


| Basic Information | |
|---|---|
| Family ID | F063879 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRREQP |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.51 % |
| % of genes near scaffold ends (potentially truncated) | 81.40 % |
| % of genes from short scaffolds (< 2000 bps) | 80.62 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.946 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.380 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.930 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.512 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 37.14% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF16793 | RepB_primase | 72.09 |
| PF12728 | HTH_17 | 4.65 |
| PF00589 | Phage_integrase | 3.88 |
| PF14659 | Phage_int_SAM_3 | 0.78 |
| PF11154 | DUF2934 | 0.78 |
| PF00437 | T2SSE | 0.78 |
| PF02789 | Peptidase_M17_N | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.37 % |
| Unclassified | root | N/A | 11.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10281814 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300005176|Ga0066679_10548632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 753 | Open in IMG/M |
| 3300005534|Ga0070735_10264419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300005538|Ga0070731_10238766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300005557|Ga0066704_11017852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005602|Ga0070762_11233318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
| 3300006176|Ga0070765_100383951 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300006797|Ga0066659_10460703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300006804|Ga0079221_10628488 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300007255|Ga0099791_10572573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300007982|Ga0102924_1133671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300009089|Ga0099828_10007601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7895 | Open in IMG/M |
| 3300009524|Ga0116225_1310734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300010048|Ga0126373_11837300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300010335|Ga0134063_10305310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300010339|Ga0074046_10255750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300010361|Ga0126378_12532451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300010379|Ga0136449_104129097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300011271|Ga0137393_11387604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012189|Ga0137388_10712470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012200|Ga0137382_10790075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012202|Ga0137363_11055448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012205|Ga0137362_11078175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012211|Ga0137377_10733817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300012361|Ga0137360_10771175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300012363|Ga0137390_10592838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300012363|Ga0137390_10777394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300012363|Ga0137390_10870839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300012582|Ga0137358_10429858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300012683|Ga0137398_10425174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300012917|Ga0137395_10254948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300012918|Ga0137396_10732963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300012922|Ga0137394_10827030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300012931|Ga0153915_10896003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300012977|Ga0134087_10796811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300014165|Ga0181523_10403400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300014200|Ga0181526_10414394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300014200|Ga0181526_10712188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300014201|Ga0181537_10832570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300014495|Ga0182015_10915040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300014501|Ga0182024_11773784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300015241|Ga0137418_11282138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300016270|Ga0182036_11921191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300016294|Ga0182041_10079356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2340 | Open in IMG/M |
| 3300016319|Ga0182033_11277377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300016404|Ga0182037_12024060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017948|Ga0187847_10122884 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300017955|Ga0187817_10202338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300017955|Ga0187817_10353578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300017988|Ga0181520_10530000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300018007|Ga0187805_10228472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300018017|Ga0187872_10272121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300018037|Ga0187883_10127376 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
| 3300018040|Ga0187862_10502571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300018086|Ga0187769_10413043 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300018088|Ga0187771_10359643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300018482|Ga0066669_12347969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300020580|Ga0210403_10933307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300020581|Ga0210399_10454250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300020583|Ga0210401_11077812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300021170|Ga0210400_11213056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021402|Ga0210385_10887522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300021474|Ga0210390_10368246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300021478|Ga0210402_10105024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2541 | Open in IMG/M |
| 3300021478|Ga0210402_10128889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2292 | Open in IMG/M |
| 3300021478|Ga0210402_10446074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300021559|Ga0210409_11710218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021560|Ga0126371_10253157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1876 | Open in IMG/M |
| 3300021560|Ga0126371_11977924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300025320|Ga0209171_10088546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
| 3300026319|Ga0209647_1027593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3382 | Open in IMG/M |
| 3300026523|Ga0209808_1052633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
| 3300026551|Ga0209648_10017091 | All Organisms → cellular organisms → Bacteria | 6327 | Open in IMG/M |
| 3300026551|Ga0209648_10819875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027629|Ga0209422_1020995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1623 | Open in IMG/M |
| 3300027655|Ga0209388_1182437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300027674|Ga0209118_1173653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300027846|Ga0209180_10615203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027898|Ga0209067_10510754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027908|Ga0209006_10032938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4695 | Open in IMG/M |
| 3300027911|Ga0209698_10174851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1749 | Open in IMG/M |
| 3300028759|Ga0302224_10125597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300028798|Ga0302222_10393092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300029944|Ga0311352_10390997 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300029951|Ga0311371_11860800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300030058|Ga0302179_10067329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1593 | Open in IMG/M |
| 3300030058|Ga0302179_10175558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300030058|Ga0302179_10500621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300030520|Ga0311372_10965551 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300030524|Ga0311357_10714685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300030617|Ga0311356_10481769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300030618|Ga0311354_10361139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300030618|Ga0311354_11169894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300030848|Ga0075388_11573409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031240|Ga0265320_10146459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300031249|Ga0265339_10491783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031446|Ga0170820_12396315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031446|Ga0170820_16228953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300031525|Ga0302326_11168081 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300031525|Ga0302326_13679038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031671|Ga0307372_10253271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300031708|Ga0310686_100658169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031708|Ga0310686_113067219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300031718|Ga0307474_11632662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031754|Ga0307475_10576454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300031910|Ga0306923_11689095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031946|Ga0310910_10148442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1792 | Open in IMG/M |
| 3300032163|Ga0315281_11534710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300032205|Ga0307472_102429043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300032783|Ga0335079_10000418 | All Organisms → cellular organisms → Bacteria | 49017 | Open in IMG/M |
| 3300032892|Ga0335081_10413251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1731 | Open in IMG/M |
| 3300033158|Ga0335077_10159012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2582 | Open in IMG/M |
| 3300033289|Ga0310914_10183242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1864 | Open in IMG/M |
| 3300033405|Ga0326727_10208989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2114 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.10% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.10% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102818141 | 3300001593 | Forest Soil | HSLNVVVQLERRPGRRFVSQVVEINGYDPDTDEYDFTVIFSNEREQP*IRP* |
| JGIcombinedJ26739_1014375181 | 3300002245 | Forest Soil | HSLNVVVQLERRPGRRFVSQVVEINGYDPDRDEYDFGAVFSSEREPL* |
| Ga0062385_101308343 | 3300004080 | Bog Forest Soil | VQLERRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS* |
| Ga0062388_1028416922 | 3300004635 | Bog Forest Soil | QLERRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS* |
| Ga0066679_105486323 | 3300005176 | Soil | LGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFAVIYQSRQEQP* |
| Ga0070713_1015461712 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GYSLNVVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFGAIFQSEREPL* |
| Ga0070741_111815992 | 3300005529 | Surface Soil | VQLQRRPGRRFVSEVVEINGYDPDHDEYDFGPVFLSEREPL* |
| Ga0070735_102644192 | 3300005534 | Surface Soil | VQLERRPGRRFVSEVVEINHYDPDLDEYDFGVIYQARQEQP* |
| Ga0070730_104202181 | 3300005537 | Surface Soil | VVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFAAIFQSEREPL* |
| Ga0070731_102387663 | 3300005538 | Surface Soil | LNVVVQLERRPGRRFVSEVVEIRGYDPDKDQYDFAAVFPPIPEWS* |
| Ga0066704_110178521 | 3300005557 | Soil | DSLNVVVQLERRPGRRFVSEVLEIHRYAPDADEYDFGAIFQRREEPQ* |
| Ga0070762_112333181 | 3300005602 | Soil | GVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQARQEQP* |
| Ga0070765_1003839511 | 3300006176 | Soil | NVVVQLERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR* |
| Ga0066659_104607031 | 3300006797 | Soil | RPGRRYVSEVLEIRGYDPDADLFDCSAIYQKREAHA* |
| Ga0079221_106284882 | 3300006804 | Agricultural Soil | SLGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQALKEQP* |
| Ga0099791_105725732 | 3300007255 | Vadose Zone Soil | VHLDRRPGRRFVSEVLAIHCYDPDADEYEFSAIYQRHEERQ* |
| Ga0102924_11336711 | 3300007982 | Iron-Sulfur Acid Spring | DIGYSLNVVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS* |
| Ga0099828_100076011 | 3300009089 | Vadose Zone Soil | GHSLNVVVQLERRPGRRYVSEVVEIKGYDPDTDEYGFGVIFSTGRAQP* |
| Ga0116225_13107342 | 3300009524 | Peatlands Soil | SLNVVVQLERRPGRRFISEVLEIHCYDPDADEYEFSAIYQRREEPR* |
| Ga0116121_13099521 | 3300009644 | Peatland | TWDTNRRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS* |
| Ga0126373_118373002 | 3300010048 | Tropical Forest Soil | KTNIGDSVNVVVQLERRPGKRFVSEVVQIIRYNTDLDEYDFAAVYQRPQEKI* |
| Ga0134063_103053101 | 3300010335 | Grasslands Soil | TNIGDSLNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP* |
| Ga0074046_102557501 | 3300010339 | Bog Forest Soil | LNVVVQLERRPGRRFVSEVIEIHSYDPDLDEYDFGAIYQSRQEQQ* |
| Ga0126378_125324511 | 3300010361 | Tropical Forest Soil | IKTNIGDSLNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP* |
| Ga0136449_1041290972 | 3300010379 | Peatlands Soil | VVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQRQEELR* |
| Ga0137393_113876042 | 3300011271 | Vadose Zone Soil | SLNVVVQLERRPGKRFVSEVVEINRYDPDLDEYDFGVIYQSCQEQP* |
| Ga0137388_104629871 | 3300012189 | Vadose Zone Soil | RPGRRFVSEVVEINGYDPDRDEYDFGPVFLSEREPL* |
| Ga0137388_107124701 | 3300012189 | Vadose Zone Soil | GRRFVSEVLEIHRYDPDADEYDFGAIFQRHEEPQ* |
| Ga0137382_107900751 | 3300012200 | Vadose Zone Soil | TADSLGVVVQLERRPGRRFVSELVEINRYDPDLDEYDFGVIYQSRQEQP* |
| Ga0137363_110554482 | 3300012202 | Vadose Zone Soil | ERRPGRRYVSEVIEINGYDPDTDEYDFGVIFSNEREQP* |
| Ga0137362_110781751 | 3300012205 | Vadose Zone Soil | VQLERRPGRRFVSQVVEINGYDPDTDEYDFTVIFSNERDQP* |
| Ga0137362_112031212 | 3300012205 | Vadose Zone Soil | ERRPGRRFVSEVVEINGYDPDRDEYDFGPVFLSEREPL* |
| Ga0137377_107338172 | 3300012211 | Vadose Zone Soil | RPGKRFVSEVVEINRYDPDLDEYDFGVIFQARQEES* |
| Ga0137367_102148484 | 3300012353 | Vadose Zone Soil | QLERRRGRRFVSQVVEINGYDPDRDEYDFGAIFQSEREPL* |
| Ga0137360_107711751 | 3300012361 | Vadose Zone Soil | VVVQLERRPGRRFVSQVVEINGYDPDTDEYDFTVIFSNEREQP* |
| Ga0137390_105928381 | 3300012363 | Vadose Zone Soil | SLNVVVQLERRPGRRYVSEVVEINGYDPDRDEYDFGVIFSTERAQP* |
| Ga0137390_106077821 | 3300012363 | Vadose Zone Soil | QLERRPGMRFVSDVVEINGYDPDFDEYDFGPVFLSEREPL* |
| Ga0137390_107773941 | 3300012363 | Vadose Zone Soil | HSLNVVVQLERRPGRRYVSEVVEINGYDPDRDEYDFGVIFSQERAQP* |
| Ga0137390_108708391 | 3300012363 | Vadose Zone Soil | LERRPGRRFVSEVLAIHCYDPDADEYEFSAIYQKHEESR* |
| Ga0137358_104298581 | 3300012582 | Vadose Zone Soil | IGDSLNVVVQLERRPGKRFVSEVVEINRYDPDLDEFDFGVIFRARHEEP* |
| Ga0137398_102252433 | 3300012683 | Vadose Zone Soil | ERRPGIRFVSQVVEINGYDPDTDEYDFTVIFSNERKQP* |
| Ga0137398_104251742 | 3300012683 | Vadose Zone Soil | GDSLNVVVQLERRPGKRFVSEVVEINRYDPDLDEYDFGVIFQARQEES* |
| Ga0137395_102549481 | 3300012917 | Vadose Zone Soil | RPGRRFVSEVLAIHCYDPDADEYEFSAIYQKHEEPR* |
| Ga0137396_107329631 | 3300012918 | Vadose Zone Soil | DRRPGRRFVSEVLAIHCYDPDADEYEFSAIYQKNEESR* |
| Ga0137394_108270301 | 3300012922 | Vadose Zone Soil | NVVVQLERRPGKRFVSEVVEINRYDPDLDEYDFGIIYQSRQEQP* |
| Ga0153915_108960032 | 3300012931 | Freshwater Wetlands | VNVVVQLERRPGRRFVSEVLEIHRYDPDADEYDFGAIYQSRQEQP* |
| Ga0134087_107968112 | 3300012977 | Grasslands Soil | LNVVVQLERRPGKRFVSEVVEINRYDPDLDEYDFGVIFRARQEEP* |
| Ga0181523_104034001 | 3300014165 | Bog | LERRPGRRFISEVLEIHRYDPDADEYEFSAIYQRQAELR* |
| Ga0181526_104143942 | 3300014200 | Bog | KTNIGDSVNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQR* |
| Ga0181526_107121882 | 3300014200 | Bog | LNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGIIYQHRQEQP* |
| Ga0181537_108325701 | 3300014201 | Bog | IGYSLNVVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFAAIFQSEREPL* |
| Ga0182015_109150401 | 3300014495 | Palsa | PGRRFVSEVLAIHCYDPDADEYEFSAIYQKHEESR* |
| Ga0182024_117737842 | 3300014501 | Permafrost | NIGDSLNIVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQRQEELR* |
| Ga0137418_112821381 | 3300015241 | Vadose Zone Soil | IKTNIADSLNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVVYQSRQEQP* |
| Ga0182036_119211912 | 3300016270 | Soil | SVNVVVQLERRPGKRFVSEVAQIVRYDTDLDEYDFGAVYQCPLEKI |
| Ga0182041_100793561 | 3300016294 | Soil | KTNIGDSLNVVVQLERRPGRRFVSEVVEIIRYDPNLDEYDFGAIYQSRQVQP |
| Ga0182033_112773771 | 3300016319 | Soil | PGKRFVSEVVQVIRYDADLDEYDFGAVYQCPQEKP |
| Ga0182037_120240602 | 3300016404 | Soil | VQLERRPGRRFVSEVVEVNRYDPDLDEYDFGVIYQARQEEP |
| Ga0187847_101228841 | 3300017948 | Peatland | ERRPGRRFISEVLEIHRYDPDADEYEFSAIYQRQEELR |
| Ga0187817_102023381 | 3300017955 | Freshwater Sediment | IKTNTADSLGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP |
| Ga0187817_103535782 | 3300017955 | Freshwater Sediment | IKTNTADSLGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQARKEQP |
| Ga0181520_105300002 | 3300017988 | Bog | VVQLERRPGRRFISEVLEIHRYDPDADEYEFCAIYQKREELR |
| Ga0187805_102284721 | 3300018007 | Freshwater Sediment | KTNTADSLGVVVQLERRPGRRFVSEVVEINRYNPDLDEYDFGVIYQARWEQP |
| Ga0187872_102721211 | 3300018017 | Peatland | NIGDSLNIVVQLERRPGRRFISQVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0187883_101273763 | 3300018037 | Peatland | VVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0187862_105025711 | 3300018040 | Peatland | KSNIGDSLNVVVQLERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR |
| Ga0187769_104130431 | 3300018086 | Tropical Peatland | LERRPGRRFVSEVVEVNRYDPDLDEYHYGVIYQARQEQP |
| Ga0187771_103596431 | 3300018088 | Tropical Peatland | IKTNIGDSLNVVVQLERRPGKRFVSEVMEINCYDPDSDEYDYGVVYQRKADQS |
| Ga0066669_123479692 | 3300018482 | Grasslands Soil | SLGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP |
| Ga0210403_109333072 | 3300020580 | Soil | IGDSLNVVVQLERRPGWRFVSEVVEINRYDPDLDEYDFGAIYQSRQEQP |
| Ga0210399_104542502 | 3300020581 | Soil | QEQYRDSLNVVVQLERRPGRRFISEVLEIHQYDPDADEYEFSAIYQKREEPR |
| Ga0210401_110778122 | 3300020583 | Soil | KTNIGDSLNVVVQLERRPGRRFVSEVVEIIRYDPNLDEYDFGAVYQSHQEQP |
| Ga0210400_112130562 | 3300021170 | Soil | RRPGRRFVSEVLAIHCYDPDADEYEFSAIYQKREESR |
| Ga0210385_108875222 | 3300021402 | Soil | NIGDSLNVVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0210390_103682463 | 3300021474 | Soil | LERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR |
| Ga0210402_101050241 | 3300021478 | Soil | QLERRPGRRFVSEVVEIIRYDPDLDEYDFGAIYQSRQVQP |
| Ga0210402_101288893 | 3300021478 | Soil | NVVVQLERRPGRRFVSEVVEIIRYDPDLDEYDLGAIYQSRQV |
| Ga0210402_104460741 | 3300021478 | Soil | AIKTNIGDSLNVVVQLERRPGRRFVSEVVEINRYEPDLDEYDFGAVYQSHQEQP |
| Ga0210409_117102181 | 3300021559 | Soil | GHSVNVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVTYQSRQEQP |
| Ga0126371_102531573 | 3300021560 | Tropical Forest Soil | VNVVVQLERRPGRRFVSEVVQIIRYDPDLDEYDFGAVFQYPQEKK |
| Ga0126371_119779241 | 3300021560 | Tropical Forest Soil | VQLERRPGKRFVSEVLEIHRYDAAADEYDFSAIFQANGNLQ |
| Ga0209171_100885461 | 3300025320 | Iron-Sulfur Acid Spring | VQLERRPGRRYVSEVVEINGYDPDTDEYDFGVIFSNERKQP |
| Ga0207686_100980511 | 3300025934 | Miscanthus Rhizosphere | RRPGRRFVSEVVEINGYDPDRDEYDFGPVFLSEREPS |
| Ga0209647_10275935 | 3300026319 | Grasslands Soil | RRPGRRFLSEVVEINRYDPDLDEYDFGVIYQSRREQP |
| Ga0209808_10526331 | 3300026523 | Soil | ERRPGRRYVSEVLEIRGYDPDADLFDCSAIYQKREAHA |
| Ga0209648_100170916 | 3300026551 | Grasslands Soil | VNILVHLGRRPGRRFVSEVVEINHYDPDVDEYDFGVIYQSREEQPRVPSASEKQFN |
| Ga0209648_108198752 | 3300026551 | Grasslands Soil | ERRPGRRFVSEVVGINRYNPDLDEYDFGVIYQGRQEQP |
| Ga0209422_10209953 | 3300027629 | Forest Soil | IKSNIGDSLNVVVQLERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR |
| Ga0209388_11824372 | 3300027655 | Vadose Zone Soil | NIVVHLDRRPGRRFVSEVLAIHCYDPDADEYEFSAIYQKHEEPQ |
| Ga0209118_11736532 | 3300027674 | Forest Soil | VVQLERRPGRRFVSQVVEINGYDPDTDEYDFTVIFSNEREQP |
| Ga0209248_102574772 | 3300027729 | Bog Forest Soil | VQLERRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS |
| Ga0209180_106152031 | 3300027846 | Vadose Zone Soil | NVVVQLERRPGRRYVSEVVEINGYDPDTDEYDFAVIFSSERAQP |
| Ga0209067_105107541 | 3300027898 | Watersheds | SNIGDSLNVVVHLDRRPGRRFVSEVLAIHCYDPDADEYEFSAIYQKHEESR |
| Ga0209006_100329388 | 3300027908 | Forest Soil | VVQLERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR |
| Ga0209698_101748511 | 3300027911 | Watersheds | VVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRREQP |
| Ga0302224_101255971 | 3300028759 | Palsa | GDSLNVVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0302222_103930922 | 3300028798 | Palsa | ERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0311352_103909972 | 3300029944 | Palsa | NVVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKHEEPR |
| Ga0311371_118608001 | 3300029951 | Palsa | IGDSLNVVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0302179_100673291 | 3300030058 | Palsa | VVVQLERRPGRRFISEVLEIHRYDPDADEFEFSAIYQKHEELR |
| Ga0302179_101755581 | 3300030058 | Palsa | SNIGDSLDVVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0302179_105006212 | 3300030058 | Palsa | IKSNIGDSLNIVVQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQRQEELR |
| Ga0311372_109655511 | 3300030520 | Palsa | GDSLNVVVQLERRPGRRFVSEVLEIHRYDPDADEYEFSAIYQKHEESR |
| Ga0311357_107146852 | 3300030524 | Palsa | RPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0311356_104817693 | 3300030617 | Palsa | QLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0311354_103611394 | 3300030618 | Palsa | PGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0311354_111698941 | 3300030618 | Palsa | YSLNVVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFGAVFLSERESS |
| Ga0075388_115734091 | 3300030848 | Soil | ERRPGRRFVSEVVEIIRYDPDLDEYDFGAIYQSRQVQP |
| Ga0302324_1007915181 | 3300031236 | Palsa | ERRPGRRFVSQVVEIKGYDPDRDEYDFGVVFLSEREPS |
| Ga0265320_101464592 | 3300031240 | Rhizosphere | VQLERRPGRRFISEVLEIHRYDPDADEYEFSAIYQKREEPR |
| Ga0265339_104917831 | 3300031249 | Rhizosphere | LNVVVQLERRPGRRFISEVLEIHRYDPDADEYEFCAIYQKREESR |
| Ga0170820_123963151 | 3300031446 | Forest Soil | LERRPGRRFVSEVVEIIRYDPDLDEYDFAAIYQSRQVRP |
| Ga0170820_162289531 | 3300031446 | Forest Soil | NVVVQLERRPGRRFVSEVLEIHRYNPDADEYDFGAIYQSRQEQP |
| Ga0302326_111680812 | 3300031525 | Palsa | YSLTVVVQLERRPGRRFVSQVVEIKGYDPDRDEYDFGVVFLSEREPS |
| Ga0302326_136790381 | 3300031525 | Palsa | GDSLNVVVQLERRPGRRFISEVLEIHRYDPDSDEYEFSAIYQKREEPR |
| Ga0307372_102532712 | 3300031671 | Soil | LNVVVHLDRRPGRRFVSEVLAIHCFDPDADEYEFSAIYQKQEEAR |
| Ga0310686_1006581691 | 3300031708 | Soil | LDRRPGRRFVSEVLAIHCYDPDVDEYEFSAIYQKQKESR |
| Ga0310686_1130672191 | 3300031708 | Soil | LERRPGRRYVSEVVEINGYDPDTDEYDFAVIFSSERAQP |
| Ga0307474_116326622 | 3300031718 | Hardwood Forest Soil | NVVVQLERRPGRRFISEVLEIHRYDPDADEYEFCAIYQKREEAR |
| Ga0307475_105764541 | 3300031754 | Hardwood Forest Soil | LGVVVQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQARKEQP |
| Ga0306923_116890951 | 3300031910 | Soil | IKTNIGDSVNVVVQLERRPGRRFVSEVLEIHRYNPDADEYDFGPIYQSRQEQP |
| Ga0310910_101484422 | 3300031946 | Soil | VVVQLERRPGRRFVSEVVEIIRYDPDLDEYDFGAIYQSRQVQP |
| Ga0315281_115347101 | 3300032163 | Sediment | RPGRRFVSEVLEIHRYDPDADEYDFGAIYQSRQEQS |
| Ga0307472_1024290432 | 3300032205 | Hardwood Forest Soil | LQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP |
| Ga0335079_1000041829 | 3300032783 | Soil | VQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQARKEQP |
| Ga0335081_104132511 | 3300032892 | Soil | VVVQLERRPGRRFVSEVVEINGYDPDRDEYDFGAVFLSEREPL |
| Ga0335077_101590121 | 3300033158 | Soil | DSLNVVVHLDRRPGRRFVSEVLAIHCYDPDADEYEFSAIYQRREEHQ |
| Ga0310914_101832423 | 3300033289 | Soil | VQLERRPGRRFVSEVVEINRYDPDLDEYDFGVIYQSRQEQP |
| Ga0326727_102089893 | 3300033405 | Peat Soil | VQLERRPGRRFVSEVVEINRYDPDLDEYDFGTIYQSRQEQP |
| ⦗Top⦘ |