


| Basic Information | |
|---|---|
| Family ID | F064076 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PNDKALQAVLERETDPKVKNFAPADFVDASFFREIEKSGLIEQLYRK |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 96.90 % |
| % of genes from short scaffolds (< 2000 bps) | 93.02 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.574 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.109 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.33% β-sheet: 0.00% Coil/Unstructured: 58.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 52.71 |
| PF12681 | Glyoxalase_2 | 10.08 |
| PF00005 | ABC_tran | 3.88 |
| PF03401 | TctC | 1.55 |
| PF13379 | NMT1_2 | 1.55 |
| PF02371 | Transposase_20 | 1.55 |
| PF03992 | ABM | 1.55 |
| PF13551 | HTH_29 | 1.55 |
| PF04909 | Amidohydro_2 | 1.55 |
| PF02738 | MoCoBD_1 | 1.55 |
| PF05618 | Zn_protease | 1.55 |
| PF08007 | JmjC_2 | 0.78 |
| PF09084 | NMT1 | 0.78 |
| PF03454 | MoeA_C | 0.78 |
| PF13701 | DDE_Tnp_1_4 | 0.78 |
| PF04972 | BON | 0.78 |
| PF16916 | ZT_dimer | 0.78 |
| PF13541 | ChlI | 0.78 |
| PF00158 | Sigma54_activat | 0.78 |
| PF13343 | SBP_bac_6 | 0.78 |
| PF01370 | Epimerase | 0.78 |
| PF07040 | DUF1326 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.55 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.78 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.57 % |
| Unclassified | root | N/A | 5.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_3347 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1970270 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c015534 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300000956|JGI10216J12902_100568018 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004463|Ga0063356_103955916 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300004463|Ga0063356_105007231 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300004479|Ga0062595_100406426 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300004480|Ga0062592_100044914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2343 | Open in IMG/M |
| 3300004779|Ga0062380_10300006 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005093|Ga0062594_103002088 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005180|Ga0066685_10416345 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005180|Ga0066685_10563023 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005328|Ga0070676_10252693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300005330|Ga0070690_100057102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2505 | Open in IMG/M |
| 3300005332|Ga0066388_104492590 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005339|Ga0070660_100234429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
| 3300005353|Ga0070669_100276733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300005364|Ga0070673_101574266 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005457|Ga0070662_101380491 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005543|Ga0070672_101537621 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005546|Ga0070696_100608674 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005546|Ga0070696_100832328 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005548|Ga0070665_101728195 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005549|Ga0070704_100190573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
| 3300005563|Ga0068855_102461144 | Not Available | 518 | Open in IMG/M |
| 3300005718|Ga0068866_10926117 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005829|Ga0074479_10469767 | Not Available | 521 | Open in IMG/M |
| 3300005844|Ga0068862_101691534 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005888|Ga0075289_1071655 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006169|Ga0082029_1090145 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006237|Ga0097621_100402762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300006800|Ga0066660_11129962 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006806|Ga0079220_10081606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1625 | Open in IMG/M |
| 3300006845|Ga0075421_100545611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1370 | Open in IMG/M |
| 3300006854|Ga0075425_102717242 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006854|Ga0075425_103178044 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300007076|Ga0075435_101389596 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300007258|Ga0099793_10221971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 909 | Open in IMG/M |
| 3300009087|Ga0105107_11335510 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009111|Ga0115026_10644123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300009147|Ga0114129_10152213 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300009147|Ga0114129_11845974 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009156|Ga0111538_13632694 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009157|Ga0105092_10005377 | All Organisms → cellular organisms → Bacteria | 6788 | Open in IMG/M |
| 3300009167|Ga0113563_10452269 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009444|Ga0114945_10394800 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300009609|Ga0105347_1029672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1903 | Open in IMG/M |
| 3300009610|Ga0105340_1130709 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300009610|Ga0105340_1320402 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300009818|Ga0105072_1004729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2273 | Open in IMG/M |
| 3300010043|Ga0126380_11774131 | Not Available | 557 | Open in IMG/M |
| 3300010045|Ga0126311_11495549 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010046|Ga0126384_12059736 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010303|Ga0134082_10089674 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300010336|Ga0134071_10094861 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300010358|Ga0126370_10414288 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300010358|Ga0126370_11865565 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010362|Ga0126377_11067507 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010362|Ga0126377_11687957 | Not Available | 708 | Open in IMG/M |
| 3300010371|Ga0134125_12960642 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010375|Ga0105239_11598303 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010398|Ga0126383_13516298 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010401|Ga0134121_13255933 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300011420|Ga0137314_1083818 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300011444|Ga0137463_1223644 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012034|Ga0137453_1016690 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300012035|Ga0137445_1058399 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012167|Ga0137319_1058235 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012199|Ga0137383_10440037 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012209|Ga0137379_10758680 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012350|Ga0137372_10260406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1360 | Open in IMG/M |
| 3300012353|Ga0137367_10561032 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012360|Ga0137375_11162284 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012510|Ga0157316_1017419 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012515|Ga0157338_1056902 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012517|Ga0157354_1018778 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300012519|Ga0157352_1003527 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300012685|Ga0137397_10939129 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012895|Ga0157309_10339366 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012901|Ga0157288_10048176 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300012961|Ga0164302_11718686 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012972|Ga0134077_10192112 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012989|Ga0164305_11862505 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300014308|Ga0075354_1036304 | Not Available | 859 | Open in IMG/M |
| 3300014326|Ga0157380_10580316 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300014879|Ga0180062_1164807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300014968|Ga0157379_10497293 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300015372|Ga0132256_100966803 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300015374|Ga0132255_104997267 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018027|Ga0184605_10489920 | Not Available | 536 | Open in IMG/M |
| 3300018082|Ga0184639_10085320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1662 | Open in IMG/M |
| 3300018082|Ga0184639_10125089 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300018083|Ga0184628_10036863 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300018422|Ga0190265_13642535 | Not Available | 514 | Open in IMG/M |
| 3300018466|Ga0190268_10935880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300018466|Ga0190268_11971289 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300018469|Ga0190270_10542481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1119 | Open in IMG/M |
| 3300018481|Ga0190271_12067874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300020003|Ga0193739_1124526 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021080|Ga0210382_10184046 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300021344|Ga0193719_10036466 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300021411|Ga0193709_1073858 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300022563|Ga0212128_10516004 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300025796|Ga0210113_1021481 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300025899|Ga0207642_10772353 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025906|Ga0207699_10910811 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025910|Ga0207684_10816429 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025916|Ga0207663_10728393 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025959|Ga0210116_1010901 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300026095|Ga0207676_12324487 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026118|Ga0207675_102052682 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300026538|Ga0209056_10552349 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027682|Ga0209971_1018992 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300027722|Ga0209819_10005987 | All Organisms → cellular organisms → Bacteria | 3882 | Open in IMG/M |
| 3300027765|Ga0209073_10230427 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027778|Ga0209464_10136186 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300027907|Ga0207428_10567064 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300027909|Ga0209382_11117059 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300028420|Ga0210366_10497692 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031184|Ga0307499_10130171 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031229|Ga0299913_11078014 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300031719|Ga0306917_11034139 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031854|Ga0310904_11330328 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032005|Ga0307411_10906073 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300032144|Ga0315910_10307847 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300033513|Ga0316628_101066877 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300034115|Ga0364945_0020147 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1746 | Open in IMG/M |
| 3300034150|Ga0364933_036433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1206 | Open in IMG/M |
| 3300034150|Ga0364933_037175 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.33% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.55% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.55% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00191640 | 2199352025 | Soil | MEVLPAPNEKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| ICChiseqgaiiDRAFT_19702702 | 3300000033 | Soil | LERLPAPNDKALQAVLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| ARSoilOldRDRAFT_0155342 | 3300000044 | Arabidopsis Rhizosphere | LPAPNDKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| JGI10216J12902_1005680181 | 3300000956 | Soil | AVLDRENDPKLKVMSPADFTDTSFFRDIERSGLIEQLYRK* |
| Ga0063356_1039559161 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KALQAVLDRENDAKLKTMSPADFVDASFTREIEKSGLIEQLYRK* |
| Ga0063356_1050072311 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AVLERESDPKVKSLSPAEYVDASFFREIEKSGLIEKLYRK* |
| Ga0062595_1004064261 | 3300004479 | Soil | KALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0062592_1000449141 | 3300004480 | Soil | NDRALQAVLDREADPKAKSAATADFVDASFFREIEKSGLIEKLYRK* |
| Ga0062380_103000062 | 3300004779 | Wetland Sediment | MERLPGPNEKALQAVLDRETDPKVKSFAVGDFIDGSFFRDIEKSGYVEQLYRK* |
| Ga0062594_1030020882 | 3300005093 | Soil | SPAPNEKALQAVLERETDPKVKSFGPADFVDASFFKEIEKSDMIEQLYRK* |
| Ga0066685_104163451 | 3300005180 | Soil | PFPSDKALQALLDRESDPKAKSSKPADFFDVSFLREIEKSGLINQLYRK* |
| Ga0066685_105630232 | 3300005180 | Soil | PSDKALQALLDRESDPKAKSSKPADFIDVSFLKEIEKSGLINQLYRK* |
| Ga0070676_102526931 | 3300005328 | Miscanthus Rhizosphere | KALRAVLDRETDPKVKSFSPADFVDASFFTEIEKSGLIEQLYRN* |
| Ga0070690_1000571025 | 3300005330 | Switchgrass Rhizosphere | LQAVLERETDPKTKSFGPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0066388_1044925901 | 3300005332 | Tropical Forest Soil | APNDKALQAVLERETDPKIKNFAPADFVDASFFREIEKSGMIEQLYRK* |
| Ga0070660_1002344291 | 3300005339 | Corn Rhizosphere | EKALRAVLDRETDPKVKSFSPADFVDASFSTEIEKSGLIEQLYRN* |
| Ga0070669_1002767331 | 3300005353 | Switchgrass Rhizosphere | PAPNEKALQAVLERETDPKTKSFGPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0070673_1015742661 | 3300005364 | Switchgrass Rhizosphere | ERSPAPNEKALQAVLERETDPKVKSFGPADFVDASFFKEIEKSDMIEQLYRK* |
| Ga0070662_1013804912 | 3300005457 | Corn Rhizosphere | AVLERETDPKTKSLSTADFVDATFFKEIEKSGMIEQLYRK* |
| Ga0070672_1015376211 | 3300005543 | Miscanthus Rhizosphere | QAVLEREGDPKAKSTPPAEFVDASFFREIAKSGMMEQLYRK* |
| Ga0070696_1006086742 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QAVLERETDPKTKSFGPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0070696_1008323283 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | METLPAPNDKALQAVLEREGDPKAKSTPPAEFVDASFFREIAKSGMMEQLYRK* |
| Ga0070665_1017281951 | 3300005548 | Switchgrass Rhizosphere | TDPKVKSFGPGDFVDASFFKEIEKSGMIEQLYRK* |
| Ga0070704_1001905731 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LMETLPAPNDKALQAVLEREGDPKAKSTPPAEFVDASFFREIAKSGMMEQLYRK* |
| Ga0068855_1024611442 | 3300005563 | Corn Rhizosphere | DEQADLLERSPAPNEKALQAVLERETDPKVKSFGPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0068866_109261172 | 3300005718 | Miscanthus Rhizosphere | RETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0074479_104697672 | 3300005829 | Sediment (Intertidal) | VDLLERLPGPNDKALQAVLDRENDAKLKTMSPADFVDASFSREIEKSGLIEQLYRK* |
| Ga0068862_1016915341 | 3300005844 | Switchgrass Rhizosphere | VLERETDPKTKSFGPGDFVDASFFKEIEKSGMIEQLYRK* |
| Ga0075289_10716551 | 3300005888 | Rice Paddy Soil | TLPAPNEKALQAVLDRESDPKVRSSSPSEYVDASFFREIAKSGMIEQLYKK* |
| Ga0082029_10901451 | 3300006169 | Termite Nest | RSPAPNEKALQAVLEREADPKVKSLSPADFVDASFFREIERSGVIEQLYRK* |
| Ga0097621_1004027621 | 3300006237 | Miscanthus Rhizosphere | PNDKALQAVLDREPDPKIKTLALTEFTDASFFKEIERSGLIEQLYRK* |
| Ga0066660_111299621 | 3300006800 | Soil | RETDPKAKSFSTADFIDAGFFREIEKSGMIEQLYRR* |
| Ga0079220_100816061 | 3300006806 | Agricultural Soil | ERETDPKTKNFGPADFVDASFFKEIEKSGMIEQLYGK* |
| Ga0075421_1005456111 | 3300006845 | Populus Rhizosphere | PAPNDKALQAVLERETDPKTKHFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0075425_1027172422 | 3300006854 | Populus Rhizosphere | LERSPAPNEKALQAVLERETDPKVKNLSPADFVDASFFREIEKSGMIEQLYRK* |
| Ga0075425_1031780442 | 3300006854 | Populus Rhizosphere | DLLERSPAPNEKALQAVLERETDPKTKSFGPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0075435_1013895962 | 3300007076 | Populus Rhizosphere | ESDPKAKSAKPADFVDVSFLRDIEKSGMIEQLYRK* |
| Ga0099793_102219711 | 3300007258 | Vadose Zone Soil | APNDKALQTVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0105107_113355101 | 3300009087 | Freshwater Sediment | LDRENDAKLKTMSPADFTDASFFRDIERSGLIEQLYRK* |
| Ga0115026_106441232 | 3300009111 | Wetland | EPDPKVKSFAIADFIDGSFFRELEKSGYVEQLYRK* |
| Ga0114129_101522135 | 3300009147 | Populus Rhizosphere | LPAPNDRAIQAVLERESDPKLKNFSSADFIDASFFRDIEKSGMIEQLYRKKQSG* |
| Ga0114129_118459742 | 3300009147 | Populus Rhizosphere | VLERENDPKVKNSAPADFVDASFLKEIEKSGMIEQLYRK* |
| Ga0111538_136326941 | 3300009156 | Populus Rhizosphere | APNDKALQAVLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0105092_100053778 | 3300009157 | Freshwater Sediment | ALQAVLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0113563_104522691 | 3300009167 | Freshwater Wetlands | RLPGPNDKALQAVLDRENDAKLKTMSPADFTDASFFRDIERSGLIEQLYRK* |
| Ga0114945_103948001 | 3300009444 | Thermal Springs | PNEKALRAVLDRESDPKVKSLAVGDFVEASFFRDIEKSGMIQQLYRR* |
| Ga0105347_10296721 | 3300009609 | Soil | VDLLERLPAPNDKALQAVLERETDPKVKNFAPADFVDASFFREIEKSGLIEHLYRK* |
| Ga0105340_11307091 | 3300009610 | Soil | AVLERESDSKVKGLPVADYVDASFFKDIEKSGLIEKLYR* |
| Ga0105340_13204022 | 3300009610 | Soil | DLLERVPAPNEKALQAVLERENDAKLKTMSPADFIDASFFREIEKSGLIEQLYRK* |
| Ga0105072_10047291 | 3300009818 | Groundwater Sand | VLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0126380_117741311 | 3300010043 | Tropical Forest Soil | KVLRAVLDRETDPKVKGFSTADFVDASFFKEIEKSGLIERLYRK* |
| Ga0126311_114955491 | 3300010045 | Serpentine Soil | NDRALQAVLDRENDPKLKVMSPADFTDASFFRDIERSGLIEQLYRK* |
| Ga0126384_120597361 | 3300010046 | Tropical Forest Soil | GKALQAVLERETDPKIKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0134082_100896743 | 3300010303 | Grasslands Soil | SDKALQALLDRESDPKAKSSKPADFFDVSFLKEIEKSGLINQLYRK* |
| Ga0134071_100948611 | 3300010336 | Grasslands Soil | SDPKAKISKPADFIDVSFLKEIEKSGLINQLYRK* |
| Ga0126370_104142881 | 3300010358 | Tropical Forest Soil | PAPNDKALQAVLERETDPKIKNFAPADFVDASFFREIEKSGMIEQLYRK* |
| Ga0126370_118655651 | 3300010358 | Tropical Forest Soil | QAVLERETDPKIKNFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0126377_110675072 | 3300010362 | Tropical Forest Soil | QAVLERETDPKIKNFAPADFVDASFFREIEKSGMIEQLYRK* |
| Ga0126377_116879572 | 3300010362 | Tropical Forest Soil | LEALPAPSDKVLRAVLDRETDPKVKSFSTADFVDASFFKEIERSGSIERLYRK* |
| Ga0134125_129606421 | 3300010371 | Terrestrial Soil | QADLLERSPAPNEKALQAVLERETDPKTKSFGPGDFVDASFFKEIEKSGMIEQLYRK* |
| Ga0105239_115983031 | 3300010375 | Corn Rhizosphere | ETDPKTKSFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0126383_135162981 | 3300010398 | Tropical Forest Soil | KVLRAVLDRETDPKVKSFPTADFVDASFFKEIERSGLIERLYRK* |
| Ga0134121_132559331 | 3300010401 | Terrestrial Soil | YQDQIDLIETLPAPNDKALRAVLDRETDPAVKNFSTADFVDASFFREIEKSGLIEQLYRK |
| Ga0137314_10838181 | 3300011420 | Soil | KALQAVLERENDAKLKTMSPADFIDASFFREIEKSGLIEQLYRK* |
| Ga0137463_12236442 | 3300011444 | Soil | ALQAVLDRESDAKLKTMSPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0137453_10166901 | 3300012034 | Soil | RENDAKLKTMSPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0137445_10583992 | 3300012035 | Soil | EKALQAVLGRETDAKVKTMSPADFIDASFFREIEKSGLIEQLYRK* |
| Ga0137319_10582352 | 3300012167 | Soil | LPGPNDKALQAVLDRENDAKLKTMSPADFTDASFFRDIERSGLIEQLYRK* |
| Ga0137383_104400373 | 3300012199 | Vadose Zone Soil | DLMEVLPAPNDKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0137379_107586802 | 3300012209 | Vadose Zone Soil | LLETLPAPNDKAIQAVLERESDARLKNSAPADFVDASFFRDIEKSGMIEQLYRK* |
| Ga0137372_102604061 | 3300012350 | Vadose Zone Soil | LEALPAPNDKAIQAVLERESDPKLKNSAPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0137367_105610322 | 3300012353 | Vadose Zone Soil | DLLEALPAPNDKAIQAVLERESDPKVKNPAPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0137375_111622842 | 3300012360 | Vadose Zone Soil | DLLEALPAPNDKAIQAVLERESDPKVKNSAPADFVDASFFKEIEKSGMIEQLYRK* |
| Ga0157316_10174192 | 3300012510 | Arabidopsis Rhizosphere | LQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0157338_10569022 | 3300012515 | Arabidopsis Rhizosphere | AVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0157354_10187783 | 3300012517 | Unplanted Soil | PNDKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0157352_10035271 | 3300012519 | Unplanted Soil | DKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK* |
| Ga0137397_109391291 | 3300012685 | Vadose Zone Soil | TDPKVKTFSTEDFVDASFFKEIEKSGMIEQLYRR* |
| Ga0157309_103393661 | 3300012895 | Soil | EKALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0157288_100481761 | 3300012901 | Soil | LERETDPKTKSFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0164302_117186862 | 3300012961 | Soil | VLDRETDPKVKNFAIADFVDGSFFKEIEKSGLVEQLYRK* |
| Ga0134077_101921121 | 3300012972 | Grasslands Soil | ALLDRESDPKAKSSKPADFFDVSFLKEIEKSGLINQLYRK* |
| Ga0164305_118625052 | 3300012989 | Soil | MEPLPSPNDKALQAVLDREPDPKIKTLALTEFTDASFFKEIERSGLIEQLYRK* |
| Ga0075354_10363041 | 3300014308 | Natural And Restored Wetlands | PAPNDKALQAVLERETDPKTKNFALSDFVDASFFREIEKSGLIEQLYRK* |
| Ga0157380_105803161 | 3300014326 | Switchgrass Rhizosphere | ETLPAPNDKALQAVLERESDPKAKSAPLAEFVDASFFREIAKSGMMEQLYRK* |
| Ga0180062_11648071 | 3300014879 | Soil | LLERLPAPNDKALQAVLERETDPKTKSFAPADFVDASFFREIEKSGLIEQLYRK* |
| Ga0157379_104972933 | 3300014968 | Switchgrass Rhizosphere | APNEKALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGLLEQLYRK* |
| Ga0132256_1009668033 | 3300015372 | Arabidopsis Rhizosphere | LERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0132255_1049972671 | 3300015374 | Arabidopsis Rhizosphere | KALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK* |
| Ga0184605_104899201 | 3300018027 | Groundwater Sediment | RENDPKLKTLSPADFIDASFFREIEKTGLIEQLYRK |
| Ga0184639_100853204 | 3300018082 | Groundwater Sediment | NEKALQAVLDRETDAKLKSMSPADFVDASFFKEIERSGLIEQLYRK |
| Ga0184639_101250891 | 3300018082 | Groundwater Sediment | EQIDLMEVLPAPNDKALQAVLDRETDPKVKSLSTADFVDASFFREIEKSGMIEQQYRR |
| Ga0184628_100368631 | 3300018083 | Groundwater Sediment | RENDAKLKTMSPADFIDASFFREIEKSGLIEQLYRK |
| Ga0190265_136425352 | 3300018422 | Soil | ETLPAPNDKALQAVLERESDSKVKSSPVADYVDASFFKEIERSGLIEKLYRN |
| Ga0190268_109358801 | 3300018466 | Soil | AVLERESDPKVKSLAIGDFIGASFFREIEKSGLIEQLYRK |
| Ga0190268_119712892 | 3300018466 | Soil | LPAPNDRALQAVLDREADPKAKNAAAADFVDASFFREIEKSGLIEKLYRK |
| Ga0190270_105424811 | 3300018469 | Soil | EQVEFLERIPGPNEKALAAVLERESDPKAKSLAIGDFIDASFFREIEKTGLIEHLYRK |
| Ga0190271_120678741 | 3300018481 | Soil | LPAPNEKALAAVLERESDPKVKSLAIGDFIDASFFREIEKTGLIEHLYRK |
| Ga0193739_11245261 | 3300020003 | Soil | DRESDPKLKSSSPADFVDASFFRDIEKSGTIEQLYRK |
| Ga0210382_101840463 | 3300021080 | Groundwater Sediment | ALQAVLERENDPKLKVSSPADFVDASFYREIEKSGMIEQLYRR |
| Ga0193719_100364665 | 3300021344 | Soil | PAPNDKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| Ga0193709_10738581 | 3300021411 | Soil | PNEKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| Ga0212128_105160043 | 3300022563 | Thermal Springs | EKALRAVLDRESDPKVKSLAVGDFVEASFFRDIEKSGMIQQLYRR |
| Ga0210113_10214811 | 3300025796 | Natural And Restored Wetlands | PAANDKAIRAVLERESDPKVKSSPVAEYVDASFFRDIEKSGLVEKLYHK |
| Ga0207642_107723531 | 3300025899 | Miscanthus Rhizosphere | EVLPAPNEKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| Ga0207699_109108111 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QADLLERSPAPNERALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK |
| Ga0207684_108164291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LDRESDPKAKSSKPADFVDVSFLKDIEKSGMIDQLYRK |
| Ga0207663_107283931 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | APNERALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMLEQLYRK |
| Ga0210116_10109011 | 3300025959 | Natural And Restored Wetlands | DRENDPKLKTMSIADFVDASFFREIERSGLIEQLYRK |
| Ga0207676_123244871 | 3300026095 | Switchgrass Rhizosphere | RESDPKAKSAPLAEFVDASFFREIAKSGMMEQLYRK |
| Ga0207675_1020526822 | 3300026118 | Switchgrass Rhizosphere | MEVLPAPNDKALQAVLERETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| Ga0209056_105523492 | 3300026538 | Soil | LLDRESDPKAKSSKPADFIDVSFLKEIEKSGLINQLYRK |
| Ga0209971_10189923 | 3300027682 | Arabidopsis Thaliana Rhizosphere | VLERESDPKMKNSPVADYVDATFFREIEKSGLVEKLYRK |
| Ga0209819_100059871 | 3300027722 | Freshwater Sediment | PNDKALQAVLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK |
| Ga0209073_102304272 | 3300027765 | Agricultural Soil | ALQAVLERETDPKTKNFGPADFVDASFFKEIEKSGMIEQLYGK |
| Ga0209464_101361861 | 3300027778 | Wetland Sediment | PAPNDKALQAVLDRENDAKLKTMLPADFVDASFFRDIEKSGLIEQLYRK |
| Ga0207428_105670641 | 3300027907 | Populus Rhizosphere | NDKALQAVLERETDPKTKNFAPADFVDASFFREIEKSGLIEQLYRK |
| Ga0209382_111170591 | 3300027909 | Populus Rhizosphere | LPAPNDKALQAVLERETDPKTKHFAPADFVDASFFREIEKSGLIEQLYRK |
| Ga0210366_104976922 | 3300028420 | Estuarine | LSLPGTNCFPLMEVLPAPNDKTLQAVLDCETDPKLKSFSPADFIDANFFRDIERIGAKEQLY |
| Ga0307499_101301711 | 3300031184 | Soil | APNDKALQAVLDRETDPKVKSFSTADFIDASFFKEIEKSGMIEQLYRK |
| Ga0299913_110780141 | 3300031229 | Soil | LQAVLDRESDPKVKSSSVADYVDSSFFREIEKSGLIEKLYRK |
| Ga0306917_110341391 | 3300031719 | Soil | ALQAVLERETDPKVKSFAFGDFVDASFFKEIEKSGMIEQLYRK |
| Ga0310904_113303281 | 3300031854 | Soil | DLLERLPAPNDKALQAVLERETDPKVKNFAPADFVDASFFREIEKSGLIEQLYRK |
| Ga0307411_109060732 | 3300032005 | Rhizosphere | EQVELLERLPGPNDRALQAVLDRENDPKLKVMSPADFTDASFFRDIERSGLIEQLYRK |
| Ga0315910_103078473 | 3300032144 | Soil | VLEREADPKLKSSAPAEYVDASFFREIEKGGLIEKLYRK |
| Ga0316628_1010668773 | 3300033513 | Soil | KALRAVLDRETDPKVKSFSTANFVDASFFREIENSGMIEELYRKQ |
| Ga0364945_0020147_2_115 | 3300034115 | Sediment | ERETDPKTKNFAPVDFVDASFFREIEKSGLIEQLYRK |
| Ga0364933_036433_2_145 | 3300034150 | Sediment | PNDKALQAVLERETDPKVKNFAPADFVDASFFREIEKSGLIEQLYRK |
| Ga0364933_037175_1076_1192 | 3300034150 | Sediment | LGRENDAKLKTMAPADFIDASFFRDIEKSGLIEQLYRK |
| ⦗Top⦘ |