


| Basic Information | |
|---|---|
| Family ID | F063988 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KMDMTYRPPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.20 % |
| % of genes near scaffold ends (potentially truncated) | 90.70 % |
| % of genes from short scaffolds (< 2000 bps) | 93.02 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.519 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.256 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.287 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF08501 | Shikimate_dh_N | 51.94 |
| PF03401 | TctC | 8.53 |
| PF00005 | ABC_tran | 6.20 |
| PF01381 | HTH_3 | 2.33 |
| PF03480 | DctP | 1.55 |
| PF13417 | GST_N_3 | 0.78 |
| PF02627 | CMD | 0.78 |
| PF04134 | DCC1-like | 0.78 |
| PF01977 | UbiD | 0.78 |
| PF00857 | Isochorismatase | 0.78 |
| PF00501 | AMP-binding | 0.78 |
| PF13560 | HTH_31 | 0.78 |
| PF02653 | BPD_transp_2 | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF03061 | 4HBT | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 51.94 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 8.53 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.78 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.78 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.78 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.78 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.52 % |
| Unclassified | root | N/A | 22.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01EXHG5 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1079753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300001661|JGI12053J15887_10358961 | Not Available | 704 | Open in IMG/M |
| 3300002239|JGI24034J26672_10087194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300004479|Ga0062595_100269680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300004633|Ga0066395_10338336 | Not Available | 833 | Open in IMG/M |
| 3300005148|Ga0066819_1027676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300005179|Ga0066684_10510660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300005327|Ga0070658_10696809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300005330|Ga0070690_100313290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300005467|Ga0070706_100884824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300005529|Ga0070741_11703652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 513 | Open in IMG/M |
| 3300005564|Ga0070664_100443121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300005564|Ga0070664_101293025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300005602|Ga0070762_10524345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 779 | Open in IMG/M |
| 3300005713|Ga0066905_100752622 | Not Available | 841 | Open in IMG/M |
| 3300005713|Ga0066905_101761760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300005764|Ga0066903_100397520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 2265 | Open in IMG/M |
| 3300005764|Ga0066903_102070392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300006034|Ga0066656_10210960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
| 3300006173|Ga0070716_101171629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300006175|Ga0070712_100525694 | Not Available | 994 | Open in IMG/M |
| 3300006176|Ga0070765_100301439 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300006177|Ga0075362_10069673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300006794|Ga0066658_10919509 | Not Available | 505 | Open in IMG/M |
| 3300006845|Ga0075421_100070551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4409 | Open in IMG/M |
| 3300006914|Ga0075436_101443649 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009089|Ga0099828_11879059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300009094|Ga0111539_10342297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1741 | Open in IMG/M |
| 3300009100|Ga0075418_11243486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300009177|Ga0105248_12354135 | Not Available | 607 | Open in IMG/M |
| 3300009683|Ga0116224_10152020 | Not Available | 1114 | Open in IMG/M |
| 3300010040|Ga0126308_10160416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1426 | Open in IMG/M |
| 3300010043|Ga0126380_10457040 | Not Available | 967 | Open in IMG/M |
| 3300010358|Ga0126370_11702096 | Not Available | 607 | Open in IMG/M |
| 3300010359|Ga0126376_11425180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300010360|Ga0126372_10140561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1908 | Open in IMG/M |
| 3300010362|Ga0126377_10531282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1212 | Open in IMG/M |
| 3300010362|Ga0126377_12317831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300010366|Ga0126379_11454475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300010366|Ga0126379_13811377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300010396|Ga0134126_13004258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300010398|Ga0126383_10128079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2328 | Open in IMG/M |
| 3300010399|Ga0134127_13083031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300012200|Ga0137382_10171132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1482 | Open in IMG/M |
| 3300012206|Ga0137380_11496122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300012361|Ga0137360_11416883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300012363|Ga0137390_10324863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1520 | Open in IMG/M |
| 3300012363|Ga0137390_11616982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300012469|Ga0150984_105544066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300012683|Ga0137398_11099779 | Not Available | 547 | Open in IMG/M |
| 3300012960|Ga0164301_10926298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012971|Ga0126369_10326329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1547 | Open in IMG/M |
| 3300012989|Ga0164305_12227220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 504 | Open in IMG/M |
| 3300014200|Ga0181526_10251493 | Not Available | 1127 | Open in IMG/M |
| 3300014501|Ga0182024_10121681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3732 | Open in IMG/M |
| 3300014501|Ga0182024_10458022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1633 | Open in IMG/M |
| 3300014657|Ga0181522_10261725 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300016294|Ga0182041_10556566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300017975|Ga0187782_10771205 | Not Available | 743 | Open in IMG/M |
| 3300018055|Ga0184616_10397219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300018083|Ga0184628_10508119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 622 | Open in IMG/M |
| 3300018422|Ga0190265_11911626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300018476|Ga0190274_12320671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300019873|Ga0193700_1053800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300020001|Ga0193731_1099767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300020580|Ga0210403_10816055 | Not Available | 741 | Open in IMG/M |
| 3300021073|Ga0210378_10146633 | Not Available | 912 | Open in IMG/M |
| 3300021073|Ga0210378_10183184 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021180|Ga0210396_10492016 | Not Available | 1074 | Open in IMG/M |
| 3300021403|Ga0210397_10268329 | Not Available | 1244 | Open in IMG/M |
| 3300021407|Ga0210383_11027063 | Not Available | 698 | Open in IMG/M |
| 3300021420|Ga0210394_10339566 | Not Available | 1319 | Open in IMG/M |
| 3300021420|Ga0210394_10406033 | Not Available | 1198 | Open in IMG/M |
| 3300021433|Ga0210391_11117621 | Not Available | 612 | Open in IMG/M |
| 3300021474|Ga0210390_11131896 | Not Available | 634 | Open in IMG/M |
| 3300021560|Ga0126371_10777441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
| 3300024330|Ga0137417_1408452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4837 | Open in IMG/M |
| 3300025627|Ga0208220_1169376 | Not Available | 547 | Open in IMG/M |
| 3300025915|Ga0207693_10393188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1084 | Open in IMG/M |
| 3300025930|Ga0207701_10183637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1843 | Open in IMG/M |
| 3300025939|Ga0207665_11140534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300025939|Ga0207665_11162328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300025941|Ga0207711_11627232 | Not Available | 589 | Open in IMG/M |
| 3300025961|Ga0207712_11179891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300026494|Ga0257159_1013112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1313 | Open in IMG/M |
| 3300027671|Ga0209588_1142341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300027684|Ga0209626_1010228 | Not Available | 2144 | Open in IMG/M |
| 3300027842|Ga0209580_10661608 | Not Available | 516 | Open in IMG/M |
| 3300027853|Ga0209274_10208010 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300027874|Ga0209465_10155005 | Not Available | 1138 | Open in IMG/M |
| 3300027874|Ga0209465_10474070 | Not Available | 626 | Open in IMG/M |
| 3300028711|Ga0307293_10109225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300028754|Ga0307297_10143067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300028778|Ga0307288_10278392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300028809|Ga0247824_10789247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300029951|Ga0311371_12126316 | Not Available | 589 | Open in IMG/M |
| 3300030707|Ga0310038_10023431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3797 | Open in IMG/M |
| 3300031184|Ga0307499_10068172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 912 | Open in IMG/M |
| 3300031446|Ga0170820_12329744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300031561|Ga0318528_10115669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1415 | Open in IMG/M |
| 3300031572|Ga0318515_10228706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300031679|Ga0318561_10419846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300031681|Ga0318572_10734512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300031682|Ga0318560_10101995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1485 | Open in IMG/M |
| 3300031724|Ga0318500_10324133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 757 | Open in IMG/M |
| 3300031724|Ga0318500_10743369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300031768|Ga0318509_10232752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1027 | Open in IMG/M |
| 3300031777|Ga0318543_10021475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2421 | Open in IMG/M |
| 3300031779|Ga0318566_10121109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300031793|Ga0318548_10079970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1544 | Open in IMG/M |
| 3300031795|Ga0318557_10246634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
| 3300031819|Ga0318568_10637680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300031845|Ga0318511_10368521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300031894|Ga0318522_10035685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1705 | Open in IMG/M |
| 3300031910|Ga0306923_11665631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300031912|Ga0306921_10493285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1424 | Open in IMG/M |
| 3300032001|Ga0306922_10411102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1448 | Open in IMG/M |
| 3300032008|Ga0318562_10053529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2219 | Open in IMG/M |
| 3300032010|Ga0318569_10311898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300032044|Ga0318558_10086303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1451 | Open in IMG/M |
| 3300032044|Ga0318558_10307877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300032055|Ga0318575_10101976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1392 | Open in IMG/M |
| 3300032063|Ga0318504_10103146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1279 | Open in IMG/M |
| 3300032160|Ga0311301_10725055 | Not Available | 1389 | Open in IMG/M |
| 3300032205|Ga0307472_101421090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300032205|Ga0307472_102605528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300033550|Ga0247829_11039818 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300033551|Ga0247830_10345470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.10% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_01971160 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MTYRPPDHLERLIAALYQTPPDLIETVKKLVPSVQ |
| AF_2010_repII_A100DRAFT_10797532 | 3300000655 | Forest Soil | TYRPPDHLARLVTQLYATPPATIEMVKKIVPNLR* |
| JGI12053J15887_103589612 | 3300001661 | Forest Soil | AEADRLKLDMTYRSPEDLERLVKNLYETPPEMVETVKKLVPAMQ* |
| JGI24034J26672_100871941 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | LLAEAARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0062595_1002696801 | 3300004479 | Soil | EAARIKMDMTYRPPDHLERLIAALYQTPPALIETVKKLVPSVQ* |
| Ga0066395_103383362 | 3300004633 | Tropical Forest Soil | MLDEAEKAKIDRTCQPPARLEELVASLYRTPPDMIETVKKVVPNLQ* |
| Ga0066819_10276762 | 3300005148 | Soil | ALLAEAARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0066684_105106601 | 3300005179 | Soil | KLKLDMTYRSPQDLERLVTNLYETPPDVIETVKRLVPNVQ* |
| Ga0070658_106968091 | 3300005327 | Corn Rhizosphere | RMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0070690_1003132902 | 3300005330 | Switchgrass Rhizosphere | MKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0070706_1008848241 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EAARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0070741_117036522 | 3300005529 | Surface Soil | QAEAARMKLDMTYRPPEHLETLVMHLYDTPKETIAELKKIAPTLR* |
| Ga0070664_1004431211 | 3300005564 | Corn Rhizosphere | AEAARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0070664_1012930252 | 3300005564 | Corn Rhizosphere | AARMKMDMTYRPPDHLERLVTSLYSTPPALIETVKKLVPNLQ* |
| Ga0070762_105243452 | 3300005602 | Soil | MTYTAPDRLEQLVGKLYETPPAVIEKVKALLPNEK* |
| Ga0066905_1007526221 | 3300005713 | Tropical Forest Soil | SKIDMTYLPPEHLEQLVASLYRTPPDLIETVKKLVPNLQ* |
| Ga0066905_1017617602 | 3300005713 | Tropical Forest Soil | ALVGEAARMKMDMTYRSPERLERLVATLYETPPALIETVKKLVPNLQ* |
| Ga0066903_1003975204 | 3300005764 | Tropical Forest Soil | MTYLPPARLEELVAGLYRIPPDLIESVKKLVPNLQ* |
| Ga0066903_1020703921 | 3300005764 | Tropical Forest Soil | TYRPPDQLEGLVASLYDTPAVLIETVKKLVPNLQ* |
| Ga0066656_102109601 | 3300006034 | Soil | AARIKMDMTYRPPDDLQQLVANLYATPPALIETVKKLVPNLQ* |
| Ga0070716_1011716291 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EAAKMKMDMTYRPPEELERLVADLYQTPPALIETVKKLVPSLQ* |
| Ga0070712_1005256941 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DAEKSRIDMTYLPPERLEQLVASLYRTPPDLIESVKKLVPNLQ* |
| Ga0070765_1003014395 | 3300006176 | Soil | TYTSPESLEQLVAKLYKTPPALIATVKTILPNEK* |
| Ga0075362_100696731 | 3300006177 | Populus Endosphere | AARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0066658_109195092 | 3300006794 | Soil | DMTYRPPDHLERLVANLYETPPELIETIKKLVPTLR* |
| Ga0075421_1000705516 | 3300006845 | Populus Rhizosphere | KMDMTYRPPDHLERLVTSLYSTPPALIETVKKLVPNLQ* |
| Ga0075436_1014436492 | 3300006914 | Populus Rhizosphere | MLAEAKKMKLDMTYLSPARLEELIESLYRTPPDMIEAVKKLVPNLQ* |
| Ga0099828_118790591 | 3300009089 | Vadose Zone Soil | AARLKMDMTYRPPDHLEQLIAALYQTPPALIETVKKLVPSVQ* |
| Ga0111539_103422971 | 3300009094 | Populus Rhizosphere | QADAEKSKMDMTYLPPERLEQLVASLYRTPPDLIETVKKLVPNLQ* |
| Ga0075418_112434862 | 3300009100 | Populus Rhizosphere | EAARIRMDMTYRPPDHLERLVARLYDTPPAMIETIKKLVPHAE* |
| Ga0105248_123541352 | 3300009177 | Switchgrass Rhizosphere | YMTYLPPERLDQLVASLYRTPPDLIETVKKLVPNLQ* |
| Ga0116224_101520203 | 3300009683 | Peatlands Soil | AAIKMDMTYTPPEHLEQLVEKLYQTPPSVIETVKSLLPNEK* |
| Ga0126308_101604162 | 3300010040 | Serpentine Soil | DVAKDPEMLAEAGKSKIDMTYHSPAHQERLVQSLYQTPPELIEVVKKLVPNLQ* |
| Ga0126380_104570401 | 3300010043 | Tropical Forest Soil | MLGEAEKGKIDMTYLPPARLEALVASLYRTPPDLIETVKKLVPNLQ* |
| Ga0126370_117020961 | 3300010358 | Tropical Forest Soil | MQLDAERSKIDMTYLPPERLEQLVANLYRTPPDLIETVKKLVPNLQ* |
| Ga0126376_114251802 | 3300010359 | Tropical Forest Soil | LDMTFRPPDALERLVANLYETPPAMIETVKKLVPNLQ* |
| Ga0126372_101405613 | 3300010360 | Tropical Forest Soil | ARIKLDMTYRPPDHLERLVAALYQTPPALIETVKKLVPNVQ* |
| Ga0126377_105312821 | 3300010362 | Tropical Forest Soil | RIKMDMTYRPPDHLERLVAALYETPPALIETVRKLVPSVQ* |
| Ga0126377_123178312 | 3300010362 | Tropical Forest Soil | VAEAAKIKLDMTYRPPEHLEGLVAELYDTPPELIETVKKLVPSVQ* |
| Ga0126379_114544752 | 3300010366 | Tropical Forest Soil | KMDMTYRPPDHLERLVAALYETPPALIETVRKLVPSVQ* |
| Ga0126379_138113772 | 3300010366 | Tropical Forest Soil | IKLDMTYRPPDHLERLVAALYQTPPALVETVKKLVPSVQ* |
| Ga0134126_130042581 | 3300010396 | Terrestrial Soil | MDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0126383_101280791 | 3300010398 | Tropical Forest Soil | MLDEAEKAKIDMTDLPPARLEELVASLYRTPPDMIETVKKVVPNLQ* |
| Ga0134127_130830312 | 3300010399 | Terrestrial Soil | RMKMDMTYRPPDHLERLVTSLYSTPPALIETVKKLVPNLQ* |
| Ga0137382_101711321 | 3300012200 | Vadose Zone Soil | DAEKSKIDMTYLPPERLEQLVASLYRTPPDLIETVKKLVPNLQ* |
| Ga0137380_114961222 | 3300012206 | Vadose Zone Soil | ADRIKLDMTYRAPDHLERLVANLYETPPALIETVKKLIPNLR* |
| Ga0137360_114168832 | 3300012361 | Vadose Zone Soil | DMTYRPPDHLERLIAALYQTPPALIETVKKLVPSVQ* |
| Ga0137390_103248633 | 3300012363 | Vadose Zone Soil | AEAARIKMDMTYRPPDHLERVLASLYETPPALIATVKKLVPSMQ* |
| Ga0137390_116169821 | 3300012363 | Vadose Zone Soil | KLDMSYRPPHALERLVVQLYEAPPELIETVKKLVPNMQ* |
| Ga0150984_1055440662 | 3300012469 | Avena Fatua Rhizosphere | LAEATRMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ* |
| Ga0137398_110997791 | 3300012683 | Vadose Zone Soil | LRLDMTYRSPEDLERLVANLYETPPEMVETVKKLVPGLQ* |
| Ga0164301_109262981 | 3300012960 | Soil | LDMAYHSPAQLEQLVAALYQTPPTMIEAVKKLVPSLD* |
| Ga0126369_103263294 | 3300012971 | Tropical Forest Soil | MTCLSATRLEELVASLYRTPPDLIETVKKIMPNLQ* |
| Ga0164305_122272201 | 3300012989 | Soil | SYRAPEHLEQLVVKLYQTPQDVIDAVKKLIPAVQ* |
| Ga0181526_102514931 | 3300014200 | Bog | MTYTPPDHLEELVGKLYQTPPSVIETIKSLLPNEK* |
| Ga0182024_101216815 | 3300014501 | Permafrost | MTYTPPEHLERLVAKLYQTPPALIGTVKALLPNMK* |
| Ga0182024_104580222 | 3300014501 | Permafrost | MALRPSDLLKLDMTYRPPQDLERLVAQLYETPPALIETVKKLVPTLQ* |
| Ga0181522_102617251 | 3300014657 | Bog | AIKMDMTYTPPDHLEQLVEKLYQTPPAVIETVKSLLPNEK* |
| Ga0182041_105565661 | 3300016294 | Soil | IKMDMTYRPPDHLERLVAALYETPPALIETVKKLVPSVQ |
| Ga0187782_107712051 | 3300017975 | Tropical Peatland | ANIKMDMTFTSAESLEQLVVKLYQTPPALIATVKAILPNEK |
| Ga0184616_103972191 | 3300018055 | Groundwater Sediment | LAEAARMKMDMTYRQPDRLEQLVATLYSTPPAMIETVKKLVPNLQ |
| Ga0184628_105081192 | 3300018083 | Groundwater Sediment | ALIAEAARMKMDMTYRQPDRLEQLVANLYSTPPAMIETVKKLVPNLQ |
| Ga0190265_119116261 | 3300018422 | Soil | LDMSFRGPERLEKLVADLYATPPGVIEAVKKLVPNLQ |
| Ga0190274_123206711 | 3300018476 | Soil | ARMKMDMTYRQPDRLEQLVGSLYSTPPAMIETVKKLVPNLQ |
| Ga0193700_10538001 | 3300019873 | Soil | MTFRQPDRLEQLVASLYSTTPAMIETVKKLVPNLQ |
| Ga0193731_10997672 | 3300020001 | Soil | RMKMDMTFRQPDRLEQLVASLYSTTPAMIETVKKLVPNLQ |
| Ga0210403_108160552 | 3300020580 | Soil | ANIKMDMTYTPPEHLEQLVAKLYQTPPAVIETVKTLLPNEK |
| Ga0210378_101466331 | 3300021073 | Groundwater Sediment | DPQMQADAEKSKIDMTYLPPERLEQLVASLYRTPPDMIETVKKLVPNLQ |
| Ga0210378_101831841 | 3300021073 | Groundwater Sediment | DMTYRPADHLERTVAGLYETPPALIETIKKLVPNLQ |
| Ga0210396_104920163 | 3300021180 | Soil | ATIKMDMTYTAPDRLEQLVEKLYQTPPAVIETVKALLPNEK |
| Ga0210397_102683293 | 3300021403 | Soil | LVAEAATIKMDMTYTAPDRLEQLVEKLYQTPPAVIETVKALLPNEK |
| Ga0210383_110270631 | 3300021407 | Soil | KMDMTFTPADRLEQLVAKLYQTPPGVIETVKSLLPNEK |
| Ga0210394_103395663 | 3300021420 | Soil | EADRLKLDMTYRSPQDLERLVANLYETPPEMVETVKKLVPGLQ |
| Ga0210394_104060333 | 3300021420 | Soil | SIKMDMTYTPPEHLEQLVAKLYQTPPAVIETVKALLPNEK |
| Ga0210391_111176211 | 3300021433 | Soil | KMDMTYAPPDRLEQLVANLYQTPPSVIETVKSLLPNEK |
| Ga0210390_111318961 | 3300021474 | Soil | TIKMDMTYTAPDRLEQLVEKLYQTPPAVIETVKALLPNEK |
| Ga0126371_107774411 | 3300021560 | Tropical Forest Soil | KIKLDMTYRPREHLEGLVAALYDTPPELIETVKKLVPSVQ |
| Ga0137417_14084523 | 3300024330 | Vadose Zone Soil | MTYRPPDDLTRLVADLYDTAPALIATVKKLVPNLQ |
| Ga0208220_11693762 | 3300025627 | Arctic Peat Soil | GLDMTYTPPETLEQLVAKLFQTPPALVATVRSILPNEK |
| Ga0207693_103931883 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DAEKSRIDMTYLPPERLEQLVASLYRTPPDLIESVKKLVPNLQ |
| Ga0207701_101836374 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0207665_111405342 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLKMDMTYRPPDHLERLIAALYQTPPALIETVKKLVPSVQ |
| Ga0207665_111623282 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EAAKMKMDMTYRPPEELERLVADLYQTPPALIETVKKLVPSLQ |
| Ga0207711_116272322 | 3300025941 | Switchgrass Rhizosphere | YMTYLPPERLDQLVASLYRTPPDLIETVKKLVPNLQ |
| Ga0207712_111798911 | 3300025961 | Switchgrass Rhizosphere | AEAARMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0257159_10131123 | 3300026494 | Soil | LKMDMTYRPPDHLEQLIAALYQTPPALIETVKKLVPSVQ |
| Ga0209588_11423412 | 3300027671 | Vadose Zone Soil | CSYRPPDHLEQLIAALYQTPPALIETVKKLVPSVQ |
| Ga0209626_10102284 | 3300027684 | Forest Soil | ASIKMDMTYTPPEHLEQLVTKLYQTPPAVIETVKALLPNEK |
| Ga0209580_106616082 | 3300027842 | Surface Soil | DMTYTPPDRLEQLVAKLYQTPPAVIETVKALLPNEK |
| Ga0209274_102080103 | 3300027853 | Soil | AASIKMDMTYTPPDHLDELIGKLYQTPPSVIEAVKSLLPNEK |
| Ga0209465_101550051 | 3300027874 | Tropical Forest Soil | MLDEAEKAKIDRTCQPPARLEELVASLYRTPPDMIETVKKVVPNLQ |
| Ga0209465_104740702 | 3300027874 | Tropical Forest Soil | EAAKMKMDMSYRPPDLLKRLVAQIYETPPDLIETVKKLVPTQQ |
| Ga0307293_101092251 | 3300028711 | Soil | RMKMDMTYRQPDRLEQLVASLYSTTPAMIETVKKLVPNLQ |
| Ga0307297_101430672 | 3300028754 | Soil | TEAARMKMDMTYRQPDRLEQLVANLYSTPPAMIETVKKLVPNLQ |
| Ga0307288_102783921 | 3300028778 | Soil | AARMKMDMTYRQPDRLEQLVASLYSTTPAMIETVKKLVPNLQ |
| Ga0247824_107892471 | 3300028809 | Soil | MKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0311371_121263161 | 3300029951 | Palsa | MDMTYTSPDQLEQLVAALYKTPPSVIESVKALLPGEK |
| Ga0310038_100234316 | 3300030707 | Peatlands Soil | MTYTPPEQLEQLVAKLYETPPAVIETVKSLLPNEK |
| Ga0307499_100681722 | 3300031184 | Soil | ALLAEATRMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0170820_123297442 | 3300031446 | Forest Soil | AIRMKMDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0318528_101156693 | 3300031561 | Soil | MTYRPPDHLERLVAALYETPPALIETVKKLVPSVQ |
| Ga0318515_102287062 | 3300031572 | Soil | DMTYRPPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318561_104198462 | 3300031679 | Soil | VAEAAKLKIDMTFRPPQRLEQLVAHLYETPQPLIETVRKLVPSVQ |
| Ga0318572_107345121 | 3300031681 | Soil | MDMTYRSPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318560_101019951 | 3300031682 | Soil | EAARIKMDMTYRPPDHLERLVAALYETPPALIETVKKLVPSVQ |
| Ga0318500_103241332 | 3300031724 | Soil | MTYRSPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318500_107433691 | 3300031724 | Soil | DMTYRSPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318509_102327521 | 3300031768 | Soil | NLVAEAARIKMDMTYRSPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318543_100214751 | 3300031777 | Soil | LAEAARIKMDMTYRPPDHLERLVAALYETPPALIETVKKLVPSVQ |
| Ga0318566_101211093 | 3300031779 | Soil | KMDMTYRPPDHLERLIAALYQTPPTLIETVKKLVPSVQ |
| Ga0318548_100799701 | 3300031793 | Soil | DMTYRPPDHLERLIAALYQTPPTLIETVKKLVPSVQ |
| Ga0318557_102466341 | 3300031795 | Soil | VAEAAKLKIDMTFRPPQRLEQLVARLYETPQPLIETVRKLVPSVQ |
| Ga0318568_106376802 | 3300031819 | Soil | IKLDMSYRPPDALERLVAQLYDAPAELIDTVKKLVPSIQ |
| Ga0318511_103685212 | 3300031845 | Soil | MDMTYRPPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318522_100356853 | 3300031894 | Soil | MTYRPPDHLERLVAALYQTPPALIETVKKLVPNVQ |
| Ga0306923_116656312 | 3300031910 | Soil | DVTYRPPDHLERLVAALYQTPPALIETVRKLVPSVQ |
| Ga0306921_104932851 | 3300031912 | Soil | IKMDMTYRPPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0306922_104111021 | 3300032001 | Soil | KMDMTYRPPDHLERLVAALYQTPPALIETVKKLVPSVQ |
| Ga0318562_100535291 | 3300032008 | Soil | AARIKLDMTYRSPDHLERLVAALYQTPPALVETVKKLVPSVQ |
| Ga0318569_103118982 | 3300032010 | Soil | EAARIKMDMTYRPPDHLERLIAALYQTPPTLIETVKKLVPSVQ |
| Ga0318558_100863033 | 3300032044 | Soil | ELLAEAARIKMDMTYRPPDHLERLVAALYETPPALIETVKKLVPSVQ |
| Ga0318558_103078771 | 3300032044 | Soil | IKMDVTYRPPDHLERLVAALYQTPPALIETVRKLVPSVQ |
| Ga0318575_101019763 | 3300032055 | Soil | ARIKMDMTYRPPDHLERLIAALYQTPPTLIETVKKLVPSVQ |
| Ga0318504_101031463 | 3300032063 | Soil | DMTYRPPDHLERLVAALYQTPPALIETVRKLVPSVQ |
| Ga0311301_107250551 | 3300032160 | Peatlands Soil | DMTYTPPEHLEQLVAKLYQTPPAVIETVKALLPNEK |
| Ga0307472_1014210901 | 3300032205 | Hardwood Forest Soil | MDMTYRQPDRLEQLVASLYSTPPAMIETVKKLVPNLQ |
| Ga0307472_1026055281 | 3300032205 | Hardwood Forest Soil | VGEAARMKMDMTYRSPEQLEQRVTALYETPPALIETVKKLVPNLQ |
| Ga0247829_110398181 | 3300033550 | Soil | DMTHRPADHLERTVAGLYETPPALIETIKRLVPNLQ |
| Ga0247830_103454701 | 3300033551 | Soil | LIAEAARMKMDMTYRPPDHLERLVTSLYSTPPALIETVKKLVPNLQ |
| ⦗Top⦘ |