


| Basic Information | |
|---|---|
| Family ID | F063645 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 39 residues |
| Representative Sequence | INNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 90.70 % |
| % of genes from short scaffolds (< 2000 bps) | 93.02 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.938 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (56.589 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.969 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.597 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 8.96% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 82.95 |
| PF00622 | SPRY | 4.65 |
| PF07460 | NUMOD3 | 0.78 |
| PF01381 | HTH_3 | 0.78 |
| PF01844 | HNH | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.94 % |
| All Organisms | root | All Organisms | 48.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10069331 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10147467 | Not Available | 810 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10147479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 810 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10160474 | Not Available | 759 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10142159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 805 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10142588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10197125 | Not Available | 622 | Open in IMG/M |
| 3300000949|BBAY94_10108724 | Not Available | 758 | Open in IMG/M |
| 3300001846|ACM22_1047598 | Not Available | 854 | Open in IMG/M |
| 3300005057|Ga0068511_1086007 | Not Available | 550 | Open in IMG/M |
| 3300006025|Ga0075474_10071922 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300006025|Ga0075474_10093469 | Not Available | 976 | Open in IMG/M |
| 3300006029|Ga0075466_1049161 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300006029|Ga0075466_1099454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → unclassified Votkovvirus → Pelagibacter phage HTVC200P | 790 | Open in IMG/M |
| 3300006637|Ga0075461_10111108 | Not Available | 857 | Open in IMG/M |
| 3300006735|Ga0098038_1145109 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 793 | Open in IMG/M |
| 3300006736|Ga0098033_1018292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 2188 | Open in IMG/M |
| 3300006736|Ga0098033_1028942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1689 | Open in IMG/M |
| 3300006737|Ga0098037_1070051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1241 | Open in IMG/M |
| 3300006802|Ga0070749_10164791 | Not Available | 1283 | Open in IMG/M |
| 3300006802|Ga0070749_10289230 | Not Available | 921 | Open in IMG/M |
| 3300006802|Ga0070749_10354208 | Not Available | 815 | Open in IMG/M |
| 3300006802|Ga0070749_10696857 | Not Available | 543 | Open in IMG/M |
| 3300006810|Ga0070754_10198546 | Not Available | 936 | Open in IMG/M |
| 3300006810|Ga0070754_10250548 | Not Available | 809 | Open in IMG/M |
| 3300006810|Ga0070754_10274264 | Not Available | 764 | Open in IMG/M |
| 3300006810|Ga0070754_10287306 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 741 | Open in IMG/M |
| 3300006916|Ga0070750_10270761 | Not Available | 733 | Open in IMG/M |
| 3300006919|Ga0070746_10246665 | Not Available | 835 | Open in IMG/M |
| 3300007276|Ga0070747_1173240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 769 | Open in IMG/M |
| 3300007344|Ga0070745_1155878 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 863 | Open in IMG/M |
| 3300007344|Ga0070745_1261210 | Not Available | 624 | Open in IMG/M |
| 3300007344|Ga0070745_1339517 | Not Available | 529 | Open in IMG/M |
| 3300007345|Ga0070752_1196026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 807 | Open in IMG/M |
| 3300007345|Ga0070752_1283460 | Not Available | 635 | Open in IMG/M |
| 3300007346|Ga0070753_1167793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 825 | Open in IMG/M |
| 3300007346|Ga0070753_1215074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Mycoplasmatota bacterium | 707 | Open in IMG/M |
| 3300007538|Ga0099851_1028953 | All Organisms → Viruses → Predicted Viral | 2223 | Open in IMG/M |
| 3300007538|Ga0099851_1035082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1999 | Open in IMG/M |
| 3300007538|Ga0099851_1147685 | Not Available | 876 | Open in IMG/M |
| 3300007538|Ga0099851_1167257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 813 | Open in IMG/M |
| 3300007538|Ga0099851_1276407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 596 | Open in IMG/M |
| 3300007538|Ga0099851_1280898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 590 | Open in IMG/M |
| 3300007539|Ga0099849_1025291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2566 | Open in IMG/M |
| 3300007539|Ga0099849_1309870 | Not Available | 568 | Open in IMG/M |
| 3300007540|Ga0099847_1108669 | Not Available | 841 | Open in IMG/M |
| 3300007540|Ga0099847_1119310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 795 | Open in IMG/M |
| 3300007542|Ga0099846_1143171 | Not Available | 863 | Open in IMG/M |
| 3300007542|Ga0099846_1146453 | Not Available | 851 | Open in IMG/M |
| 3300007960|Ga0099850_1146308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 953 | Open in IMG/M |
| 3300007960|Ga0099850_1226060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300008012|Ga0075480_10264159 | Not Available | 885 | Open in IMG/M |
| 3300008012|Ga0075480_10272896 | Not Available | 867 | Open in IMG/M |
| 3300008012|Ga0075480_10319495 | Not Available | 783 | Open in IMG/M |
| 3300008012|Ga0075480_10330261 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Korarchaeota archaeon | 766 | Open in IMG/M |
| 3300008050|Ga0098052_1244183 | Not Available | 688 | Open in IMG/M |
| 3300008259|Ga0114841_1012656 | All Organisms → Viruses → Predicted Viral | 4497 | Open in IMG/M |
| 3300009001|Ga0102963_1075683 | Not Available | 1379 | Open in IMG/M |
| 3300009001|Ga0102963_1196111 | Not Available | 806 | Open in IMG/M |
| 3300009149|Ga0114918_10105523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1743 | Open in IMG/M |
| 3300009790|Ga0115012_10831006 | All Organisms → Viruses | 751 | Open in IMG/M |
| 3300010148|Ga0098043_1035611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1555 | Open in IMG/M |
| 3300010153|Ga0098059_1328459 | Not Available | 582 | Open in IMG/M |
| 3300010155|Ga0098047_10054662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1575 | Open in IMG/M |
| 3300010299|Ga0129342_1174023 | Not Available | 775 | Open in IMG/M |
| 3300010300|Ga0129351_1289884 | Not Available | 620 | Open in IMG/M |
| 3300017714|Ga0181412_1122681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 598 | Open in IMG/M |
| 3300017717|Ga0181404_1047870 | Not Available | 1080 | Open in IMG/M |
| 3300017749|Ga0181392_1034904 | Not Available | 1572 | Open in IMG/M |
| 3300017773|Ga0181386_1107338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 868 | Open in IMG/M |
| 3300017952|Ga0181583_10467094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300017987|Ga0180431_10807818 | Not Available | 627 | Open in IMG/M |
| 3300018041|Ga0181601_10098515 | All Organisms → Viruses → Predicted Viral | 1897 | Open in IMG/M |
| 3300018048|Ga0181606_10265660 | Not Available | 963 | Open in IMG/M |
| 3300018428|Ga0181568_11307409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 541 | Open in IMG/M |
| 3300020436|Ga0211708_10266678 | Not Available | 693 | Open in IMG/M |
| 3300020810|Ga0181598_1180115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 826 | Open in IMG/M |
| 3300021368|Ga0213860_10000613 | All Organisms → Viruses | 14324 | Open in IMG/M |
| 3300021958|Ga0222718_10084762 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
| 3300021958|Ga0222718_10352810 | Not Available | 748 | Open in IMG/M |
| 3300021959|Ga0222716_10739892 | Not Available | 517 | Open in IMG/M |
| 3300021960|Ga0222715_10255425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1017 | Open in IMG/M |
| 3300021960|Ga0222715_10369061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 793 | Open in IMG/M |
| 3300021960|Ga0222715_10375837 | Not Available | 784 | Open in IMG/M |
| 3300021960|Ga0222715_10497713 | Not Available | 647 | Open in IMG/M |
| 3300021961|Ga0222714_10527290 | Not Available | 601 | Open in IMG/M |
| 3300021964|Ga0222719_10095591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2178 | Open in IMG/M |
| 3300021964|Ga0222719_10257102 | Not Available | 1157 | Open in IMG/M |
| 3300021964|Ga0222719_10302189 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300022063|Ga0212029_1056337 | Not Available | 572 | Open in IMG/M |
| 3300022065|Ga0212024_1048638 | Not Available | 742 | Open in IMG/M |
| 3300022068|Ga0212021_1046250 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 877 | Open in IMG/M |
| 3300022068|Ga0212021_1137092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium | 500 | Open in IMG/M |
| 3300022187|Ga0196899_1103506 | Not Available | 840 | Open in IMG/M |
| 3300022907|Ga0255775_1117617 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300022921|Ga0255765_1153325 | Not Available | 1088 | Open in IMG/M |
| 3300022923|Ga0255783_10175182 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300025108|Ga0208793_1182770 | Not Available | 535 | Open in IMG/M |
| 3300025133|Ga0208299_1165391 | Not Available | 683 | Open in IMG/M |
| 3300025508|Ga0208148_1076489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → unclassified Votkovvirus → Pelagibacter phage HTVC200P | 764 | Open in IMG/M |
| 3300025543|Ga0208303_1074303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED128 | 766 | Open in IMG/M |
| 3300025543|Ga0208303_1095532 | Not Available | 636 | Open in IMG/M |
| 3300025543|Ga0208303_1114625 | Not Available | 551 | Open in IMG/M |
| 3300025646|Ga0208161_1021893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 2389 | Open in IMG/M |
| 3300025646|Ga0208161_1099739 | Not Available | 802 | Open in IMG/M |
| 3300025647|Ga0208160_1036414 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300025647|Ga0208160_1085293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 840 | Open in IMG/M |
| 3300025652|Ga0208134_1103416 | Not Available | 783 | Open in IMG/M |
| 3300025671|Ga0208898_1022771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 2721 | Open in IMG/M |
| 3300025671|Ga0208898_1113069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED128 | 799 | Open in IMG/M |
| 3300025674|Ga0208162_1081437 | Not Available | 1001 | Open in IMG/M |
| 3300025674|Ga0208162_1184198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 543 | Open in IMG/M |
| 3300025759|Ga0208899_1175575 | Not Available | 705 | Open in IMG/M |
| 3300025769|Ga0208767_1148831 | Not Available | 855 | Open in IMG/M |
| 3300025818|Ga0208542_1038604 | Not Available | 1526 | Open in IMG/M |
| 3300025828|Ga0208547_1132042 | Not Available | 731 | Open in IMG/M |
| 3300025853|Ga0208645_1204157 | Not Available | 697 | Open in IMG/M |
| 3300025889|Ga0208644_1086226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1590 | Open in IMG/M |
| 3300025889|Ga0208644_1197061 | Not Available | 878 | Open in IMG/M |
| 3300026187|Ga0209929_1132301 | Not Available | 622 | Open in IMG/M |
| 3300031539|Ga0307380_10224578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1795 | Open in IMG/M |
| 3300031578|Ga0307376_10516823 | Not Available | 770 | Open in IMG/M |
| 3300034374|Ga0348335_038464 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300034374|Ga0348335_038623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1984 | Open in IMG/M |
| 3300034374|Ga0348335_046125 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300034374|Ga0348335_056148 | Not Available | 1480 | Open in IMG/M |
| 3300034375|Ga0348336_022807 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3170 | Open in IMG/M |
| 3300034375|Ga0348336_042673 | Not Available | 1963 | Open in IMG/M |
| 3300034375|Ga0348336_114964 | Not Available | 875 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 56.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.53% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.20% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.10% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.33% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.78% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.78% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.78% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.78% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.78% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100693311 | 3300000115 | Marine | TVDELKALYEYTNTGTEANPVITRPLAEFPTLEN* |
| DelMOSpr2010_101474671 | 3300000116 | Marine | EMETMINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI* |
| DelMOSpr2010_101474791 | 3300000116 | Marine | MINNCTTVDELKALYEYTNTGTEQNPVMTRPLPSFPKEVI* |
| DelMOSpr2010_101604741 | 3300000116 | Marine | INNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| DelMOWin2010_101421591 | 3300000117 | Marine | METQIDACTTVDELKALYEYTNTGTEANPVITRLLAEFPEEI* |
| DelMOWin2010_101425881 | 3300000117 | Marine | METQIDACTTVDELKALYEYTTQEDGTQTRPMPEFPEEI* |
| DelMOWin2010_101971252 | 3300000117 | Marine | IDGATNVEELKALFEYTNTGTEANPVYTRPLSEFPVK* |
| BBAY94_101087242 | 3300000949 | Macroalgal Surface | METMIDNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPTEVI* |
| ACM22_10475981 | 3300001846 | Marine Plankton | TQIDACTNVDELKVLYEYTEQEDGTFTRPLPEFPTLEN* |
| Ga0068511_10860071 | 3300005057 | Marine Water | SNEMENQINACTTVDELKALYEYTEDAEGNITRPLAEFPKTEVL* |
| Ga0075474_100719222 | 3300006025 | Aqueous | QIDGATNVDELKALFEYTNTGTEANPVYTRPLGEFPVK* |
| Ga0075474_100934692 | 3300006025 | Aqueous | KSNEMETQINACTTVDELKALYEYTEQENGTFTRPLAEFPEGL* |
| Ga0075466_10491611 | 3300006029 | Aqueous | CTTVDELKALYEYTNTGTESDPVIERPLAEFPIFNE* |
| Ga0075466_10994541 | 3300006029 | Aqueous | NCTTVDELKALYEYTNTGTEANPVITRPLAEFPEEI* |
| Ga0075461_101111081 | 3300006637 | Aqueous | DNCTTVDELKALYEYTEQEDGTITRPLPEFPKEVI* |
| Ga0098038_11451092 | 3300006735 | Marine | IDNCTTVDELKALYEYTTQEDGTQTRLMPEFPKEI* |
| Ga0098033_10182921 | 3300006736 | Marine | AKIDACTTVDELKTLYEYVNTGTEENRVMERPLGEFPKEI* |
| Ga0098033_10289423 | 3300006736 | Marine | NACTTVDELKTLYEYVNTGTEENRVMERPLGEFPKEI* |
| Ga0098037_10700511 | 3300006737 | Marine | ETQIDACTNVDELKALYEYTRQEDGTTTRPLAEFPKEI* |
| Ga0070749_101647912 | 3300006802 | Aqueous | METQINACMTVDELKALYEYTEDAEGNITRPLAEFPEEL* |
| Ga0070749_102892302 | 3300006802 | Aqueous | EMETMINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI* |
| Ga0070749_103542082 | 3300006802 | Aqueous | CTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0070749_106968571 | 3300006802 | Aqueous | TMIDACTTVDELKALYEYTEQQDGTITRPLPEFPKEVI* |
| Ga0070754_101985461 | 3300006810 | Aqueous | INNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI* |
| Ga0070754_102505482 | 3300006810 | Aqueous | NNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0070754_102742641 | 3300006810 | Aqueous | ETMINNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI* |
| Ga0070754_102873061 | 3300006810 | Aqueous | TTVDELKALYEYTNTGTEQNPVIIRPLPEFPKEVI* |
| Ga0070750_102707612 | 3300006916 | Aqueous | MIDACTTVDELKALYEYTEQQDGTITRPLPEFPKEI* |
| Ga0070746_102466652 | 3300006919 | Aqueous | EMETMINNCTTVDELKALYEYTEQQDGTITRPLPEFPKEVI* |
| Ga0070747_11732401 | 3300007276 | Aqueous | ACTTVDELKALYEYTNTGTESDPVITRPLAEFPEEI* |
| Ga0070745_11558781 | 3300007344 | Aqueous | TMINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI* |
| Ga0070745_12612101 | 3300007344 | Aqueous | TMINNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI* |
| Ga0070745_13395171 | 3300007344 | Aqueous | TTVDELKALYEYTNTGTEQNPVMTRPLPSFPKEVV* |
| Ga0070752_11960262 | 3300007345 | Aqueous | ACTTVDELKALYEYTNTGTEANPVITRLLAEFPEEI* |
| Ga0070752_12834601 | 3300007345 | Aqueous | NNCTTVDELKALYEYTEQQDGTITRPLPEFPEEI* |
| Ga0070753_11677931 | 3300007346 | Aqueous | TQINACTTVDELKALYEYTEDAEGNITRPLAEFPKEL* |
| Ga0070753_12150743 | 3300007346 | Aqueous | NEMETQINACTTVDELKALYEYTEDAEGNITRPLAEFPSLDG* |
| Ga0099851_10289532 | 3300007538 | Aqueous | MEGQINACTTVDELAALYIYTNTGTDENPNITRPLAEFPEEI* |
| Ga0099851_10350822 | 3300007538 | Aqueous | EMETQINACTTVDELKALYEYTEQENGTFTRPLAEFPEEL* |
| Ga0099851_11476851 | 3300007538 | Aqueous | NCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0099851_11672572 | 3300007538 | Aqueous | ACGTIEDLKRLYDYVNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0099851_12764071 | 3300007538 | Aqueous | TQINACTTVDELKALYEYTEQENGTFTRPLAEFPEEL* |
| Ga0099851_12808981 | 3300007538 | Aqueous | TVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0099849_10252912 | 3300007539 | Aqueous | MEAMIDACTTVDQLKALYEYTNTGTEEDPVITRPLPEFPEAI* |
| Ga0099849_13098701 | 3300007539 | Aqueous | GTVDDLKTLYDYVNIGTEQNPVMTRPLGEWPEEVI* |
| Ga0099847_11086691 | 3300007540 | Aqueous | TMINNCTTVDELKALYEYTNTGTEQNPVFTRPLPEFPKEVI* |
| Ga0099847_11193101 | 3300007540 | Aqueous | TQIDNCTTVDELKALYEYTNTGTEANPVITRPLAEFPEEI* |
| Ga0099846_11431712 | 3300007542 | Aqueous | DACTTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI* |
| Ga0099846_11464532 | 3300007542 | Aqueous | NEMETMINNCTTVDELKALYEYTNTGTKQNPVMTRPLPEFPTEVI* |
| Ga0099850_11463081 | 3300007960 | Aqueous | IDGAANVDALKALYEYTNTGTEQDPVYIRPLGEWPEEVI* |
| Ga0099850_12260602 | 3300007960 | Aqueous | EMENMINACTTVDALKALYDYTEQQDGTVTRPLGEWPEEVI* |
| Ga0075480_102641591 | 3300008012 | Aqueous | NCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI* |
| Ga0075480_102728962 | 3300008012 | Aqueous | ETQIDNCTTVDELKALYEYTNTGTEANPVITRPLAEFPEEI* |
| Ga0075480_103194952 | 3300008012 | Aqueous | DGAADVDALKALYEYTNTGTIENPVYTRPLGEWPEEVI* |
| Ga0075480_103302611 | 3300008012 | Aqueous | SNEMETQINACTTVDGLKALYEYTEDAEGNITRPLAEFPSLDG* |
| Ga0098052_12441831 | 3300008050 | Marine | METQIDNCTTVDELKALYEYTTQEDGTQTRLMPEFPKEI* |
| Ga0114841_10126561 | 3300008259 | Freshwater, Plankton | NACTTVEQLKALYEYVNTGTEQSPIYTRPLAEFPKVA* |
| Ga0102963_10756831 | 3300009001 | Pond Water | INACTTVDELKALYEYTEDAEGNITRPLAEFPEEL* |
| Ga0102963_11961112 | 3300009001 | Pond Water | METMIDNCTTVDELKALYEYTEQEDGTFTRPLPEFPKEVI* |
| Ga0114918_101055231 | 3300009149 | Deep Subsurface | EAQIKACTTVEQLKALYEYTNTGTEESPIYTRPLAEYPKEI* |
| Ga0115012_108310062 | 3300009790 | Marine | ETQIDACTNVDELKALYEYTRQEDGTQTRPLAEFPKEI* |
| Ga0098043_10356111 | 3300010148 | Marine | TQIDACTTVDELKALYEYTQQEDGTQTRPLAEFPKEI* |
| Ga0098059_13284592 | 3300010153 | Marine | TQIDACTTVDELKGLYEYTTQEDGTQTRPLAEFPKEI* |
| Ga0098047_100546621 | 3300010155 | Marine | MEAKINACTTVDELKTLYEYVNTGTEENRVMEKPLGEFPKEI* |
| Ga0129342_11740231 | 3300010299 | Freshwater To Marine Saline Gradient | TMINNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI* |
| Ga0129351_12898842 | 3300010300 | Freshwater To Marine Saline Gradient | MEAMIDACTTVDQLKALYEYTNTGTEEDPVITRPLPEFPEAV* |
| Ga0181412_11226812 | 3300017714 | Seawater | ETAINNCSNIDELKALYEYTEQEDGSITRPLVEFPTLEI |
| Ga0181404_10478701 | 3300017717 | Seawater | IDACTTVDELKTLYEYVNTGTEENPVIERPLAEFPKEI |
| Ga0181392_10349042 | 3300017749 | Seawater | IDNCTTVDELKTLYEYTTQEDGTQTRPLAEFPEEI |
| Ga0181386_11073382 | 3300017773 | Seawater | ETQIDACTNVDELKALYEYTTQEDGTQTRPLAEFPKEI |
| Ga0181583_104670943 | 3300017952 | Salt Marsh | INAAADVDALKTLYEYTEQEDGTFTRPLGEFPEEIE |
| Ga0180431_108078181 | 3300017987 | Hypersaline Lake Sediment | MIDACGTVEDLKRLYEYTNTGTEENPVYTRPLGEWPEEVI |
| Ga0181601_100985153 | 3300018041 | Salt Marsh | SNEMETQIDACTTVDELKALYEYTEQEDGTFTRPMPEFPKEI |
| Ga0181606_102656602 | 3300018048 | Salt Marsh | IDACTTVDELKALYEYTEQQDGTTTRPLPEFPKEVI |
| Ga0181568_113074092 | 3300018428 | Salt Marsh | IDNCTTVDELKALYEYTNTGTEANPVFTRPLAEFPEEI |
| Ga0211708_102666782 | 3300020436 | Marine | DACTTVDELKALYEYTRQEDGTQTRPIAEFPTLEN |
| Ga0181598_11801152 | 3300020810 | Salt Marsh | SNEMETMIDACTTVDELKALYEYTEQQDGTITRPLPEFPKEI |
| Ga0213860_1000061327 | 3300021368 | Seawater | METQIDACTTVDELKALYEYTEDDDGNITRPLAEFPEEI |
| Ga0222718_100847622 | 3300021958 | Estuarine Water | AKSNEMENQINACTTVDEIKALYEYTEDAEGNITRPLAEFPEEL |
| Ga0222718_103528102 | 3300021958 | Estuarine Water | QIDNCTTVDELKALYEYTNTGTEADPVITRPLAEFPKEVI |
| Ga0222716_107398921 | 3300021959 | Estuarine Water | CTTVDELKALYEYTNTGTEQNPVIERPLAEFPIFNE |
| Ga0222715_102554253 | 3300021960 | Estuarine Water | AKSNEMENQINACTTVDELKALYEYSEDAEGNVSRPLAEFPLLNA |
| Ga0222715_103690611 | 3300021960 | Estuarine Water | NCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Ga0222715_103758371 | 3300021960 | Estuarine Water | KSNEMENQINACTTVDELKALYEYTEDAEGNFTRPLAEFPKTEVL |
| Ga0222715_104977131 | 3300021960 | Estuarine Water | TTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI |
| Ga0222714_105272901 | 3300021961 | Estuarine Water | ETMINNCTIVNELKALYEYTNTGTEQNPVFTRPLPEFPKEVI |
| Ga0222719_100955911 | 3300021964 | Estuarine Water | QTQIDDASNVEELKALFEYTNTGTEANPVYTRPLGEFPVK |
| Ga0222719_102571021 | 3300021964 | Estuarine Water | KSNEMENQINACTTVDELKALYEYTEDAEGNITRPLAEFPEEL |
| Ga0222719_103021891 | 3300021964 | Estuarine Water | NEMENQINACTTVDELKALYEYTEDAEGNITRPLAEFPKTEVL |
| Ga0212029_10563371 | 3300022063 | Aqueous | NNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Ga0212024_10486382 | 3300022065 | Aqueous | MINNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Ga0212021_10462502 | 3300022068 | Aqueous | TMINNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI |
| Ga0212021_11370922 | 3300022068 | Aqueous | INNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI |
| Ga0196899_11035061 | 3300022187 | Aqueous | TTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI |
| Ga0255775_11176172 | 3300022907 | Salt Marsh | ANVDALKALYEYTNTGTEQDPVYTRPIGEWPEEVI |
| Ga0255765_11533251 | 3300022921 | Salt Marsh | TQIDACTTVDELKALYEYTEQEDGTFTRPMPEFPKEI |
| Ga0255783_101751822 | 3300022923 | Salt Marsh | DNCTTVDELKALYEYTNTGTEANPVFTRPLAEFPEEI |
| Ga0208793_11827701 | 3300025108 | Marine | TQIDNCTTVDELKALYEYTTQEDGTQTRPLAEFPKEI |
| Ga0208299_11653911 | 3300025133 | Marine | METQIDNCTTVDELKALYEYTTQEDGTQTRLMPEFPKEI |
| Ga0208148_10764892 | 3300025508 | Aqueous | CTTVDELKALYEYTNTGTEANPVITRPLAEFPTLEN |
| Ga0208303_10743032 | 3300025543 | Aqueous | ETQINACTNVDELKALYEYTTQEDGSITRPLAEFPTLEI |
| Ga0208303_10955322 | 3300025543 | Aqueous | TMINNCTTVDELKALYEYTNTGTEQNPVFTRPLPEFPKEVI |
| Ga0208303_11146251 | 3300025543 | Aqueous | METQIDNCTTVDELKALYEYTNTGTEANPVITRPLAEFPEEI |
| Ga0208161_10218933 | 3300025646 | Aqueous | TTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Ga0208161_10997392 | 3300025646 | Aqueous | MINACGTVDDLKTLYDYVNIGTEQNPVMTRPLGEWPEEVI |
| Ga0208160_10364141 | 3300025647 | Aqueous | AANVDALKALYEYTNTGTEQDPVYIRPLGEWPEEVI |
| Ga0208160_10852931 | 3300025647 | Aqueous | INNCTTVDELKALYEYTNTGTEQNPVMTRPLPEFPKEVI |
| Ga0208134_11034161 | 3300025652 | Aqueous | TQIDNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI |
| Ga0208898_10227713 | 3300025671 | Aqueous | ETMINNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI |
| Ga0208898_11130692 | 3300025671 | Aqueous | MINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI |
| Ga0208162_10814373 | 3300025674 | Aqueous | NCTTVDELKALYEYTNTGTEANPVIERPLAEFPIFNE |
| Ga0208162_11841981 | 3300025674 | Aqueous | EMETQIDNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI |
| Ga0208899_11755752 | 3300025759 | Aqueous | ETQIDACTTVDELKALYEYTNTGTEANPVITRLLAEFPEEI |
| Ga0208767_11488311 | 3300025769 | Aqueous | DACTTVDELKALYEYTNTGTEANPVITRPLAEFPTLEN |
| Ga0208542_10386044 | 3300025818 | Aqueous | NAAVDVDALKALYEYTEQEDGTLTRPLGEFPEEIE |
| Ga0208547_11320422 | 3300025828 | Aqueous | SNEMETMINNCTTVDELKALYEYTEQQDGTFTRPLPEFPKEVI |
| Ga0208645_12041571 | 3300025853 | Aqueous | EMENMINACTTVDALKALYDYTEQQDGTITRPLGEWPEEVI |
| Ga0208644_10862262 | 3300025889 | Aqueous | TTVDELKALYEYTNTGTEQNPVMRRPLPEFPKEVI |
| Ga0208644_11970612 | 3300025889 | Aqueous | NEMETMIDACTTVDELKALYEYTEQQDGTYTRPLPEFPKEVI |
| Ga0209929_11323011 | 3300026187 | Pond Water | TQIDNCTTVDELKALYEYTTQEDGTQTRPLAEFPEEI |
| Ga0307380_102245783 | 3300031539 | Soil | NACTTAEQLKALYEYTNTGTEQSPIYTRPLAEYPKEI |
| Ga0307376_105168231 | 3300031578 | Soil | METQINACTTVDELKALYEYTEDAEGNITRPLAEFPEEL |
| Ga0348335_038464_1847_1969 | 3300034374 | Aqueous | METMINNCTTVDELKALYEYTEQQDGTITRPLPEFPKEVI |
| Ga0348335_038623_1841_1969 | 3300034374 | Aqueous | METQIDNCTTVDELKALYEYTNTGTEANPVFTRPLAEFPEVI |
| Ga0348335_046125_5_136 | 3300034374 | Aqueous | METMINNCTTVDELKALYEYTNTGTEQNPVMRRPLPEFPKEVI |
| Ga0348335_056148_48_179 | 3300034374 | Aqueous | METMINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPTEVI |
| Ga0348336_022807_2997_3128 | 3300034375 | Aqueous | METMINNCTTVDELKALYEYTNTGTEANPVFTRPLPEFPKEVI |
| Ga0348336_042673_2_124 | 3300034375 | Aqueous | TQIDNCTTVDELKALYEYTNTGTEANPVFTRPLAEFPEVI |
| Ga0348336_114964_21_140 | 3300034375 | Aqueous | METQINACTTVDELKALYEYTKDAEGNITRPLAEFPEEL |
| ⦗Top⦘ |