All Organisms → Viruses → environmental samples → uncultured virus | 548 | Open in IMG/M |
| 3300018424|Ga0181591_10351608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300019459|Ga0181562_10012096 | Not Available | 5780 | Open in IMG/M |
| 3300019459|Ga0181562_10099824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1651 | Open in IMG/M |
| 3300019459|Ga0181562_10188112 | Not Available | 1092 | Open in IMG/M |
| 3300019708|Ga0194016_1000598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2992 | Open in IMG/M |
| 3300019708|Ga0194016_1035689 | All Organisms → Viruses → environmental samples → uncultured virus | 596 | Open in IMG/M |
| 3300019730|Ga0194001_1054430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 548 | Open in IMG/M |
| 3300019733|Ga0194013_1048812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300019937|Ga0194022_1052936 | Not Available | 531 | Open in IMG/M |
| 3300021356|Ga0213858_10059230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1859 | Open in IMG/M |
| 3300021368|Ga0213860_10336765 | Not Available | 657 | Open in IMG/M |
| 3300021389|Ga0213868_10034170 | Not Available | 3726 | Open in IMG/M |
| 3300021957|Ga0222717_10011979 | Not Available | 5995 | Open in IMG/M |
| 3300021958|Ga0222718_10011419 | Not Available | 6573 | Open in IMG/M |
| 3300021958|Ga0222718_10011792 | Not Available | 6437 | Open in IMG/M |
| 3300021958|Ga0222718_10017702 | Not Available | 5023 | Open in IMG/M |
| 3300021958|Ga0222718_10017877 | All Organisms → cellular organisms → Bacteria | 4996 | Open in IMG/M |
| 3300021958|Ga0222718_10020977 | Not Available | 4544 | Open in IMG/M |
| 3300021958|Ga0222718_10042778 | Not Available | 2933 | Open in IMG/M |
| 3300021958|Ga0222718_10049135 | Not Available | 2691 | Open in IMG/M |
| 3300021958|Ga0222718_10060406 | Not Available | 2361 | Open in IMG/M |
| 3300021958|Ga0222718_10528280 | All Organisms → Viruses → environmental samples → uncultured virus | 565 | Open in IMG/M |
| 3300021960|Ga0222715_10071459 | All Organisms → Viruses | 2318 | Open in IMG/M |
| 3300021962|Ga0222713_10027878 | All Organisms → Viruses | 4608 | Open in IMG/M |
| 3300021964|Ga0222719_10068826 | Not Available | 2654 | Open in IMG/M |
| 3300021964|Ga0222719_10097069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2158 | Open in IMG/M |
| 3300021964|Ga0222719_10188906 | All Organisms → Viruses | 1419 | Open in IMG/M |
| 3300022050|Ga0196883_1002954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1929 | Open in IMG/M |
| 3300022053|Ga0212030_1033232 | All Organisms → Viruses | 720 | Open in IMG/M |
| 3300022057|Ga0212025_1062670 | Not Available | 642 | Open in IMG/M |
| 3300022068|Ga0212021_1008226 | All Organisms → Viruses → environmental samples → uncultured virus | 1701 | Open in IMG/M |
| 3300022159|Ga0196893_1002537 | All Organisms → Viruses | 1474 | Open in IMG/M |
| 3300022168|Ga0212027_1027245 | Not Available | 764 | Open in IMG/M |
| 3300022183|Ga0196891_1003913 | Not Available | 3142 | Open in IMG/M |
| 3300022183|Ga0196891_1043917 | Not Available | 821 | Open in IMG/M |
| 3300022187|Ga0196899_1001557 | All Organisms → Viruses | 11204 | Open in IMG/M |
| 3300022198|Ga0196905_1032146 | Not Available | 1569 | Open in IMG/M |
| 3300022200|Ga0196901_1061891 | All Organisms → Viruses | 1372 | Open in IMG/M |
| 3300025543|Ga0208303_1001444 | All Organisms → Viruses | 9302 | Open in IMG/M |
| 3300025543|Ga0208303_1023124 | All Organisms → Viruses | 1737 | Open in IMG/M |
| 3300025610|Ga0208149_1001464 | Not Available | 8729 | Open in IMG/M |
| 3300025610|Ga0208149_1003176 | All Organisms → Viruses | 5659 | Open in IMG/M |
| 3300025610|Ga0208149_1003856 | Not Available | 5066 | Open in IMG/M |
| 3300025646|Ga0208161_1049230 | All Organisms → Viruses | 1358 | Open in IMG/M |
| 3300025647|Ga0208160_1008066 | All Organisms → Viruses | 3669 | Open in IMG/M |
| 3300025653|Ga0208428_1148308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 630 | Open in IMG/M |
| 3300025655|Ga0208795_1043083 | All Organisms → Viruses | 1366 | Open in IMG/M |
| 3300025655|Ga0208795_1084103 | Not Available | 877 | Open in IMG/M |
| 3300025671|Ga0208898_1009980 | All Organisms → Viruses | 4787 | Open in IMG/M |
| 3300025671|Ga0208898_1014441 | All Organisms → Viruses | 3753 | Open in IMG/M |
| 3300025671|Ga0208898_1017444 | All Organisms → Viruses | 3294 | Open in IMG/M |
| 3300025674|Ga0208162_1000111 | Not Available | 41550 | Open in IMG/M |
| 3300025695|Ga0209653_1018677 | All Organisms → Viruses | 3298 | Open in IMG/M |
| 3300025695|Ga0209653_1095374 | All Organisms → Viruses | 976 | Open in IMG/M |
| 3300025695|Ga0209653_1175567 | All Organisms → Viruses | 607 | Open in IMG/M |
| 3300025759|Ga0208899_1023602 | Not Available | 3018 | Open in IMG/M |
| 3300025759|Ga0208899_1026146 | All Organisms → Viruses | 2818 | Open in IMG/M |
| 3300025759|Ga0208899_1051406 | All Organisms → Viruses | 1761 | Open in IMG/M |
| 3300025769|Ga0208767_1035165 | All Organisms → Viruses | 2522 | Open in IMG/M |
| 3300025769|Ga0208767_1122393 | Not Available | 996 | Open in IMG/M |
| 3300025769|Ga0208767_1184295 | All Organisms → Viruses | 719 | Open in IMG/M |
| 3300025828|Ga0208547_1016904 | All Organisms → Viruses | 3043 | Open in IMG/M |
| 3300025853|Ga0208645_1061745 | All Organisms → Viruses | 1724 | Open in IMG/M |
| 3300025889|Ga0208644_1061864 | All Organisms → Viruses | 2009 | Open in IMG/M |
| 3300026125|Ga0209962_1033424 | Not Available | 898 | Open in IMG/M |
| 3300034374|Ga0348335_119952 | All Organisms → Viruses → environmental samples → uncultured virus | 781 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 38.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.28% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 11.63% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 6.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 5.43% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.10% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.10% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.33% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.33% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.33% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.55% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.78% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300005214 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300019733 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000406316 | 3300000116 | Marine | MIDKFMYTILGALDKFFDTFIPNIYERLKNNRIFSSKKRKRK* |
| DelMOWin2010_100378624 | 3300000117 | Marine | MFDNFMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRK* |
| DelMOWin2010_100443775 | 3300000117 | Marine | MIDKFMYTLFGAIDNLFDNIIPNQYERLKNNRIFSSKKRKRK* |
| JGI11705J14877_100242821 | 3300001419 | Saline Water And Sediment | MFDRIMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRX* |
| JGI11705J14877_101044044 | 3300001419 | Saline Water And Sediment | MIDRFMYALFGALDKFFDVIIPSIYERLKNNRIFFKRKRTKK* |
| JGI11705J14877_101650812 | 3300001419 | Saline Water And Sediment | MIDRFMYALFGALDKFFDVIIPSIYERLKNNRIFSSKKRKRK* |
| JGI11772J19994_10054952 | 3300001748 | Saline Water And Sediment | MIDKFMYAIFGAIDNFFDNIIPNKYERLKNNRIFSSKKRKRK* |
| JGI11772J19994_10177591 | 3300001748 | Saline Water And Sediment | MFDRFIYTIFGAIDNFFDTFIPNQYERLKNNRFFSSKKR |
| JGI11772J19994_10235463 | 3300001748 | Saline Water And Sediment | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTKK* |
| JGI11772J19994_10345523 | 3300001748 | Saline Water And Sediment | MIDKFMYTLFGAIDKFFDIFIPSIYERLKNNRIFFKRKRTKK* |
| JGI11772J19994_10412772 | 3300001748 | Saline Water And Sediment | MLDRFMYTIFGAIDNFFDTFIPNQYERLKNNRFFSSKKRKRK* |
| JGI26084J50262_10053098 | 3300003427 | Marine | MFDNFMYKILGAIDNFFIAIEEAYERLKNHRIFSSKKRKRK* |
| Ga0069002_100998544 | 3300005214 | Natural And Restored Wetlands | KVELLMDMFDKVMYTILGKLDKLFEVIIPSIYERLKNNRIFSSKKRKRK* |
| Ga0074648_10200842 | 3300005512 | Saline Water And Sediment | MFDRIMYKILGAIDDFFIAIEEAYERLKNNRIFSSKKRKRK* |
| Ga0074648_10306785 | 3300005512 | Saline Water And Sediment | MFDRFMYTILGAIDKFFDTFIPSVYERLKNNRIFSSKKRKRK* |
| Ga0074648_10394894 | 3300005512 | Saline Water And Sediment | MIDKFMYAIFGAIDNFFDNIIPNQYERLKNNRIFSSKKRKRK* |
| Ga0074648_11024561 | 3300005512 | Saline Water And Sediment | ELLMIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSKRKRTKK* |
| Ga0074647_10052267 | 3300005611 | Saline Water And Sediment | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSKRKRTKK* |
| Ga0074649_10064402 | 3300005613 | Saline Water And Sediment | MFDRIMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRK* |
| Ga0074649_10166362 | 3300005613 | Saline Water And Sediment | MIDKFMYALFGALDKFFDVIIPSIYERLKNNRIFSKRKRSKK* |
| Ga0074649_10244118 | 3300005613 | Saline Water And Sediment | MIDKFMYALFGALDNFFDNIIPNQYERLKNNRIFSSKKRKRK* |
| Ga0074649_11315421 | 3300005613 | Saline Water And Sediment | ALFGALDKFFDVIIPSIYERLKNNRIFFKRKRTKK* |
| Ga0075474_100061635 | 3300006025 | Aqueous | MIDKFMYTLFGALDKFFDVIIPSIYERLKNNRIFSSKKRKRK* |
| Ga0075474_100241757 | 3300006025 | Aqueous | MIDKFMYTILGALDKFFDTFIPSIYERLKNNRFFSSKKRKRK* |
| Ga0075474_102023723 | 3300006025 | Aqueous | MFDKIMYKILGAIDDFFIAIEEAYERLKNHRIFSSKKRKRK* |
| Ga0075462_100664911 | 3300006027 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFFKRKR |
| Ga0075466_10136082 | 3300006029 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNAYERLKNNRIFSSKKRKRK* |
| Ga0098073_10238764 | 3300006734 | Marine | FDNFMYKILGAIDNFFIAIKEAYERLKNNRIFSSKKRKRK* |
| Ga0070754_104013873 | 3300006810 | Aqueous | MFDRFMYTIFGAIDNFFDTFIPSIYERLKNNRIFSSK |
| Ga0075477_103340134 | 3300006869 | Aqueous | IDKFMYTLFGAIDNLFDNIIPNQYERLKNNRIFFKQKRKRK* |
| Ga0070750_104582161 | 3300006916 | Aqueous | MIDKFMYTLFGAIDNLFDNIIPNQYERLKNNRIFFKQKRKRK* |
| Ga0070746_105493353 | 3300006919 | Aqueous | MYTLFGAIDNLFDNIIPNQYERLKNNRIFFKQKRKRK* |
| Ga0070748_13451011 | 3300006920 | Aqueous | MIDKFMYTILGALDKFFDTFIPNNYERIKNNRIFSSKKRKRK* |
| Ga0070747_11435701 | 3300007276 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNAYERLKNNRIFS |
| Ga0099849_11320093 | 3300007539 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNIYERLKNNRIFSS |
| Ga0099849_13675272 | 3300007539 | Aqueous | MFDRFMYSILGKLDFLFDNIIPNAYERLKNNRIFSSKKRK |
| Ga0099846_12070381 | 3300007542 | Aqueous | MVDRFMYALCGTIDKFFDTFIPNIYERLKNNRIFSK |
| Ga0099846_12629163 | 3300007542 | Aqueous | MIDRFMYALCGTIDKFFDTFIPNIYERLKNNRIFSKRKRTK |
| Ga0102951_11133082 | 3300007725 | Water | MIDKFMYALFGALDNFFDNIIPNQYERLKNNRFFSSKKRK |
| Ga0102950_12667133 | 3300007764 | Soil | MFDRFMYTIFGAIDNFFDTFIPSIYERLKNNRFFS |
| Ga0129342_12422913 | 3300010299 | Freshwater To Marine Saline Gradient | MFDNFMYKILGAIDNFFIAIKEAYERLKNNRIFSSKKRKRK* |
| Ga0129324_103939872 | 3300010368 | Freshwater To Marine Saline Gradient | MFDKIMYKILGAIDDFFIAIEEAYERLKNNRIFSSKKRKRK* |
| Ga0136549_103206272 | 3300010389 | Marine Methane Seep Sediment | MIDKFMYALFGALDNFFDNIIPNQYERLKNNRIFSSKKRKR |
| Ga0181552_100291545 | 3300017824 | Salt Marsh | MFDNFMYKILGAIDDFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0181584_100747385 | 3300017949 | Salt Marsh | MIDKFMYTILGALDKFFDTFIPNIYERLKNNRIFSSKKRKRK |
| Ga0181584_101353956 | 3300017949 | Salt Marsh | MFDNFMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0181607_100863906 | 3300017950 | Salt Marsh | FMYKILGAIDDFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0181607_101009625 | 3300017950 | Salt Marsh | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0181607_106925753 | 3300017950 | Salt Marsh | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSKRKRSKK |
| Ga0181580_107853442 | 3300017956 | Salt Marsh | MFDNFMYKILGAIDDFFIAIEEAYERFKNNRIFSSKKRKRK |
| Ga0180437_101422543 | 3300017963 | Hypersaline Lake Sediment | MFDKIMYKILGAIDDFFIAIEEAYERLKNHRIFSSKKRKRK |
| Ga0181589_101971082 | 3300017964 | Salt Marsh | MIDKFMYTFFGAIDKFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0181589_102531725 | 3300017964 | Salt Marsh | LMFDNFMYKILGAIDNFFIAIEEAYERFKNNRIFSSKKRKRK |
| Ga0181590_103489253 | 3300017967 | Salt Marsh | MIDKFMYTLFGAIDKFFDTFIPNIYERLKNNRIFFKRKRTKK |
| Ga0181587_106458272 | 3300017968 | Salt Marsh | MIDKFMYTLFGAIDKFFDIVIPNQYERLKNNRIFSSKKRKRK |
| Ga0180432_100726921 | 3300017989 | Hypersaline Lake Sediment | MIDKFMYAIFGAIDNFFDNIIPNHYERLKNNRIFSSKKRKRK |
| Ga0181601_101166166 | 3300018041 | Salt Marsh | MFDNFMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKR |
| Ga0181601_103222074 | 3300018041 | Salt Marsh | MIDKFMYTLFGAIDKFFDTFIPNAYERLKNNRIFSKRKRSKK |
| Ga0180433_106988374 | 3300018080 | Hypersaline Lake Sediment | FMYTILGAIDKFFDTFIPSVYERLKNNRIFSSKKRKRK |
| Ga0181553_100088702 | 3300018416 | Salt Marsh | MFDKFMYSFFGAIDKFFDTFIPNQYERLKNNRIFSSKKRKRK |
| Ga0181553_101288065 | 3300018416 | Salt Marsh | MFDRFMYTFFGAIDKFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0181558_100684177 | 3300018417 | Salt Marsh | MIDKFMYTILGALDKFFDTFIPNQYERLKNNRIFSSKKRKRK |
| Ga0181563_107236332 | 3300018420 | Salt Marsh | MFDNFMYKILGAIDDFFIAIEEAYERLKNNRIFSKRKRSKK |
| Ga0181591_103516081 | 3300018424 | Salt Marsh | KVELLMIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0181562_100120966 | 3300019459 | Salt Marsh | MFDNFMYKILGAIDDFFIAIEEAYERLKNIRIFSSKKRKRK |
| Ga0181562_100998241 | 3300019459 | Salt Marsh | IIKKVELLMIDKFMYTLFGAIDKFFDTIIPNQYERLKNNRIFSSKKRKRK |
| Ga0181562_101881126 | 3300019459 | Salt Marsh | MFDNFMYKILGAIDNFFIAIEEAYERLKNNRIFSSKK |
| Ga0194016_10005987 | 3300019708 | Sediment | MFDNFMYKILGAIDSFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0194016_10356893 | 3300019708 | Sediment | MFDNFMYKILGAIDDFFIAIEEAYERLKNNRIFSSK |
| Ga0194001_10544302 | 3300019730 | Sediment | MFDNFMYKILGAIDNFFIAIEETYERLKNNRIFSSKKRKRK |
| Ga0194013_10488123 | 3300019733 | Sediment | MFDRFMYSILGKLDFLFDNIIPNAYERLKNNRIFSSKKRKRK |
| Ga0194022_10529361 | 3300019937 | Freshwater | IIKKVELLMIDKFMYTILGALDKFFDTIIPNQYERLKNNRIFSSKKRKRK |
| Ga0213858_100592305 | 3300021356 | Seawater | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0213860_103367651 | 3300021368 | Seawater | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTK |
| Ga0213868_100341704 | 3300021389 | Seawater | MFDNFMYKILGAIDNFFIAIEEAYERLKKNRIFSSKKRKRK |
| Ga0222717_100119795 | 3300021957 | Estuarine Water | MIDKFMYTILGTIDKFFDIFIPNIYERLKNNRIFSSKKRKRK |
| Ga0222718_1001141913 | 3300021958 | Estuarine Water | MFDRFMYTFFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0222718_100117923 | 3300021958 | Estuarine Water | MFDKFMYSFFGAIDNFFDTFIPNQYERLKNNRIFSSKKRKRK |
| Ga0222718_100177026 | 3300021958 | Estuarine Water | MIDRFMYALFGALDNFFDIFIPSIYARLKNNRIFSSKKRKRK |
| Ga0222718_1001787710 | 3300021958 | Estuarine Water | MIDRFMYTILGALDNFFDIFIPSIYARLKNNRIFSKRKRTKK |
| Ga0222718_100209774 | 3300021958 | Estuarine Water | MDMFDKIMYTILGKLDNLFEVIIPNIYERLKNNRIFSSKKRKRK |
| Ga0222718_100427783 | 3300021958 | Estuarine Water | MIDRFMYALFGALDNFFDNIIPNQYERLKNNRIFSSKKRKRK |
| Ga0222718_100491358 | 3300021958 | Estuarine Water | MFDRFMYTIFGAIDNFFDTFIPNQYERLKNNRFFSSKKRKRK |
| Ga0222718_100604068 | 3300021958 | Estuarine Water | MFDRFMYTILGAIDKFFDTFIPSIYERLKNNRIFSSKKRKRK |
| Ga0222718_105282802 | 3300021958 | Estuarine Water | MFDNFMYKILGAIDDFFIAIEEAYERLKNHRIFSSKKRKRK |
| Ga0222715_100714598 | 3300021960 | Estuarine Water | MIDRFMYALFGALDNFFDTFIPNQYERLKNNRIFFKRKRTKK |
| Ga0222713_100278781 | 3300021962 | Estuarine Water | MIDKFMYTILGTIDKFFDIFIPNIYERLKNNRIFSSKKRK |
| Ga0222719_100688269 | 3300021964 | Estuarine Water | MFDRFMYAILGTIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0222719_100970692 | 3300021964 | Estuarine Water | MFDRFMYTIFGAIDKFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0222719_101889062 | 3300021964 | Estuarine Water | MIDRFMYALFGALDNFFDTFIPSQYERLKNNRFFSSKKRKRK |
| Ga0196883_10029543 | 3300022050 | Aqueous | MIDKFMYTLFGALDNFFDTFIPSIYERLKNNRIFSKRKRTKK |
| Ga0212030_10332323 | 3300022053 | Aqueous | MIDKFMYTILGALDKFFDTFIPNIYERHKNNRIFSSKKRK |
| Ga0212025_10626702 | 3300022057 | Aqueous | MIDKFMYTLFGALDNFFDTFIPSIYERLKNNRIFSKR |
| Ga0212021_10082261 | 3300022068 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRT |
| Ga0196893_10025371 | 3300022159 | Aqueous | IIKKVELLMFDNFMYKILGAIDDFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0212027_10272452 | 3300022168 | Aqueous | MIDKFMYTLFGAIDKFFDTIIPNQYERLKNNRIFSSKKRKRK |
| Ga0196891_10039135 | 3300022183 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRFFSSKKRKRK |
| Ga0196891_10439174 | 3300022183 | Aqueous | YKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0196899_10015577 | 3300022187 | Aqueous | MIDKFMYTLFGALDKFFDVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0196905_10321462 | 3300022198 | Aqueous | MFDNFMYKILGAIDNFFIAIKEAYERLKNNRIFSSKKRKRK |
| Ga0196901_10618915 | 3300022200 | Aqueous | IDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFFKRKRTKK |
| Ga0208303_100144412 | 3300025543 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFFKRKRTKK |
| Ga0208303_10231241 | 3300025543 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSSKKR |
| Ga0208149_10014645 | 3300025610 | Aqueous | MIDKFMYTIFGAIDNFFDTFIPSIYERLKNNRIFSSKKRKRK |
| Ga0208149_100317611 | 3300025610 | Aqueous | MIDKFMYTILGALDKFFDTIIPNQYERLKNNRIFSSKKRKRK |
| Ga0208149_100385612 | 3300025610 | Aqueous | MIDKFMYTLFGAIDNLFDNIIPNQYERLKNNRIFSSKKRKRK |
| Ga0208161_10492306 | 3300025646 | Aqueous | MFDRFMYSVLGKLDFLFDNIIPNAYERLKNNRFFSSKKRKRK |
| Ga0208160_10080665 | 3300025647 | Aqueous | MVDRFMYALCGTIDKFFDTFIPNIYERLKNNRIFSKRKRTKK |
| Ga0208428_11483081 | 3300025653 | Aqueous | KKVELLMIDKFMYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0208795_10430832 | 3300025655 | Aqueous | MIDKFMYALCGTIDKFFDTFIPNAYERLKNNRIFFKRKRTKK |
| Ga0208795_10841031 | 3300025655 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPSIHERLKNNRFFSSKKRKR |
| Ga0208898_100998010 | 3300025671 | Aqueous | MIDKFMYTILGALDKFFDTFIPSIYERLKNNRFFSSKKRKRK |
| Ga0208898_10144419 | 3300025671 | Aqueous | MIDKFIYTLFGAIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0208898_10174447 | 3300025671 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFFKRKRSKK |
| Ga0208162_10001111 | 3300025674 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSSKKEKE |
| Ga0209653_10186775 | 3300025695 | Marine | MFDNFMYKILGAIDNFFIAIEEAYERLKNHRIFSSKKRKRK |
| Ga0209653_10953741 | 3300025695 | Marine | MIDRFMYALFGALDKFFDVIIPSIYERLKNNRIFSSKKRKRK |
| Ga0209653_11755673 | 3300025695 | Marine | MIDKFMYTLFGAIDKFFDTIIPNQYERLKNNRIFSSKKRK |
| Ga0208899_10236029 | 3300025759 | Aqueous | MFDRFMYTILGAIDKFFDTFIPSVYERLKNNRIFSSKKRKRK |
| Ga0208899_10261465 | 3300025759 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFSSKKRKRK |
| Ga0208899_10514063 | 3300025759 | Aqueous | MIDKFMYTLFGTIDKFFDTFIPSIYERLKNNRIFFKRKRTKK |
| Ga0208767_10351655 | 3300025769 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNQYERLKNNRIFFKKKRKRK |
| Ga0208767_11223935 | 3300025769 | Aqueous | MIDRFMYALCGTIDKFFDTFIPNIYERLKNNRIFSSKKRKRK |
| Ga0208767_11842953 | 3300025769 | Aqueous | MIDKFMYTLFGAIDKFFDTFIPNAYERLKNNRIFSSKKRKRK |
| Ga0208547_10169042 | 3300025828 | Aqueous | MIDKFMYTIFGAIDNFFDNIIPNHYERLKNNRIFSSKKRKRK |
| Ga0208645_10617455 | 3300025853 | Aqueous | MIDRFMYTIFGAIDNLFDNIIPNAYERLKNNRIFSSKKRKRK |
| Ga0208644_10618642 | 3300025889 | Aqueous | MIDKFMYTILGTLDNFFDTFIPSIYERLKNNRIFFKRKRSKK |
| Ga0209962_10334241 | 3300026125 | Water | EVELLMFDNFMYKILGAIDNFFIAIEEAYERLKNNRIFSSKKRKRK |
| Ga0348335_119952_659_781 | 3300034374 | Aqueous | MIDKFMYTLFGALDNFFDTFIPSIYERLKNNRIFFKRKRTK |
| ⦗Top⦘ |