


| Basic Information | |
|---|---|
| Family ID | F063738 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.55 % |
| % of genes near scaffold ends (potentially truncated) | 93.80 % |
| % of genes from short scaffolds (< 2000 bps) | 88.37 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.922 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.209 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.11% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF06537 | DHOR | 4.65 |
| PF01401 | Peptidase_M2 | 3.10 |
| PF03972 | MmgE_PrpD | 2.33 |
| PF01476 | LysM | 2.33 |
| PF07452 | CHRD | 1.55 |
| PF00583 | Acetyltransf_1 | 1.55 |
| PF00892 | EamA | 1.55 |
| PF02540 | NAD_synthase | 1.55 |
| PF02882 | THF_DHG_CYH_C | 1.55 |
| PF00106 | adh_short | 0.78 |
| PF00092 | VWA | 0.78 |
| PF13523 | Acetyltransf_8 | 0.78 |
| PF13483 | Lactamase_B_3 | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF13570 | PQQ_3 | 0.78 |
| PF01494 | FAD_binding_3 | 0.78 |
| PF01565 | FAD_binding_4 | 0.78 |
| PF01272 | GreA_GreB | 0.78 |
| PF04909 | Amidohydro_2 | 0.78 |
| PF05195 | AMP_N | 0.78 |
| PF00591 | Glycos_transf_3 | 0.78 |
| PF00753 | Lactamase_B | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF07690 | MFS_1 | 0.78 |
| PF16561 | AMPK1_CBM | 0.78 |
| PF00350 | Dynamin_N | 0.78 |
| PF00575 | S1 | 0.78 |
| PF02021 | UPF0102 | 0.78 |
| PF00924 | MS_channel | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 4.65 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 2.33 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.55 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 1.55 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.55 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 1.55 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.78 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.78 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.78 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.78 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.78 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.92 % |
| Unclassified | root | N/A | 10.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_14495220 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300001850|RCM37_1046090 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300003324|soilH2_10019203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7751 | Open in IMG/M |
| 3300004479|Ga0062595_100866919 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005093|Ga0062594_100824410 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005172|Ga0066683_10296482 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005218|Ga0068996_10146396 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005290|Ga0065712_10157452 | Not Available | 1317 | Open in IMG/M |
| 3300005354|Ga0070675_100078101 | All Organisms → cellular organisms → Bacteria | 2756 | Open in IMG/M |
| 3300005354|Ga0070675_100118956 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300005364|Ga0070673_100524130 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005364|Ga0070673_100812677 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005406|Ga0070703_10381981 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005437|Ga0070710_11407934 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005440|Ga0070705_100215963 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005444|Ga0070694_100359767 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300005444|Ga0070694_100428266 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005458|Ga0070681_10157707 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300005547|Ga0070693_101423356 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005549|Ga0070704_100398211 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300005598|Ga0066706_10107892 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300005614|Ga0068856_102057766 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005615|Ga0070702_101312473 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005617|Ga0068859_101183123 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005617|Ga0068859_101936236 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005618|Ga0068864_100522772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1144 | Open in IMG/M |
| 3300005719|Ga0068861_100168257 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300005764|Ga0066903_107377574 | Not Available | 568 | Open in IMG/M |
| 3300005843|Ga0068860_100756161 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300006031|Ga0066651_10810924 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006046|Ga0066652_102057610 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006049|Ga0075417_10036590 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300006358|Ga0068871_100468736 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300006844|Ga0075428_101788916 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006844|Ga0075428_102656653 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006852|Ga0075433_10570098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300006871|Ga0075434_100144481 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300006880|Ga0075429_101651228 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006904|Ga0075424_101959051 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009098|Ga0105245_10772187 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300009100|Ga0075418_12219339 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009101|Ga0105247_10171519 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300009147|Ga0114129_10004958 | All Organisms → cellular organisms → Bacteria | 18771 | Open in IMG/M |
| 3300009147|Ga0114129_10801028 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300009148|Ga0105243_11128372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300009162|Ga0075423_10166742 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300009162|Ga0075423_11059767 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300009162|Ga0075423_12941858 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009176|Ga0105242_11845509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 644 | Open in IMG/M |
| 3300009177|Ga0105248_11117354 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300009678|Ga0105252_10068540 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300009813|Ga0105057_1072611 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010047|Ga0126382_10370408 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300010159|Ga0099796_10366904 | Not Available | 624 | Open in IMG/M |
| 3300010359|Ga0126376_12269251 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010399|Ga0134127_13632487 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010400|Ga0134122_13045879 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010403|Ga0134123_10371931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis | 1299 | Open in IMG/M |
| 3300011119|Ga0105246_10723845 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012207|Ga0137381_10346957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
| 3300012212|Ga0150985_105822866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012350|Ga0137372_10354653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012469|Ga0150984_100284061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1044 | Open in IMG/M |
| 3300012469|Ga0150984_110291706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300012508|Ga0157315_1041670 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012509|Ga0157334_1068830 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012685|Ga0137397_10617992 | Not Available | 806 | Open in IMG/M |
| 3300012891|Ga0157305_10159315 | Not Available | 615 | Open in IMG/M |
| 3300012902|Ga0157291_10344594 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012924|Ga0137413_10545597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 860 | Open in IMG/M |
| 3300013102|Ga0157371_11003348 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300013306|Ga0163162_10018801 | All Organisms → cellular organisms → Bacteria | 6774 | Open in IMG/M |
| 3300014166|Ga0134079_10061220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1350 | Open in IMG/M |
| 3300014325|Ga0163163_13089102 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300014745|Ga0157377_10064182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2106 | Open in IMG/M |
| 3300014745|Ga0157377_10534748 | Not Available | 825 | Open in IMG/M |
| 3300014745|Ga0157377_10612246 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300014968|Ga0157379_10779120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300014969|Ga0157376_10842606 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300015371|Ga0132258_12329749 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300015371|Ga0132258_13666653 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300015372|Ga0132256_103092384 | Not Available | 559 | Open in IMG/M |
| 3300015373|Ga0132257_102201711 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300015374|Ga0132255_103695837 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300018028|Ga0184608_10273204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300018058|Ga0187766_11214630 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018060|Ga0187765_11237956 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018079|Ga0184627_10033608 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300018084|Ga0184629_10572207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 579 | Open in IMG/M |
| 3300018468|Ga0066662_10687513 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300018482|Ga0066669_11082834 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021081|Ga0210379_10246103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300021082|Ga0210380_10335075 | Not Available | 690 | Open in IMG/M |
| 3300021445|Ga0182009_10215079 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021477|Ga0210398_11511367 | Not Available | 522 | Open in IMG/M |
| 3300022563|Ga0212128_10634700 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10249151 | Not Available | 699 | Open in IMG/M |
| 3300025885|Ga0207653_10117468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300025893|Ga0207682_10186215 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300025898|Ga0207692_11108154 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025900|Ga0207710_10375789 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 727 | Open in IMG/M |
| 3300025903|Ga0207680_10180384 | Not Available | 1427 | Open in IMG/M |
| 3300025910|Ga0207684_10176738 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300025912|Ga0207707_11018436 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025918|Ga0207662_10498149 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300025920|Ga0207649_10079030 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300025923|Ga0207681_10841102 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025923|Ga0207681_11821489 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025932|Ga0207690_11432619 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300025934|Ga0207686_11306139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300025936|Ga0207670_10430375 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300025938|Ga0207704_10863490 | Not Available | 759 | Open in IMG/M |
| 3300025960|Ga0207651_10972493 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025960|Ga0207651_11236638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 671 | Open in IMG/M |
| 3300026078|Ga0207702_12328040 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026095|Ga0207676_10071534 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300026121|Ga0207683_11160488 | Not Available | 716 | Open in IMG/M |
| 3300026315|Ga0209686_1067887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300027669|Ga0208981_1029624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. DK17 | 1399 | Open in IMG/M |
| 3300027873|Ga0209814_10035527 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300028381|Ga0268264_10384343 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300028884|Ga0307308_10593877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 531 | Open in IMG/M |
| 3300031547|Ga0310887_11025355 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031720|Ga0307469_10638003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300031731|Ga0307405_12151957 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032000|Ga0310903_10552936 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300032075|Ga0310890_11103428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300032091|Ga0318577_10536022 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300034149|Ga0364929_0051670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.78% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_144952202 | 3300000953 | Soil | PAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVAE* |
| RCM37_10460902 | 3300001850 | Marine Plankton | WEVPADAPIGAWSYTVTATDRFGRTATFNPFPNHLSQLTIVE* |
| soilH2_100192034 | 3300003324 | Sugarcane Root And Bulk Soil | VGGFPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0062595_1008669192 | 3300004479 | Soil | GGFPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTASDRFGRTATFSPFINVVPQLTIVE* |
| Ga0062594_1008244102 | 3300005093 | Soil | VPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0066683_102964821 | 3300005172 | Soil | AEYSRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTAAFSPFINEVSQIAIVE* |
| Ga0068996_101463961 | 3300005218 | Natural And Restored Wetlands | GGFPAAEYPRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0065712_101574521 | 3300005290 | Miscanthus Rhizosphere | VPADAQPATLSYTVTATDRFGRTATFSPFINLVSQITIVE* |
| Ga0070675_1000781011 | 3300005354 | Miscanthus Rhizosphere | AEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0070675_1001189561 | 3300005354 | Miscanthus Rhizosphere | VVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQITIVE* |
| Ga0070673_1005241301 | 3300005364 | Switchgrass Rhizosphere | EMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE* |
| Ga0070673_1008126772 | 3300005364 | Switchgrass Rhizosphere | SEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTASFSPFINVVPQLTIVAE* |
| Ga0070703_103819812 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0070710_114079341 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEN* |
| Ga0070705_1002159633 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE* |
| Ga0070694_1003597673 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PMDAQSGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE* |
| Ga0070694_1004282662 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE* |
| Ga0070681_101577074 | 3300005458 | Corn Rhizosphere | PRQPSEMWTGVWVVPMDAQPARLSYTVTATDNFGRTATFSPFVNVVPQLTIVE* |
| Ga0070693_1014233561 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VPMDAQPGKLSYTVTATDQFGRSATFSPFINVVPQLTIVAE* |
| Ga0070704_1003982113 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVIPQLTIVE* |
| Ga0066706_101078921 | 3300005598 | Soil | GGFPAAEYSRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTAAFSPFINEVSQIAIVE* |
| Ga0068856_1020577662 | 3300005614 | Corn Rhizosphere | QPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0070702_1013124732 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE* |
| Ga0068859_1011831232 | 3300005617 | Switchgrass Rhizosphere | SEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE* |
| Ga0068859_1019362361 | 3300005617 | Switchgrass Rhizosphere | VPADAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ* |
| Ga0068864_1005227721 | 3300005618 | Switchgrass Rhizosphere | SEMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE* |
| Ga0068861_1001682571 | 3300005719 | Switchgrass Rhizosphere | QPATLSYTVTATDRFGRTATFSPFINLAAQITIVE* |
| Ga0066903_1073775742 | 3300005764 | Tropical Forest Soil | PMDAPPGVLKYTVTATDRFNRAASFSPFINTVSQLSIVE* |
| Ga0068860_1007561612 | 3300005843 | Switchgrass Rhizosphere | DQMWTGAWNVPADAPIGTIVYTVTATDRFGRTATFSPFINVLSQFTIVDQ* |
| Ga0066651_108109241 | 3300006031 | Soil | WVVPMDAAPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE* |
| Ga0066652_1020576102 | 3300006046 | Soil | GFPAEEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDQFGRSATFSPFINVVPQLTVVAE* |
| Ga0075417_100365903 | 3300006049 | Populus Rhizosphere | VWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE* |
| Ga0068871_1004687362 | 3300006358 | Miscanthus Rhizosphere | QMWTGAWNVPADAPIGAIVYTVTATDRFGRTATFSPFINLVSQFTIVE* |
| Ga0075428_1017889162 | 3300006844 | Populus Rhizosphere | MDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0075428_1026566532 | 3300006844 | Populus Rhizosphere | PMDATPATLSYTVTATDRFGRTANFLPFSYENSQLTIVQ* |
| Ga0075433_105700983 | 3300006852 | Populus Rhizosphere | EYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0075434_1001444811 | 3300006871 | Populus Rhizosphere | PGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE* |
| Ga0075429_1016512282 | 3300006880 | Populus Rhizosphere | YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0075424_1019590511 | 3300006904 | Populus Rhizosphere | VWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE* |
| Ga0105245_107721873 | 3300009098 | Miscanthus Rhizosphere | GGCPASEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0075418_122193391 | 3300009100 | Populus Rhizosphere | PMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE* |
| Ga0105247_101715191 | 3300009101 | Switchgrass Rhizosphere | ADAPIGTITYTVTATDRFGRTASFSPFINHVSQFTIVEQ* |
| Ga0114129_1000495813 | 3300009147 | Populus Rhizosphere | MWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE* |
| Ga0114129_108010283 | 3300009147 | Populus Rhizosphere | PTDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE* |
| Ga0105243_111283722 | 3300009148 | Miscanthus Rhizosphere | NFPASEYSRQPSEMWTGAWNVPPDAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ* |
| Ga0075423_101667421 | 3300009162 | Populus Rhizosphere | MWTGVWVVPMDAQPGRLSYTVTATDQFGRTATFNPFPNIVPQLTIVE* |
| Ga0075423_110597672 | 3300009162 | Populus Rhizosphere | GFPAAEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDKFGRMATFSPFINVIPQLTIVAE* |
| Ga0075423_129418581 | 3300009162 | Populus Rhizosphere | QPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE* |
| Ga0105242_118455092 | 3300009176 | Miscanthus Rhizosphere | VPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0105248_111173542 | 3300009177 | Switchgrass Rhizosphere | ARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE* |
| Ga0105252_100685401 | 3300009678 | Soil | GGFPAAEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0105057_10726111 | 3300009813 | Groundwater Sand | APPGALSYTVTATDRFNRTASFSPFINVVSQLTIVE* |
| Ga0126382_103704083 | 3300010047 | Tropical Forest Soil | QPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE* |
| Ga0099796_103669042 | 3300010159 | Vadose Zone Soil | AADTPIGTINYTVTATDRFGRSATFSPFINSASQLTIVEQ* |
| Ga0126376_122692511 | 3300010359 | Tropical Forest Soil | ADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVE* |
| Ga0134127_136324872 | 3300010399 | Terrestrial Soil | YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE* |
| Ga0134122_130458791 | 3300010400 | Terrestrial Soil | AMPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE* |
| Ga0134123_103719311 | 3300010403 | Terrestrial Soil | PTGTLSYTVTATAKFGRNASFTQFSADASQIVIVQ* |
| Ga0105246_107238453 | 3300011119 | Miscanthus Rhizosphere | FPAAEYPRQPSEMWTGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0137381_103469571 | 3300012207 | Vadose Zone Soil | EMWTGVWVVPTDAAPGRLSYTVTATDRFGRTASFSPFINVVPQLTIVE* |
| Ga0150985_1058228662 | 3300012212 | Avena Fatua Rhizosphere | GAWVVPADAPIGAIAYTVTATDAFGRNATFSPFINVLSQFTIVEQ* |
| Ga0137372_103546531 | 3300012350 | Vadose Zone Soil | AWVIPMDAPVGTIKYTVTATDRFNRTASFSPFPNVVSQFTIVE* |
| Ga0150984_1002840611 | 3300012469 | Avena Fatua Rhizosphere | MDAQIGKLSYTVTATDRFGRTATFSPFINEVSQIEIVE* |
| Ga0150984_1102917062 | 3300012469 | Avena Fatua Rhizosphere | SEYPRQPSEMWTGAWVVPADAPLGVIKYTVTATDRFGRTASFSPFINVVSQFTIVE* |
| Ga0157315_10416701 | 3300012508 | Arabidopsis Rhizosphere | MDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE* |
| Ga0157334_10688302 | 3300012509 | Soil | QPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE* |
| Ga0137397_106179922 | 3300012685 | Vadose Zone Soil | SEMWTGVWTVPADAAAGRLSYTVTATDRFGRTASFTPFINLVPQLTIVE* |
| Ga0157305_101593151 | 3300012891 | Soil | TGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0157291_103445942 | 3300012902 | Soil | FPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVE* |
| Ga0137413_105455971 | 3300012924 | Vadose Zone Soil | VVPADAQPAVLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0157371_110033481 | 3300013102 | Corn Rhizosphere | QPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0163162_100188016 | 3300013306 | Switchgrass Rhizosphere | DAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE* |
| Ga0134079_100612201 | 3300014166 | Grasslands Soil | AAEYPRQPSEMWTGVWVVPMDAAPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE* |
| Ga0163163_130891021 | 3300014325 | Switchgrass Rhizosphere | GITIRYTVTATDRFRRTATFTPFPAVPSQLTIVE* |
| Ga0157377_100641823 | 3300014745 | Miscanthus Rhizosphere | MDAQPATLSYTVTATDRFGRTATCSPFINLAAQITIVE* |
| Ga0157377_105347482 | 3300014745 | Miscanthus Rhizosphere | MWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0157377_106122461 | 3300014745 | Miscanthus Rhizosphere | PRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0157379_107791201 | 3300014968 | Switchgrass Rhizosphere | SEYPRQPSEMWTGAWVVPADAPIGVISYTVTATDRFNRTATFSPFINLVSQFTIVE* |
| Ga0157376_108426063 | 3300014969 | Miscanthus Rhizosphere | VWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0132258_123297493 | 3300015371 | Arabidopsis Rhizosphere | GRTPGPADAQPGALSYTVTATDRFGRTASFSPFINLVSQITVVE* |
| Ga0132258_136666533 | 3300015371 | Arabidopsis Rhizosphere | FPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0132256_1030923842 | 3300015372 | Arabidopsis Rhizosphere | AEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE* |
| Ga0132257_1022017112 | 3300015373 | Arabidopsis Rhizosphere | EMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0132255_1036958372 | 3300015374 | Arabidopsis Rhizosphere | RQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE* |
| Ga0184608_102732041 | 3300018028 | Groundwater Sediment | PSEMWTGAWNVPADAPIGTITYTVTATDRFGRTATFSPFINHVSQFTIVEQ |
| Ga0187766_112146302 | 3300018058 | Tropical Peatland | MWTGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEQ |
| Ga0187765_112379561 | 3300018060 | Tropical Peatland | ADAPPAALSYTVTATDRFGRTATFSPFINLVSQIAIVEQ |
| Ga0184627_100336084 | 3300018079 | Groundwater Sediment | DAPIGRLSYTVTATDRFGRTAAFTPFPNLESQLAIVE |
| Ga0184629_105722072 | 3300018084 | Groundwater Sediment | EMWTGVWTVPADAPIGRLSYTVTATDRFGRAASFTPFPNLEAQLTIVE |
| Ga0066662_106875131 | 3300018468 | Grasslands Soil | PSEMWTGVWLVPADAQPAVLSYTVTATDRFGRAATFSPFINLASQIAIVE |
| Ga0066669_110828341 | 3300018482 | Grasslands Soil | APGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE |
| Ga0210379_102461032 | 3300021081 | Groundwater Sediment | VPADTPIGVINYTVTATDRFGRTATFTPFINLVSQLTIVE |
| Ga0210380_103350751 | 3300021082 | Groundwater Sediment | DAQPAALSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0182009_102150793 | 3300021445 | Soil | EYPRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTATFTPFINEVSHITIVEQ |
| Ga0210398_115113672 | 3300021477 | Soil | VPADAQPGGLSYTVTATDRFGRTATFSPFVNVVSQIAIVE |
| Ga0212128_106347001 | 3300022563 | Thermal Springs | DAPTATFSYTVTAKDQFGRTATFEPFSYNTSQLTIVE |
| (restricted) Ga0233424_102491512 | 3300023208 | Freshwater | DDAPIGSLSYTVTATDRFGRTASFTPFPNVMSQLAIVEN |
| Ga0207653_101174682 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQPGRLSYTVTATDRFGRTATFNPFINVVPQLTIVAE |
| Ga0207682_101862152 | 3300025893 | Miscanthus Rhizosphere | ADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0207692_111081542 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEN |
| Ga0207710_103757891 | 3300025900 | Switchgrass Rhizosphere | QPSEMWTGVWTVPADTPIGVINYTVTAVDRFGRTASFSPFINSVSQLAIVE |
| Ga0207680_101803844 | 3300025903 | Switchgrass Rhizosphere | TGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0207684_101767381 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVIPQLTIVE |
| Ga0207707_110184362 | 3300025912 | Corn Rhizosphere | MWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIV |
| Ga0207662_104981492 | 3300025918 | Switchgrass Rhizosphere | MWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVE |
| Ga0207649_100790301 | 3300025920 | Corn Rhizosphere | VPMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE |
| Ga0207681_108411022 | 3300025923 | Switchgrass Rhizosphere | PMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE |
| Ga0207681_118214892 | 3300025923 | Switchgrass Rhizosphere | WNVPPDAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ |
| Ga0207690_114326191 | 3300025932 | Corn Rhizosphere | WVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE |
| Ga0207686_113061392 | 3300025934 | Miscanthus Rhizosphere | TPIGPIVYTVTATDRFGRTASFSPFINLVSQFTIVEQ |
| Ga0207670_104303753 | 3300025936 | Switchgrass Rhizosphere | EMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE |
| Ga0207704_108634901 | 3300025938 | Miscanthus Rhizosphere | GVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0207651_109724931 | 3300025960 | Switchgrass Rhizosphere | EMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE |
| Ga0207651_112366382 | 3300025960 | Switchgrass Rhizosphere | LWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQ |
| Ga0207702_123280401 | 3300026078 | Corn Rhizosphere | GVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE |
| Ga0207676_100715341 | 3300026095 | Switchgrass Rhizosphere | VWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE |
| Ga0207683_111604882 | 3300026121 | Miscanthus Rhizosphere | WTGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0209686_10678873 | 3300026315 | Soil | PSEMWTGVWVVPMDAQPGKLSYTVTATDQFGRSATFTPFINVVPQPTIVE |
| Ga0208981_10296241 | 3300027669 | Forest Soil | PSEMWTGVWVVAADTPIGTINYTVTATDRFGRSATFSPFINSASQLAIVEQ |
| Ga0209814_100355271 | 3300027873 | Populus Rhizosphere | VWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE |
| Ga0268264_103843431 | 3300028381 | Switchgrass Rhizosphere | EMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE |
| Ga0307308_105938772 | 3300028884 | Soil | GVWNVPPDAPIGTINYTVTATDRFGRTASFSPFINVVSQLAVVE |
| Ga0310887_110253552 | 3300031547 | Soil | VRDVDGSMVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0307469_106380031 | 3300031720 | Hardwood Forest Soil | GVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE |
| Ga0307405_121519572 | 3300031731 | Rhizosphere | MDAPTGTLSYTVTATDRFGRTASFVPFSYETSQLTIVP |
| Ga0310903_105529362 | 3300032000 | Soil | GGFPAAEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIV |
| Ga0310890_111034282 | 3300032075 | Soil | VVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE |
| Ga0318577_105360222 | 3300032091 | Soil | PSEMWTGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVE |
| Ga0364929_0051670_1_117 | 3300034149 | Sediment | ADTPIGVINYTVTATDRFGRTATFTPFINLVSQLTIVE |
| ⦗Top⦘ |