


| Basic Information | |
|---|---|
| Family ID | F064169 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALENILSRAA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.36 % |
| % of genes near scaffold ends (potentially truncated) | 95.35 % |
| % of genes from short scaffolds (< 2000 bps) | 98.45 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.674 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.178 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.434 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF12732 | YtxH | 93.80 |
| PF03631 | Virul_fac_BrkB | 3.88 |
| PF07394 | DUF1501 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 3.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.67 % |
| Unclassified | root | N/A | 2.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y01BBCQW | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300001305|C688J14111_10219467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300003308|Ga0006777J48905_1031429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300003308|Ga0006777J48905_1043203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300003570|Ga0007418J51697_1035271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300003571|Ga0007419J51692_1039169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300003577|Ga0007416J51690_1054238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300003579|Ga0007429J51699_1030455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300003579|Ga0007429J51699_1031684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300003579|Ga0007429J51699_1055356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300003735|Ga0006780_1048584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300004081|Ga0063454_101610668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300004643|Ga0062591_102263197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300004801|Ga0058860_11887411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300004803|Ga0058862_12418073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300005093|Ga0062594_102330186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300005336|Ga0070680_100798466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300005354|Ga0070675_101831813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300005365|Ga0070688_100821309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300005367|Ga0070667_101641407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005457|Ga0070662_101584413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005459|Ga0068867_101538141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005543|Ga0070672_101084850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300005564|Ga0070664_100242224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300005764|Ga0066903_104730236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300006163|Ga0070715_10112729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300006969|Ga0075419_10318164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300009012|Ga0066710_101493286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300009156|Ga0111538_11876765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300009649|Ga0105855_1138704 | Not Available | 701 | Open in IMG/M |
| 3300010109|Ga0127497_1015539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300010112|Ga0127458_1019339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300010132|Ga0127455_1163361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010145|Ga0126321_1248962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010146|Ga0126320_1318110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300010147|Ga0126319_1019569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010147|Ga0126319_1320144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300010147|Ga0126319_1564327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010152|Ga0126318_10059724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300010400|Ga0134122_10943329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300010401|Ga0134121_12860350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010870|Ga0102750_10014553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300011270|Ga0137391_11481400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300011332|Ga0126317_10678544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300012212|Ga0150985_100812608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012212|Ga0150985_102881447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300012212|Ga0150985_103616339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012212|Ga0150985_104280323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012212|Ga0150985_105250647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300012212|Ga0150985_106290463 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300012212|Ga0150985_107015181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300012386|Ga0134046_1156981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300012396|Ga0134057_1202411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012398|Ga0134051_1283364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012469|Ga0150984_105382281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012469|Ga0150984_109587325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300012469|Ga0150984_120660849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012898|Ga0157293_10318381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012907|Ga0157283_10341039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012911|Ga0157301_10356942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300012948|Ga0126375_11963076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012971|Ga0126369_12468731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300014487|Ga0182000_10465701 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300015372|Ga0132256_102478514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300015373|Ga0132257_102921607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300015374|Ga0132255_104940042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300018067|Ga0184611_1329641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300018081|Ga0184625_10185912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300019233|Ga0184645_1227339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300019233|Ga0184645_1270161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300019248|Ga0180117_1258715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300019255|Ga0184643_1302120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300019259|Ga0184646_1192281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300019259|Ga0184646_1600590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300019263|Ga0184647_1169258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300019269|Ga0184644_1567560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300019279|Ga0184642_1562602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300020063|Ga0180118_1014994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300020066|Ga0180108_1179958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300020069|Ga0197907_10678009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300020070|Ga0206356_11394221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300020078|Ga0206352_10151558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300020078|Ga0206352_11318445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300020082|Ga0206353_10323151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021082|Ga0210380_10426386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300022530|Ga0242658_1214515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300024177|Ga0247686_1041774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300025908|Ga0207643_10335298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300025921|Ga0207652_10727974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300025927|Ga0207687_11917933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300025930|Ga0207701_10194618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1784 | Open in IMG/M |
| 3300025934|Ga0207686_10393734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300026089|Ga0207648_11560925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300026319|Ga0209647_1230701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300028554|Ga0302047_10113736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300030784|Ga0102758_10961683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300030785|Ga0102757_11182892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300030785|Ga0102757_11346417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300030858|Ga0102759_1727710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300030858|Ga0102759_1911967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300030858|Ga0102759_1953335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300030903|Ga0308206_1110141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300030905|Ga0308200_1059866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300030936|Ga0138306_1657547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300030993|Ga0308190_1083024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300030998|Ga0073996_12142100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031039|Ga0102760_10642399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300031039|Ga0102760_10919774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031058|Ga0308189_10099252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300031058|Ga0308189_10274097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300031058|Ga0308189_10430267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031089|Ga0102748_11533223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031091|Ga0308201_10083439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300031091|Ga0308201_10162290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031092|Ga0308204_10173892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031093|Ga0308197_10125545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300031096|Ga0308193_1061012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031114|Ga0308187_10387688 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 548 | Open in IMG/M |
| 3300031114|Ga0308187_10461888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031538|Ga0310888_10134443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300031538|Ga0310888_11037500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031731|Ga0307405_10702038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300031854|Ga0310904_10348070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300032001|Ga0306922_11205870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300032205|Ga0307472_102644153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300032211|Ga0310896_10600580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300034660|Ga0314781_118477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.40% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 10.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 9.30% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 5.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003570 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003571 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028554 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9) | Environmental | Open in IMG/M |
| 3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030858 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030936 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_02523570 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | TNRVDSAIRTTMARVDDTADRVRSNVRAKTSLVVGFVRGVRVALDTMLKSAA |
| C688J14111_102194671 | 3300001305 | Soil | RIDDTADRVRTNVRAKTSALVGFLRGARLTIEALLRSEART* |
| Ga0006777J48905_10314291 | 3300003308 | Avena Fatua Rhizosphere | YAIRSTMDRVDDTADRVRSNVRAKTSRIVGFVRGARAALETMLSRAA* |
| Ga0006777J48905_10432031 | 3300003308 | Avena Fatua Rhizosphere | TIDRVDDTADRVRSNVLAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0007418J51697_10352711 | 3300003570 | Avena Fatua Rhizosphere | TMDRVDDTADRVRSNVRAKTSRIVGFVRGARAALETMLSRAA* |
| Ga0007419J51692_10391691 | 3300003571 | Avena Fatua Rhizosphere | AIKTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSSAA* |
| Ga0007416J51690_10542381 | 3300003577 | Avena Fatua Rhizosphere | DETERVDSAIRTTIDRVDDTADRVRSNVLAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0007429J51699_10304551 | 3300003579 | Avena Fatua Rhizosphere | AERVDTAIKTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSSAA* |
| Ga0007429J51699_10316841 | 3300003579 | Avena Fatua Rhizosphere | KVASAKVKDETERVDSAIRTTIDRVDDTADRVRSNVLAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0007429J51699_10553561 | 3300003579 | Avena Fatua Rhizosphere | AIRTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0006780_10485841 | 3300003735 | Avena Fatua Rhizosphere | QAIRTTMDRVDDTADRVRSNVRVKTSRIVGLMRGVRVALESMLNSRAA* |
| Ga0063454_1016106682 | 3300004081 | Soil | DDTADRVRSNVRAKTSRIVGFVRGLRVALEGMLHSEART* |
| Ga0062591_1022631972 | 3300004643 | Soil | RVDDTAERVRTNVRLRTSRIVGIVRGARVALEHILSSAA* |
| Ga0058860_118874112 | 3300004801 | Host-Associated | IRSTMNRVDDTADRVKTNVRARTSRIVGFVRGARVALETILSRAA* |
| Ga0058862_124180731 | 3300004803 | Host-Associated | RVDDTADRVRSNVRAKTSRIIGIVRGAKVALEHILSRAA* |
| Ga0062594_1023301861 | 3300005093 | Soil | HTTIDRVDDTVDRMRWNVRAKTSRIVGMVRGARLAIESMLHRAA* |
| Ga0070680_1007984661 | 3300005336 | Corn Rhizosphere | ALRSTIHRVDDTAGRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0070675_1018318131 | 3300005354 | Miscanthus Rhizosphere | RVDDTADRMRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0070688_1008213092 | 3300005365 | Switchgrass Rhizosphere | DETDRVDTAIRTTMDVVDDTTERVRTNVRAQTSRIVGIIRGARVALEHILSRAA* |
| Ga0070667_1016414072 | 3300005367 | Switchgrass Rhizosphere | ERVDDTAERVRTNVRLRTSRIVGIVRGARVALEHILSSAA* |
| Ga0070662_1015844132 | 3300005457 | Corn Rhizosphere | RVDYALRSTIHRVDDTAGRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0068867_1015381412 | 3300005459 | Miscanthus Rhizosphere | SAIRTTMDRVDDTAERVRWNVLAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0070672_1010848502 | 3300005543 | Miscanthus Rhizosphere | VDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSSAA* |
| Ga0070664_1002422244 | 3300005564 | Corn Rhizosphere | TAIRTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0066903_1047302361 | 3300005764 | Tropical Forest Soil | RIDDTADRVRTNVRVKTSRIVGFIRGLRVALEGMLQTEART* |
| Ga0070715_101127291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YAIRSTMNRVDDTADRVRTNVRARTSRIVGFVRGARVALETMLSRAA* |
| Ga0075419_103181644 | 3300006969 | Populus Rhizosphere | LRSTIHRVDDTAGRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0066710_1014932861 | 3300009012 | Grasslands Soil | VDDTADRVRSNVREKTSRVIGFVRGLRVAMESMLHSRAA |
| Ga0111538_118767652 | 3300009156 | Populus Rhizosphere | TINRVDDTAYRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0105855_11387042 | 3300009649 | Permafrost Soil | DRIDDTAVRVRSNVRARTSHLVGLLRGMRAVLEGMLRT* |
| Ga0127497_10155391 | 3300010109 | Grasslands Soil | VDQAIHRTIDRVDDTADRVRSNVRAKTSRVVGFVRGLRVAMEAMLQSRAA* |
| Ga0127458_10193391 | 3300010112 | Grasslands Soil | QAIHRTIDRVDDTADRVRSNVRAKTSRVVGFVRGLRVAMEAMLQSRAA* |
| Ga0127455_11633611 | 3300010132 | Grasslands Soil | RVDDTADRVRSNVRAKTSRVVGFVRGLRVAMEAMLQSRAA* |
| Ga0126321_12489621 | 3300010145 | Soil | RTIDRVDDTADRVRTNVRAKTSRVVGFVRGLRVAMESMLHSRAA* |
| Ga0126320_13181101 | 3300010146 | Soil | DTADRVRTNVRVKTSRVVGIVRGLRVALETMMQKRAA* |
| Ga0126319_10195692 | 3300010147 | Soil | VDDTADRVRANVRAKTSRIVGIVRGARVAIESMLSRAA* |
| Ga0126319_13201442 | 3300010147 | Soil | VDDTAERVRWNVLVKTSRIIGIVRGARVALEHILSRAA* |
| Ga0126319_15643271 | 3300010147 | Soil | TIHRVDDTAGRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0126318_100597243 | 3300010152 | Soil | DDTADRVRSNVRAKTSRLVGIVRGARVAIEHILSRAA* |
| Ga0134122_109433293 | 3300010400 | Terrestrial Soil | LRSTINRVDNTADRVRSNVRAKTSRVVGFVRGVRVAIETMLRPAA* |
| Ga0134121_128603501 | 3300010401 | Terrestrial Soil | TADRVRTNVRAKTSRIVGFVRGARVALETMLSRAA* |
| Ga0102750_100145532 | 3300010870 | Soil | AERVDQAIRTTIDRVDDTADRVRTNVRAKTSRIVGVMRGVRVALESMLHTRAA* |
| Ga0137391_114814001 | 3300011270 | Vadose Zone Soil | VHEETVRLDDAIRSTINRVDHTAERVRRNVLAKTSRIVGFVRGARTVIEMILNSRAA* |
| Ga0126317_106785441 | 3300011332 | Soil | TIDRIDNTADRVRSNVRAKTSALVGFIRGLRVALEGVLHREART* |
| Ga0150985_1008126082 | 3300012212 | Avena Fatua Rhizosphere | MGRIDDTADRVRSNVRAKTSRIVGLVRGLRVALEGMLHSEART* |
| Ga0150985_1028814473 | 3300012212 | Avena Fatua Rhizosphere | VDDTAGRVRSNVRAKTSKVVGIVRGLRVALETMMQSRAA* |
| Ga0150985_1036163392 | 3300012212 | Avena Fatua Rhizosphere | DAIHRTMDRVDDTADRVRYTVRAKTSRIVGFVRGARMAIETMLRSRAA* |
| Ga0150985_1042803232 | 3300012212 | Avena Fatua Rhizosphere | KTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVAIEHILSRAA* |
| Ga0150985_1052506471 | 3300012212 | Avena Fatua Rhizosphere | KSETVRVDQAILSTMGRVDDTVDRVKSNVRAKTSRIVGLVRGARVALEAMLQSRAA* |
| Ga0150985_1062904633 | 3300012212 | Avena Fatua Rhizosphere | DLAIRTTMDRVDDTADRVRSNVRAKTSRIVGFVRGARMAIETILSNSRAA* |
| Ga0150985_1070151811 | 3300012212 | Avena Fatua Rhizosphere | TAIKTTMDRVDDTADRVRSNVRAKTSRIVGIVRGVRVALEHILSNAA* |
| Ga0134046_11569812 | 3300012386 | Grasslands Soil | IHRTMDRVDDTADRVRSNVRAKTSRVVGFVRGLRVVMESILHSRAA* |
| Ga0134057_12024112 | 3300012396 | Grasslands Soil | VDDAIHRTMDRVDDTADRVRSNVRAKTSRVVGMVRGLRVALETIMQTRPA* |
| Ga0134051_12833642 | 3300012398 | Grasslands Soil | VDDTADRVRSNVRAKTSKMVGMVRGLRVALETMMQSRAA* |
| Ga0150984_1053822812 | 3300012469 | Avena Fatua Rhizosphere | VDDTAERVRGNVRDKTNRIIGLVRGVRVAVESILQSRAA* |
| Ga0150984_1095873253 | 3300012469 | Avena Fatua Rhizosphere | VDDTADRVRSNVRVKTSRIVGLMRGVRVALESMLNSRAA* |
| Ga0150984_1206608492 | 3300012469 | Avena Fatua Rhizosphere | VDDTVDRVKSNVRARTSRIVGLVRGARVALEAMLQSRAA* |
| Ga0157293_103183812 | 3300012898 | Soil | VDDTAERVRWNVLAKTSRIVGIVRGARVALEHILSRAA* |
| Ga0157283_103410392 | 3300012907 | Soil | IHRTIDRVDDTADRVRSNVRAKTSRIIGFVRGARTAIETILTHSRAA* |
| Ga0157301_103569421 | 3300012911 | Soil | RVDDTVDRMRWNMRAKTSRIVGIVRGARVAIESMLSRAA* |
| Ga0126375_119630762 | 3300012948 | Tropical Forest Soil | MGRIDDTADRVRTNVRVKTSRIIGFIRGLRVALEGMLQSEART* |
| Ga0126369_124687312 | 3300012971 | Tropical Forest Soil | DQAIRSTMDRVDESADRLRSNVRARTSRLVGLVRGARVAIETMLSNSRAA* |
| Ga0182000_104657012 | 3300014487 | Soil | MGRIDDTADRVRSNVRAKTSRIVGFVRGLRVALEGMLHSEART* |
| Ga0132256_1024785141 | 3300015372 | Arabidopsis Rhizosphere | TTMDKVDDTAERVRSNVRAKTSRIIGIVRGARVALEHILSRAA* |
| Ga0132257_1029216072 | 3300015373 | Arabidopsis Rhizosphere | VDTAIRTTMERVDDTAERVRTNVRLRTSRIVGIVRGARVALEHILSSAA* |
| Ga0132255_1049400422 | 3300015374 | Arabidopsis Rhizosphere | RTTIHRVDDTADRVRSNVRAKTSRVVGFVRGLRVAIESMLHSSEART* |
| Ga0184611_13296411 | 3300018067 | Groundwater Sediment | TTIDRVDDTVDRMRWNVRAKTSRIVGMVRGARLAIESMLHRAA |
| Ga0184625_101859124 | 3300018081 | Groundwater Sediment | ERVDHAIHTTIDRVDDTVDRMRWNVRAKTSRIVGMVRGARLAIESMLHRAA |
| Ga0184645_12273391 | 3300019233 | Groundwater Sediment | RTIDRVDDTADRVRSNVRAKTSRVVGFVRGLRVAIEGLLPVRN |
| Ga0184645_12701612 | 3300019233 | Groundwater Sediment | IDRVDDTADRVRSNVRAKTSKVVGLVRGLRVALETIMQSRAA |
| Ga0180117_12587151 | 3300019248 | Groundwater Sediment | HAIHTTIDRVDDTVDRMRWNVRAKTSRLVGMVRGARHAIESMLHRAA |
| Ga0184643_13021202 | 3300019255 | Groundwater Sediment | AIHRTIDRVDDTADRVRSNVRAKTSKVVGLVRGLRVALETIMQSRAA |
| Ga0184646_11922811 | 3300019259 | Groundwater Sediment | TADRVRSNVRAKTSWVVGFIRGVRVAVESMLRTPEATEGRS |
| Ga0184646_16005902 | 3300019259 | Groundwater Sediment | DQAIRTTIDRVDDTADRVRSNVRAKTSRIVGLVRGARVAIETILNSRAA |
| Ga0184647_11692582 | 3300019263 | Groundwater Sediment | DTADRVRSNVRAKTSRIVGIVRGARVALEHILSRAA |
| Ga0184644_15675601 | 3300019269 | Groundwater Sediment | IDDTADRVRSNVRAKTSRLVGLIRGARMAIETALRTEVRT |
| Ga0184642_15626022 | 3300019279 | Groundwater Sediment | VDDTADRVRSNVRAKTSRVVGFVRGLRVAIEGLLPVRN |
| Ga0180118_10149943 | 3300020063 | Groundwater Sediment | DRVDDTVDRVRWNVRAKTSRLIGIVRGARLAIETILSRAA |
| Ga0180108_11799582 | 3300020066 | Groundwater Sediment | AETERVDHAIHTTIDRVDDTVDRMRWNVRAKTSRFVGMVRGARLAIETILSRAA |
| Ga0197907_106780093 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | DRVDDTADRVRSNVRAKTSRLVGIVRGARVAIEHILSRAA |
| Ga0206356_113942211 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | TMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALENILSRAA |
| Ga0206352_101515581 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | TMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSSAA |
| Ga0206352_113184452 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | RIDDTADRVRSNVRAKTSRVVGFVRGLRVALEGMLHSEART |
| Ga0206353_103231511 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVDDTAERVRTNVRLRTSRIVGIVRGARVALEHILSSAA |
| Ga0210380_104263861 | 3300021082 | Groundwater Sediment | IDRVDDTVDRMRWNVRAKTSRIVGMVRGARLAIESMLHRAA |
| Ga0242658_12145151 | 3300022530 | Soil | MDRVDDTADRVRSNVRVKTSRIVGLMRGVRVALESMLNSRAA |
| Ga0247686_10417741 | 3300024177 | Soil | DDTADRVRSNVRAKTSRIVGFVRGLRVALEGMLHSEART |
| Ga0207643_103352981 | 3300025908 | Miscanthus Rhizosphere | RTTMDRVDDTAERVRWNVLAKTSRIVGIVRGARVALEHILSRAA |
| Ga0207652_107279744 | 3300025921 | Corn Rhizosphere | RIDDTADRVRSNVRAKTSSIAAFVRGARAAVEGMLHRSEVRT |
| Ga0207687_119179332 | 3300025927 | Miscanthus Rhizosphere | RVDDTAERVRWNVLAKTSRIVGIVRGARVALEHILSRAA |
| Ga0207701_101946181 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AIRTTMERVDDTAERVRTNVRLRTSRIVGIVRGARVALEHILSSAA |
| Ga0207686_103937343 | 3300025934 | Miscanthus Rhizosphere | TADRVRSNVRMKTSRIVGFVRGVRVALEGFLHTRQAA |
| Ga0207648_115609251 | 3300026089 | Miscanthus Rhizosphere | SAIRTTMDRVDDTAERVRWNVLAKTSRIVGIVRGARVALEHILSRAA |
| Ga0209647_12307011 | 3300026319 | Grasslands Soil | TADRVRSNVRARTSRIVGFVRGVRVAIESMLTTSELRT |
| Ga0302047_101137362 | 3300028554 | Soil | AERVDQAIRTTIDRVDDTADRVRTNVRAKTSRIVGVMRGVRVALESMLHTRAA |
| Ga0102758_109616831 | 3300030784 | Soil | FVDDTADRVRTNVRAKTSRLVGLMRGVRVAVESMLGSQA |
| Ga0102757_100450053 | 3300030785 | Soil | ALRTTMDRVDDTADRVRSNVKAQTGRLVGILRGARVAIETMLGARAM |
| Ga0102757_111828922 | 3300030785 | Soil | MDRVDDTADRVRSNVRAKTSRLVGLMRGVRVAVESMLGSQA |
| Ga0102757_113464172 | 3300030785 | Soil | MDRVDDTADRVRSNVRAKTSRLVGLIRGVRVAVESLLNSRAA |
| Ga0102759_17277101 | 3300030858 | Soil | VDDTADRVRTNVREKTSRIVGLVRGARVALESFLQSRAA |
| Ga0102759_19119672 | 3300030858 | Soil | DDTADRVRTNVRAKTSRLVGLMRGVRVAVESMLGSQA |
| Ga0102759_19533352 | 3300030858 | Soil | RVDDTADRVRSNVRVKTSRIVGLMRGVRVALESMLNSRAA |
| Ga0308202_10723371 | 3300030902 | Soil | ADRVRSNVRAKTSRLVGLIRGARMAIESALRTEVRT |
| Ga0308206_11101411 | 3300030903 | Soil | MDRVDDTADRVRTNVRAKTSRLVGLLRGVRVAVESMLGSQA |
| Ga0308200_10598661 | 3300030905 | Soil | VDTAIRTTMDRVDDTADRVRSNVRAKTSRIVGIVRGARVALEHILSRAA |
| Ga0138306_16575472 | 3300030936 | Soil | VDTAIRTTMDRVDDTAERVRSNVRAKTSMIVGIVRGARVALEHILSRAA |
| Ga0308190_10830242 | 3300030993 | Soil | VDSAIRSTIDRVDDTADRVRSNVRAKTSRVVGFVRGVRVAIETMLRQAA |
| Ga0073996_121421001 | 3300030998 | Soil | MDRVDDTADRVRSNVRAKTSRIVGLVRGARVAIEAILHSRAA |
| Ga0102760_106423991 | 3300031039 | Soil | MDRVDDTADRVRTNVREKTSRIVGLVRGARVALESFLQSRAA |
| Ga0102760_109197742 | 3300031039 | Soil | DDTADRVRSNVRAKTSRLVGLMRGVRVALEAMLGSQA |
| Ga0308189_100992521 | 3300031058 | Soil | VDDTADRVRSNVRVKTSRIVGMVRGARVALETMLHSRAA |
| Ga0308189_102740972 | 3300031058 | Soil | RVDHAIRTTIDRVDDTAERVRSNVRAKTSWVVGAVRGLRTAVEQLLSSRPVQGKS |
| Ga0308189_104302671 | 3300031058 | Soil | ERVDHAIHRTIDRVDDTADRVRSNVRAKTSRIVGFVRGLRVAIERMLPIRS |
| Ga0102748_115332231 | 3300031089 | Soil | VDDTADRVRSNVRVKTSRIVGLMRGVRVALESMLNSRAA |
| Ga0308201_100834393 | 3300031091 | Soil | DDTADRVRTNVRAKTSRFVGLLRGVRVAVESMLGSQA |
| Ga0308201_101622902 | 3300031091 | Soil | VDTALRTTMDRVDDTADRVRSNVRAQTGRLVGILRGARVALESMLSARAM |
| Ga0308204_101738921 | 3300031092 | Soil | ERVDDAIHRTMERVDDTADRVRYNVRAKTSRIVGFVRGARMAIETMLRSRAA |
| Ga0308197_101255451 | 3300031093 | Soil | KDETDRVDTAIRTTMDVVDDTTERVRTNVRAQTSRIVGIIRGARVALEHILSRAA |
| Ga0308193_10610121 | 3300031096 | Soil | RTIDRVDDTADRVRSNVRAKTSKVVGLVRGLRVALETIMQSRAA |
| Ga0308187_103876881 | 3300031114 | Soil | RIDDTADRVRSNVRAKTSRLVGLIRGARMAIETALRSEVRT |
| Ga0308187_104618882 | 3300031114 | Soil | AIRTTMDRVDGTADRVRSNVRAKTSRLVGLLRGVRVAVESMLGSQA |
| Ga0310888_101344431 | 3300031538 | Soil | TTIDRVDDTVDRMRWNMRAKTSRIVGIVRGARVAIESMLSRAA |
| Ga0310888_110375001 | 3300031538 | Soil | TADRMRSNVRAKTSRVVGFVRGVRVAIETMLRPAA |
| Ga0307405_107020381 | 3300031731 | Rhizosphere | HTTIDRVDDTVDRVRWNVRAKTSRIVGIVRGARVAIESMLSHAA |
| Ga0310904_103480701 | 3300031854 | Soil | AERVDHAIHTTIDRVDDTVDRMRWNMRAKTSRIVGIVRGARVAIESMLSRAA |
| Ga0306922_112058701 | 3300032001 | Soil | ETAVRVRSNVRAKTSAIVGLVRAARMALEGMFRSAVRT |
| Ga0307472_1026441532 | 3300032205 | Hardwood Forest Soil | DTADRVRSNVRMKTSRVVGFVRGLRVAIESMLHTSEART |
| Ga0310896_106005801 | 3300032211 | Soil | DRVDDTVDRMRWNVRAKTSRIVGLVRGARLAIESMLHRAA |
| Ga0314781_118477_432_548 | 3300034660 | Soil | VDDTADRVRSNVREKTNRIVGIVRGARVALEHILTRAA |
| ⦗Top⦘ |