


| Basic Information | |
|---|---|
| Family ID | F063916 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.69 % |
| % of genes near scaffold ends (potentially truncated) | 92.25 % |
| % of genes from short scaffolds (< 2000 bps) | 90.70 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.922 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.279 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.806 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 0.00% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01554 | MatE | 5.43 |
| PF00072 | Response_reg | 2.33 |
| PF00581 | Rhodanese | 2.33 |
| PF00069 | Pkinase | 2.33 |
| PF02735 | Ku | 1.55 |
| PF12222 | PNGaseA | 1.55 |
| PF08238 | Sel1 | 0.78 |
| PF02812 | ELFV_dehydrog_N | 0.78 |
| PF13519 | VWA_2 | 0.78 |
| PF13432 | TPR_16 | 0.78 |
| PF04055 | Radical_SAM | 0.78 |
| PF07498 | Rho_N | 0.78 |
| PF13022 | HTH_Tnp_1_2 | 0.78 |
| PF07228 | SpoIIE | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF12732 | YtxH | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF12705 | PDDEXK_1 | 0.78 |
| PF03050 | DDE_Tnp_IS66 | 0.78 |
| PF03544 | TonB_C | 0.78 |
| PF00982 | Glyco_transf_20 | 0.78 |
| PF13360 | PQQ_2 | 0.78 |
| PF11154 | DUF2934 | 0.78 |
| PF02954 | HTH_8 | 0.78 |
| PF01558 | POR | 0.78 |
| PF00144 | Beta-lactamase | 0.78 |
| PF04945 | YHS | 0.78 |
| PF07494 | Reg_prop | 0.78 |
| PF02321 | OEP | 0.78 |
| PF07676 | PD40 | 0.78 |
| PF00990 | GGDEF | 0.78 |
| PF00166 | Cpn10 | 0.78 |
| PF10012 | DUF2255 | 0.78 |
| PF01553 | Acyltransferase | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF01070 | FMN_dh | 0.78 |
| PF07311 | Dodecin | 0.78 |
| PF01068 | DNA_ligase_A_M | 0.78 |
| PF16925 | TetR_C_13 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 9.30 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.55 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.78 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.78 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.78 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.78 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.78 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.78 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.92 % |
| Unclassified | root | N/A | 10.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002G5L0T | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300001100|JGI12703J13194_108548 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100627289 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101007313 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10256123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300004092|Ga0062389_100091195 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300004633|Ga0066395_10179077 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005175|Ga0066673_10588298 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005184|Ga0066671_10233854 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300005334|Ga0068869_100209559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1540 | Open in IMG/M |
| 3300005468|Ga0070707_101222052 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005518|Ga0070699_101078179 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005534|Ga0070735_10487676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300005534|Ga0070735_10800724 | Not Available | 555 | Open in IMG/M |
| 3300005541|Ga0070733_10444841 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005542|Ga0070732_10720017 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005555|Ga0066692_10968134 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005556|Ga0066707_10721222 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005559|Ga0066700_10706509 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005575|Ga0066702_10053465 | Not Available | 2179 | Open in IMG/M |
| 3300005586|Ga0066691_10078512 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300006028|Ga0070717_10028614 | All Organisms → cellular organisms → Bacteria | 4462 | Open in IMG/M |
| 3300006102|Ga0075015_100082036 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300006175|Ga0070712_100711965 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300006176|Ga0070765_100686597 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006358|Ga0068871_101913582 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006800|Ga0066660_10214102 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300009012|Ga0066710_101862677 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009038|Ga0099829_11054046 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009101|Ga0105247_10497305 | Not Available | 888 | Open in IMG/M |
| 3300009177|Ga0105248_10723954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300009521|Ga0116222_1165958 | Not Available | 951 | Open in IMG/M |
| 3300009523|Ga0116221_1310387 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009525|Ga0116220_10253748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 768 | Open in IMG/M |
| 3300009700|Ga0116217_10584038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300010048|Ga0126373_12621724 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010361|Ga0126378_12826156 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010376|Ga0126381_102066944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300010376|Ga0126381_102554170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300010397|Ga0134124_10224478 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300011269|Ga0137392_10412261 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012200|Ga0137382_11255421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012202|Ga0137363_11087747 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012917|Ga0137395_10473488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300012918|Ga0137396_10242582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300012930|Ga0137407_11519389 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300013105|Ga0157369_10279485 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300013306|Ga0163162_10408667 | Not Available | 1490 | Open in IMG/M |
| 3300014495|Ga0182015_10943321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300014501|Ga0182024_10701221 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300014654|Ga0181525_10075815 | Not Available | 1877 | Open in IMG/M |
| 3300016445|Ga0182038_11157875 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300017924|Ga0187820_1327853 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017928|Ga0187806_1045161 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300017937|Ga0187809_10085653 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300017972|Ga0187781_10177260 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300018021|Ga0187882_1388626 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018023|Ga0187889_10423006 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018062|Ga0187784_10772069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300018085|Ga0187772_10437374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 915 | Open in IMG/M |
| 3300020580|Ga0210403_10002695 | All Organisms → cellular organisms → Bacteria | 15873 | Open in IMG/M |
| 3300020580|Ga0210403_10762846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300020580|Ga0210403_11031174 | Not Available | 642 | Open in IMG/M |
| 3300020581|Ga0210399_10450375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300020582|Ga0210395_10388621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300020582|Ga0210395_11328426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300021168|Ga0210406_11014779 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021402|Ga0210385_10296158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
| 3300021406|Ga0210386_10179150 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300021407|Ga0210383_11629404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 530 | Open in IMG/M |
| 3300021420|Ga0210394_10715685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300021432|Ga0210384_10428685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300021433|Ga0210391_10707166 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021559|Ga0210409_10583443 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300021559|Ga0210409_11269229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300021560|Ga0126371_13828083 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300022528|Ga0242669_1101263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300022557|Ga0212123_10213509 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300022724|Ga0242665_10146231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300022733|Ga0224562_1017490 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300025320|Ga0209171_10104576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300025321|Ga0207656_10277141 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300025612|Ga0208691_1048150 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300025898|Ga0207692_11061470 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025922|Ga0207646_10538829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300026552|Ga0209577_10439535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300027559|Ga0209222_1043000 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027605|Ga0209329_1111985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 599 | Open in IMG/M |
| 3300027643|Ga0209076_1088386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300027667|Ga0209009_1123310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300027729|Ga0209248_10045111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300027825|Ga0209039_10111460 | Not Available | 1165 | Open in IMG/M |
| 3300027842|Ga0209580_10262352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 860 | Open in IMG/M |
| 3300027889|Ga0209380_10494052 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027895|Ga0209624_10126167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1683 | Open in IMG/M |
| 3300027895|Ga0209624_10771607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300027986|Ga0209168_10655028 | Not Available | 500 | Open in IMG/M |
| 3300028020|Ga0265351_1007103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300028379|Ga0268266_10006448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10745 | Open in IMG/M |
| 3300028379|Ga0268266_10086823 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300028381|Ga0268264_10602325 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300028536|Ga0137415_10153045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2142 | Open in IMG/M |
| 3300028745|Ga0302267_10269340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300029636|Ga0222749_10570422 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300029882|Ga0311368_10034642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4752 | Open in IMG/M |
| 3300029956|Ga0302150_10271346 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300030509|Ga0302183_10401098 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030815|Ga0265746_1014596 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300030991|Ga0073994_12358989 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031049|Ga0074036_10779255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300031128|Ga0170823_14940047 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300031231|Ga0170824_127868696 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031233|Ga0302307_10208630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300031236|Ga0302324_100274392 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300031708|Ga0310686_110451997 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031711|Ga0265314_10366863 | Not Available | 788 | Open in IMG/M |
| 3300031716|Ga0310813_10550157 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031718|Ga0307474_10164967 | Not Available | 1676 | Open in IMG/M |
| 3300031718|Ga0307474_10426797 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300031718|Ga0307474_10679466 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031740|Ga0307468_101704796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031754|Ga0307475_10412568 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300031962|Ga0307479_10076867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3231 | Open in IMG/M |
| 3300031962|Ga0307479_10110624 | Not Available | 2672 | Open in IMG/M |
| 3300032001|Ga0306922_10478045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
| 3300032180|Ga0307471_104185836 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032515|Ga0348332_11645103 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300032828|Ga0335080_11412565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031049 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_09563650 | 2170459003 | Grass Soil | GGGARAIPVGFIEVSDQQARFVPITDRKKLAGAAAIGIGLGMWLGWRRRR |
| JGI12703J13194_1085481 | 3300001100 | Forest Soil | VRTIPVGVIEVSDQPTRFVPITDRKKLTGAVLASIGLGMLLGWRRRR* |
| JGIcombinedJ26739_1006272891 | 3300002245 | Forest Soil | GVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR* |
| JGIcombinedJ26739_1010073131 | 3300002245 | Forest Soil | IEVSDQQTRFIPITNRKKMAGVALAGTLLGIVLSWRKRR* |
| JGIcombinedJ51221_102561231 | 3300003505 | Forest Soil | VRAIPVGVIEISEQRTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR* |
| Ga0062389_1000911953 | 3300004092 | Bog Forest Soil | TIPVGVIEISDQPTRFIPITSRKKLAAAIVGGILFGLLFARRRRR* |
| Ga0066395_101790772 | 3300004633 | Tropical Forest Soil | IRAVPVGVIEVSSNQPTRFVPITDRKKLGAAAMAGIVVGMWLGWRRRR* |
| Ga0066673_105882981 | 3300005175 | Soil | GVVRAVPVGVFEVGSHGTRFVSITERRKLASVLATGVALGMWLGWRRRH* |
| Ga0066671_102338543 | 3300005184 | Soil | IEVSSQPTRFVPISDRKKLTAAVFLGLGLGMLLGFRRRR* |
| Ga0068869_1002095593 | 3300005334 | Miscanthus Rhizosphere | AVPVGVIEVSIHQTRFVPITDRRKLTGALLAGIGLGMWLGWRRRR* |
| Ga0070707_1012220522 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVGVIEVSEQHTCFVPITDRKKLTGALLAGIAFGMWLGWRRLR* |
| Ga0070699_1010781792 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | HAVPVGVVEVSDQQTRFVPISDRKKLTGMLLLGVGMGMWLNRRRRS* |
| Ga0070735_104876761 | 3300005534 | Surface Soil | RTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR* |
| Ga0070735_108007242 | 3300005534 | Surface Soil | VGVVEVSAQNTRFVPISDRKKLAGAVALGALLGVP* |
| Ga0070733_104448411 | 3300005541 | Surface Soil | VIEISDQQTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR* |
| Ga0070732_107200172 | 3300005542 | Surface Soil | AIPVGVIEVSDQQTRFVPITDHKKLAGAVLAGIGLGMWLGWRRRR* |
| Ga0066692_109681341 | 3300005555 | Soil | VGVIEISDQQTRFVQITDRKKLTGAILAGIGLGMWLG* |
| Ga0066707_107212222 | 3300005556 | Soil | VGVIEVSDQQTRFVPISDRKKLTGVLLLGVGLGMWLGYRR* |
| Ga0066700_107065092 | 3300005559 | Soil | VGVIEISDQQTRFVPITDRKKLTGAVLVGIGLGMFLGWRRRH* |
| Ga0066702_100534654 | 3300005575 | Soil | QQTRFVPITDRKKLTGAVLVGIGLGMFLGWRRRH* |
| Ga0066691_100785123 | 3300005586 | Soil | VRAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRGRGV* |
| Ga0070717_100286148 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGARAIPVGVIEVSEQPTRFVPITDRKKLTGAVLVGIGLGLWLGWRRRKFNS* |
| Ga0075015_1000820361 | 3300006102 | Watersheds | VRAVPVGVIEISDHPTRFVPVTDRKKLAGAVLVGIGLGVWLGWRRWR* |
| Ga0070712_1007119651 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EVSNQQTRFVPISDKRKLVGAVLAGISFGIWWGWRRHR* |
| Ga0070765_1006865971 | 3300006176 | Soil | RAIPVGVIEISDQQTSFVPITDRKKLTGAVLAGIGLGVLLGWRTRR* |
| Ga0068871_1019135821 | 3300006358 | Miscanthus Rhizosphere | PVGVIEISDQQTRFVPITDRKKLTGAVVVGIGLGLWLGWRRRH* |
| Ga0066660_102141023 | 3300006800 | Soil | RAVPVGVIEVSDQPTRFVPISDRKKLTGAVLVGLALGMLMSLRRR* |
| Ga0066710_1018626772 | 3300009012 | Grasslands Soil | VIEISDQQTRFVPITDRKKLTGAVLAGIGLGVWLGWRRWR |
| Ga0099829_110540461 | 3300009038 | Vadose Zone Soil | VIEVSDQQTRFVPISDRKKLTGVLLLGVGLGMWLGHRR* |
| Ga0105247_104973051 | 3300009101 | Switchgrass Rhizosphere | EVSNQQTRFIPITDRRKLAGALLAGIGFGMWLGWRRRR* |
| Ga0105248_107239542 | 3300009177 | Switchgrass Rhizosphere | GAVRAVPVGVIEVSIHQTRFVPITDRRKLTGALLAGIGLGMWLGWRRRR* |
| Ga0116222_11659581 | 3300009521 | Peatlands Soil | GVVEISDQQTCFVPITSRKKLAVAVLAGIVLGIWVGWRRRG* |
| Ga0116221_13103873 | 3300009523 | Peatlands Soil | GARTVPVGVIEISDQPTCFVPITDRKKLTEALLAGIGFGMWLGWRNRR* |
| Ga0116220_102537482 | 3300009525 | Peatlands Soil | VRAVPVGVIEISDQQTCFVPITDRKKLTGAVLAGIGLGVLLGWRARR* |
| Ga0116217_105840381 | 3300009700 | Peatlands Soil | EGGGGAGGVRAVPVGVIEISDQPTRFVPISNHKKLTGAVLAGIGFGMLLGWRRR* |
| Ga0126373_126217241 | 3300010048 | Tropical Forest Soil | GVIEISDHQTRFVPITDRRKLSAAILIGAGFGMWLARSRRH* |
| Ga0126378_128261561 | 3300010361 | Tropical Forest Soil | GVQAVPIGVIEVSKQQTRFVPITDRKKLGGAVLAGMVLGMFWRWQRRH* |
| Ga0126381_1020669442 | 3300010376 | Tropical Forest Soil | VEVSEQQTRFVPISDRKKLTAAAFGGIVLGMWLGWRRRR* |
| Ga0126381_1025541701 | 3300010376 | Tropical Forest Soil | SKQQTRFVPISDRKKLSAAVLTGMVIGMFWRWRRRH* |
| Ga0134124_102244783 | 3300010397 | Terrestrial Soil | GGGVRAIPVGVIEVSHQSTRFIPITDRKKLTGAVLAGIGVGIWLAWTRRR* |
| Ga0137392_104122611 | 3300011269 | Vadose Zone Soil | VIEISDQQFRFVPITDSKKLTGAVLAGIGFGMWLGWRRRR* |
| Ga0137382_112554211 | 3300012200 | Vadose Zone Soil | QQTRFVPITDRKRLAGAVLAGIGLGMWLGWRRRR* |
| Ga0137363_110877471 | 3300012202 | Vadose Zone Soil | QQTRFVPITDRKKMTGALLAGIGFGMWLGWRRHR* |
| Ga0137395_104734883 | 3300012917 | Vadose Zone Soil | RAVPVGIIEISDQQTRFVPITDRKKLAAATLVGIGLGMWLGWCRRR* |
| Ga0137396_102425821 | 3300012918 | Vadose Zone Soil | RAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRR* |
| Ga0137407_115193892 | 3300012930 | Vadose Zone Soil | GVRAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGLGMWLGWRRRR* |
| Ga0157369_102794854 | 3300013105 | Corn Rhizosphere | PVGVIEVSHQQTRFVPITDRKKLTGTLLAGIGLGMWLAWSRRR* |
| Ga0163162_104086672 | 3300013306 | Switchgrass Rhizosphere | VIEVSNQQTRFIPITDRRKLAGALLAGIGFGMWLGWRRRR* |
| Ga0182015_109433212 | 3300014495 | Palsa | RAVPVGVIEISEQRTCFVPVTDRKKLAGAVVAGIGLGILLSWRSRRR* |
| Ga0182024_107012211 | 3300014501 | Permafrost | EVSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR* |
| Ga0181525_100758152 | 3300014654 | Bog | GGARVVPLGVIEISEQQTTFVPITSRKKLTGVLLGGIGLGMLLGWRRLRSR* |
| Ga0182038_111578751 | 3300016445 | Soil | SAQQTRFVPISDQKKLGSVLLAGIGLGLLMAWRRKR |
| Ga0187820_13278531 | 3300017924 | Freshwater Sediment | PVGVVEVSDQQTRFVPINDRKKVAGAIAMGVGLGIFLAWRRRR |
| Ga0187806_10451614 | 3300017928 | Freshwater Sediment | GGGVRTVPVGVIEISDQPTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR |
| Ga0187809_100856531 | 3300017937 | Freshwater Sediment | GGGARTVPVGVIEISDQPTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR |
| Ga0187781_101772602 | 3300017972 | Tropical Peatland | EISGQATRFVPISDRKKLTGAVVAGIGLGLWLGWRRRR |
| Ga0187882_13886261 | 3300018021 | Peatland | RAIPVGVIEISDQQETRFVPITDRKKLTGAILAGIGLGMWLGWRRRR |
| Ga0187889_104230063 | 3300018023 | Peatland | IDISDQQETRCVPITDRKKLTGAILAGIGLGMWLGWRRRR |
| Ga0187784_107720692 | 3300018062 | Tropical Peatland | GGGGARAIPVGVIEISDQQTRFVPITDRKKLTAATVAGIGLGIWLSWRRRH |
| Ga0187772_104373742 | 3300018085 | Tropical Peatland | IPVGVIEISDQQTRFVPITDRKKLTAATVAGIGLGIWLSWRRRH |
| Ga0210403_1000269517 | 3300020580 | Soil | VGVIEVSDQQTRFVPITDRKKLTGAVLTGIGLGMFLGWRRRR |
| Ga0210403_107628461 | 3300020580 | Soil | RAVAVGVIEVSDRQTRFVPITDRKRLAGAVLVGIGLGMLLGWRRRR |
| Ga0210403_110311741 | 3300020580 | Soil | EISEHQTRFIPITSRKKLTGAVIAGILLGISFGWRRRRR |
| Ga0210399_104503752 | 3300020581 | Soil | VGVIEISDQPTCFVPITDRKKLTGAAVAGIGLGILLGWRSRRR |
| Ga0210395_103886211 | 3300020582 | Soil | VGVIEISDLRTCFVPITDRKKLTGAVLAGVGLGILLGWSARR |
| Ga0210395_108886241 | 3300020582 | Soil | SARSEGRGGVGGVRAIPVGVIEVSDQQIHFVPITDRKRLAGAVLAGIGLGMLLGWRRRH |
| Ga0210395_113284262 | 3300020582 | Soil | GGGGAVRAVPIGVIEISDQPARFVPISNHKKLTAAVLAGIGFGMLMGWRRRR |
| Ga0210406_110147791 | 3300021168 | Soil | QTRFVPITDRKKLTGAVLAGIVLGMWVGWRRVRRH |
| Ga0210385_102961582 | 3300021402 | Soil | IPVGVIEISDQHTCFIPITSRKKLAGAIVVGALLGIFLGWRRRRR |
| Ga0210386_101791501 | 3300021406 | Soil | IPVGVIEVTDQHTRFIPITSSKKLAGFVLAGALLGMIFGRRKRR |
| Ga0210383_116294041 | 3300021407 | Soil | EGGGGGCGVRAVPVGVIDVSDQGTVFVPITSRHKLAGAVVAGVGLGIFLSWRRRKK |
| Ga0210394_107156851 | 3300021420 | Soil | PVGVIEISEQRTCFVPITDRKKLTGAVVAGIGLGILLGWRSRRR |
| Ga0210384_104286852 | 3300021432 | Soil | VSTGQTRFVPITSRKKLVAASFGGIVVGALIGWLGRRR |
| Ga0210391_107071662 | 3300021433 | Soil | ISDQQTSFVPITDRKKLTGAVLAGIGLGVLLGRRRRR |
| Ga0210409_105834431 | 3300021559 | Soil | GGVRAIPVGVIEISDQQTRFVPITDRTKLTGAVLAGIGLGMWLGWRRRG |
| Ga0210409_112692291 | 3300021559 | Soil | PVGVIEISEQRTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR |
| Ga0126371_138280832 | 3300021560 | Tropical Forest Soil | AIPVGVIEISDLQTRFVPITDRKKLTAAAVAGIGLGIWLSWRRRH |
| Ga0242669_11012632 | 3300022528 | Soil | GGGGAGVRAIPVGVIEISDQHTCFIPITSRKKLAGAIVVGALLGIFLSWRRRRR |
| Ga0212123_102135094 | 3300022557 | Iron-Sulfur Acid Spring | ARAIPVGVIEISDLRTCFVPITDRKKLTGAVLAGVGLGILLVWSARR |
| Ga0242665_101462312 | 3300022724 | Soil | GGAVRAVPIGVIEISDQPARFVPISNHKKLTAAVLAGIGFGMLMGWRKRR |
| Ga0224562_10174901 | 3300022733 | Soil | GVRAIPVGVIEISDHPTSFVPITDRKKLTGAVLAGIGLGILLGWRTRR |
| Ga0209171_101045765 | 3300025320 | Iron-Sulfur Acid Spring | PIGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGMLLGWRRRR |
| Ga0207656_102771411 | 3300025321 | Corn Rhizosphere | AVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR |
| Ga0208691_10481501 | 3300025612 | Peatland | VRAIPVGVIEISDQQTRFIPITSRKKLTGAVVAGILLGISLGWRRRRR |
| Ga0207692_110614702 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GGARAIPVGVIEVSEQPTRFVPITDRKKLTGAVLVGIGLGLWLGWRRRKFNS |
| Ga0207646_105388294 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ATPVGVIEISDQQTRFVPITDRKRLAGAVLAGIGLGIFLGWRRRR |
| Ga0209577_104395352 | 3300026552 | Soil | RAIPVGVIEISDQQTRFVPITDRKKLAGAILAGIGFGMWLGWRGGRR |
| Ga0209222_10430002 | 3300027559 | Forest Soil | PVGVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR |
| Ga0209329_11119852 | 3300027605 | Forest Soil | VQNLIAQQTRFVPITDRKKLTGAVLAGIGIGMWLGWRRRR |
| Ga0209076_10883861 | 3300027643 | Vadose Zone Soil | GGGVRAIPVGVIEISDQQTRFVPITDRKKLTGAVLVGIGLGVWLGWRRRR |
| Ga0209009_11233101 | 3300027667 | Forest Soil | GVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGILLGWRRRH |
| Ga0209248_100451114 | 3300027729 | Bog Forest Soil | GCGGAGVRAIPVGVIEISDQQTRFIPITSRKKLAGAILGGILLGITLGWRRRRR |
| Ga0209039_101114601 | 3300027825 | Bog Forest Soil | PLGVIEVSAEQTRFVPITSRRKLAGALVAGVGFGILLAWRRLRSR |
| Ga0209580_102623522 | 3300027842 | Surface Soil | VIEISDHQTRFVPIATDRRKLAGAIATGIGMGLWLARLRR |
| Ga0209380_104940522 | 3300027889 | Soil | LAIPAGVMEISDQQTRFVPITDRKKLAGAVLAGISFGMWLGWRRRR |
| Ga0209624_101261672 | 3300027895 | Forest Soil | VGVIEIGDQQTRFVPITDRKKLTGAVLVGTGFGMRLGWRKRR |
| Ga0209624_107716072 | 3300027895 | Forest Soil | EISDRRTCFVPITDRKKLTGAVLAGVGLGILLGWSARR |
| Ga0209168_106550282 | 3300027986 | Surface Soil | VGVVEVSAQNTRFVPISDRKKLAGAVALGALLGVP |
| Ga0265351_10071032 | 3300028020 | Soil | EVSDQHTRFVPITDRKRLVGAVLAGIGLGMWLGWRRRR |
| Ga0268266_1000644815 | 3300028379 | Switchgrass Rhizosphere | RAVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR |
| Ga0268266_100868236 | 3300028379 | Switchgrass Rhizosphere | GVIEVSHQQTRFVPITDRKKLTGTLLAGIGLGMWLAWSRRR |
| Ga0268264_106023251 | 3300028381 | Switchgrass Rhizosphere | GVRAVPVGVIEVSNQPTRFVPITDRRKLTGAVLAGIGFGMWLGWRRRR |
| Ga0137415_101530451 | 3300028536 | Vadose Zone Soil | SDQQTRFVPITDRKTLTGAVLAGIGLGMWLGWRRRR |
| Ga0302267_102693402 | 3300028745 | Bog | VRAIPVGVIEVSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR |
| Ga0222749_105704221 | 3300029636 | Soil | VRAVPVGVIEVSEQQTRFVPITDRKKLTGAVLAGIGFGMWVGWRRLRRHESVAQ |
| Ga0311368_100346421 | 3300029882 | Palsa | GAAVRTIPVGVIEVSDQQTRFIPITSRKKLAAAALVGTLLGISLGWRKRR |
| Ga0302150_102713462 | 3300029956 | Bog | VIELSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR |
| Ga0302183_104010981 | 3300030509 | Palsa | PVGVIEVSDQQTRFIPITSRKKLAGAVFVGSLLGIFLGWRKRR |
| Ga0265746_10145962 | 3300030815 | Soil | GVIDITEKETRFVPITDRKRLGGAVLVGVGLGMLLSWRRRR |
| Ga0073994_123589891 | 3300030991 | Soil | IEISDQQTRFVPITDRKKLTGVLLAGIGFGMWLGWNRRR |
| Ga0074036_107792551 | 3300031049 | Soil | AWAIPMGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGMLLGWRRRR |
| Ga0170823_149400473 | 3300031128 | Forest Soil | VSDQQTRFVPITDRKRLAGAVLVGIGLGMLLDWRRRR |
| Ga0170824_1278686961 | 3300031231 | Forest Soil | GVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGILLGWRRRR |
| Ga0302307_102086301 | 3300031233 | Palsa | GVIEISGQQTRFIPITSRKKLTGAVIAGILLGISLGWRRRRR |
| Ga0302324_1002743924 | 3300031236 | Palsa | LRAIPVGVIEISGQQTRFIPITSRKKLTGAVIAGILLGISLGWRRRRR |
| Ga0310686_1104519971 | 3300031708 | Soil | GVRAIPVGVIEVSDQQTRFIPITSRKKMAGALFAGSLLGIFLGWRRRR |
| Ga0265314_103668631 | 3300031711 | Rhizosphere | TVPVGVIEISGQRTCFVPITDRKKLAGAILAGIGLGLWLGWRRRL |
| Ga0310813_105501573 | 3300031716 | Soil | GVRAVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR |
| Ga0307474_101649671 | 3300031718 | Hardwood Forest Soil | GVIEVSQEQTRFIPITSRRKLAGAVFAGIVLGLTLSLRRRRH |
| Ga0307474_104267972 | 3300031718 | Hardwood Forest Soil | EGGSGGGGVLAIPAGVMEISDQQTRFVPITDRKKLAGAVLAGIGFGMWLGWRRRR |
| Ga0307474_106794662 | 3300031718 | Hardwood Forest Soil | RAVPVGVIEVSHQQTRFVPITDRKKLSGAVLAGIGLGMWLGWRRRR |
| Ga0307468_1017047961 | 3300031740 | Hardwood Forest Soil | GGGVRAVPVGVIEVSDQQTRFVPITDRKKLTGAVLAGIGIGMWLSWHRRR |
| Ga0307475_104125681 | 3300031754 | Hardwood Forest Soil | VGVIEVSEQQTRFVPISDRKKLTGAVLAGIVFGMWMGWRGLRRH |
| Ga0307479_100768677 | 3300031962 | Hardwood Forest Soil | GVRAIPVGVIEVSDQQTRFVPITDRKKLTGAVLAGIGLGMFLGWRRRR |
| Ga0307479_101106242 | 3300031962 | Hardwood Forest Soil | MARAVPVGVVEVSKAANRFVPITDRKKLAGTLRTGIGLGILFGRRRRH |
| Ga0306922_104780451 | 3300032001 | Soil | GAGGVRAIPVGVIEVSNQQTRFVPITDRKKLTGAVLTGVGLGIWLGWRRRR |
| Ga0307471_1041858361 | 3300032180 | Hardwood Forest Soil | VSNQQTRFVPISDKRKLVGAVLAGISFGIWWGWRRHR |
| Ga0348332_116451032 | 3300032515 | Plant Litter | AGVRAIPVGVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR |
| Ga0335080_114125652 | 3300032828 | Soil | GVRAVPVGVIEISNQPTRFVSINDKKKLTGAVIAGIGLGMWLGWRRRR |
| ⦗Top⦘ |