


| Basic Information | |
|---|---|
| Family ID | F063583 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 49 residues |
| Representative Sequence | DLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 97.67 % |
| % of genes from short scaffolds (< 2000 bps) | 89.92 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.798 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.659 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.814 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 89.58% β-sheet: 0.00% Coil/Unstructured: 10.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF04480 | DUF559 | 5.43 |
| PF13561 | adh_short_C2 | 4.65 |
| PF13540 | RCC1_2 | 3.88 |
| PF05685 | Uma2 | 3.88 |
| PF13602 | ADH_zinc_N_2 | 3.10 |
| PF00144 | Beta-lactamase | 3.10 |
| PF02585 | PIG-L | 1.55 |
| PF00106 | adh_short | 1.55 |
| PF01627 | Hpt | 0.78 |
| PF14552 | Tautomerase_2 | 0.78 |
| PF01936 | NYN | 0.78 |
| PF01906 | YbjQ_1 | 0.78 |
| PF00563 | EAL | 0.78 |
| PF05726 | Pirin_C | 0.78 |
| PF04126 | Cyclophil_like | 0.78 |
| PF13936 | HTH_38 | 0.78 |
| PF12840 | HTH_20 | 0.78 |
| PF00069 | Pkinase | 0.78 |
| PF02687 | FtsX | 0.78 |
| PF13531 | SBP_bac_11 | 0.78 |
| PF12710 | HAD | 0.78 |
| PF13924 | Lipocalin_5 | 0.78 |
| PF13365 | Trypsin_2 | 0.78 |
| PF06114 | Peptidase_M78 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 3.88 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.10 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.10 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.10 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.10 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.55 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.78 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.78 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.78 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.78 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.78 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.78 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.80 % |
| Unclassified | root | N/A | 6.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002908|JGI25382J43887_10096999 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300002908|JGI25382J43887_10304020 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300002911|JGI25390J43892_10039337 | Not Available | 1134 | Open in IMG/M |
| 3300005175|Ga0066673_10238085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300005186|Ga0066676_10102066 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300005186|Ga0066676_10449825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300005444|Ga0070694_100818281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
| 3300005445|Ga0070708_102070756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella bronchiseptica | 526 | Open in IMG/M |
| 3300005446|Ga0066686_10251403 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300005447|Ga0066689_10532184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300005467|Ga0070706_102102345 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005468|Ga0070707_100827791 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005471|Ga0070698_100198766 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300005518|Ga0070699_100725112 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005518|Ga0070699_100730083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 905 | Open in IMG/M |
| 3300005518|Ga0070699_100842409 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005526|Ga0073909_10483616 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005540|Ga0066697_10582972 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005556|Ga0066707_10141066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1520 | Open in IMG/M |
| 3300005566|Ga0066693_10438821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea → unclassified Pandoraea → Pandoraea sp. B-6 | 534 | Open in IMG/M |
| 3300005586|Ga0066691_10098679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1637 | Open in IMG/M |
| 3300005713|Ga0066905_100365246 | Not Available | 1158 | Open in IMG/M |
| 3300005904|Ga0075280_10130656 | Not Available | 532 | Open in IMG/M |
| 3300006031|Ga0066651_10360785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300006034|Ga0066656_11088869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300006755|Ga0079222_10003790 | All Organisms → cellular organisms → Bacteria | 4829 | Open in IMG/M |
| 3300006791|Ga0066653_10623233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300006804|Ga0079221_10330058 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300006844|Ga0075428_100657276 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300006844|Ga0075428_100834531 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006852|Ga0075433_11133854 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006854|Ga0075425_101108071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 901 | Open in IMG/M |
| 3300006854|Ga0075425_102582126 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006903|Ga0075426_10722176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 748 | Open in IMG/M |
| 3300006904|Ga0075424_100200717 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300006904|Ga0075424_100543359 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300006904|Ga0075424_100588310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1188 | Open in IMG/M |
| 3300006914|Ga0075436_100107932 | Not Available | 1941 | Open in IMG/M |
| 3300006914|Ga0075436_100977656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 635 | Open in IMG/M |
| 3300006954|Ga0079219_10501779 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300007076|Ga0075435_100091071 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300007076|Ga0075435_100668817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300007258|Ga0099793_10066437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
| 3300009012|Ga0066710_100304018 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300009012|Ga0066710_100442689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1947 | Open in IMG/M |
| 3300009012|Ga0066710_100672692 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300009089|Ga0099828_11501670 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009089|Ga0099828_11868892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300009090|Ga0099827_10390654 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300009094|Ga0111539_12419410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
| 3300009147|Ga0114129_10421122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1756 | Open in IMG/M |
| 3300009147|Ga0114129_11053652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1021 | Open in IMG/M |
| 3300009162|Ga0075423_12149714 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010320|Ga0134109_10042214 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300010322|Ga0134084_10089371 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300010329|Ga0134111_10546242 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010337|Ga0134062_10713325 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010371|Ga0134125_11578437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 714 | Open in IMG/M |
| 3300010373|Ga0134128_12224526 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
| 3300010399|Ga0134127_12604871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300010403|Ga0134123_11618033 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011270|Ga0137391_10693468 | Not Available | 847 | Open in IMG/M |
| 3300011270|Ga0137391_10810560 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300011403|Ga0137313_1015056 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300012096|Ga0137389_11143160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300012175|Ga0137321_1061942 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012198|Ga0137364_10566044 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012199|Ga0137383_10050125 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300012199|Ga0137383_10195087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1484 | Open in IMG/M |
| 3300012199|Ga0137383_11048739 | Not Available | 592 | Open in IMG/M |
| 3300012200|Ga0137382_10951569 | Not Available | 618 | Open in IMG/M |
| 3300012202|Ga0137363_11741625 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012203|Ga0137399_10042873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3229 | Open in IMG/M |
| 3300012203|Ga0137399_10144396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1894 | Open in IMG/M |
| 3300012203|Ga0137399_10269710 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300012207|Ga0137381_10431160 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012208|Ga0137376_10752859 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012210|Ga0137378_10654956 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012212|Ga0150985_105197354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1416 | Open in IMG/M |
| 3300012349|Ga0137387_10555199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300012350|Ga0137372_10895953 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012351|Ga0137386_10516163 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012354|Ga0137366_10620675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
| 3300012356|Ga0137371_10814639 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012356|Ga0137371_11018743 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012358|Ga0137368_10377967 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012359|Ga0137385_10048616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3794 | Open in IMG/M |
| 3300012362|Ga0137361_11094501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300012363|Ga0137390_10719611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 960 | Open in IMG/M |
| 3300012469|Ga0150984_112755966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012685|Ga0137397_10355109 | Not Available | 1092 | Open in IMG/M |
| 3300012918|Ga0137396_11270122 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012924|Ga0137413_11194427 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012925|Ga0137419_10031121 | All Organisms → cellular organisms → Bacteria | 3269 | Open in IMG/M |
| 3300012925|Ga0137419_11701968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012927|Ga0137416_10237001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1484 | Open in IMG/M |
| 3300012927|Ga0137416_10853577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 807 | Open in IMG/M |
| 3300012927|Ga0137416_11806066 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012944|Ga0137410_10023236 | All Organisms → cellular organisms → Bacteria | 4289 | Open in IMG/M |
| 3300012944|Ga0137410_10379137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1136 | Open in IMG/M |
| 3300012972|Ga0134077_10366205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300012976|Ga0134076_10194838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 848 | Open in IMG/M |
| 3300014154|Ga0134075_10579512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300015241|Ga0137418_10060676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3462 | Open in IMG/M |
| 3300015359|Ga0134085_10488518 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300017654|Ga0134069_1100892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300017657|Ga0134074_1187171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_68_14 | 732 | Open in IMG/M |
| 3300018028|Ga0184608_10007237 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
| 3300018028|Ga0184608_10135640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1053 | Open in IMG/M |
| 3300018056|Ga0184623_10224400 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300018075|Ga0184632_10005774 | All Organisms → cellular organisms → Bacteria | 5161 | Open in IMG/M |
| 3300021073|Ga0210378_10038667 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300024330|Ga0137417_1010493 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300025917|Ga0207660_10492200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 994 | Open in IMG/M |
| 3300026118|Ga0207675_101888003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
| 3300026320|Ga0209131_1102550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1507 | Open in IMG/M |
| 3300026320|Ga0209131_1267737 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
| 3300026327|Ga0209266_1197367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300026538|Ga0209056_10544886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300027725|Ga0209178_1332911 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027787|Ga0209074_10141097 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 858 | Open in IMG/M |
| 3300028536|Ga0137415_10108206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas phototrophica | 2629 | Open in IMG/M |
| 3300028536|Ga0137415_10528301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300028884|Ga0307308_10332343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 728 | Open in IMG/M |
| 3300031820|Ga0307473_10097859 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300031820|Ga0307473_10130744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1395 | Open in IMG/M |
| 3300032157|Ga0315912_11389015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 554 | Open in IMG/M |
| 3300032180|Ga0307471_100976968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1014 | Open in IMG/M |
| 3300033412|Ga0310810_11486403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J43887_100969991 | 3300002908 | Grasslands Soil | QEAEAELADLDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| JGI25382J43887_103040202 | 3300002908 | Grasslands Soil | DLDGRLKEAQSGRARAEARCRELTAEVERLSAAGEALEALESLVRRSR* |
| JGI25390J43892_100393373 | 3300002911 | Grasslands Soil | LQEAQSAQARAEARCRELTSEVERLSAAGEALEALESLVNRNR* |
| Ga0066673_102380853 | 3300005175 | Soil | LKEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0066676_101020663 | 3300005186 | Soil | DLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEGLESLVRRSP* |
| Ga0066676_104498252 | 3300005186 | Soil | DLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0070694_1008182813 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KEEQSGRARAEARCRELTAEVERLSAAGEALEALETLVRRSP* |
| Ga0070708_1020707561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LQEAEAELADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGAALEALESLVKRNR* |
| Ga0066686_102514033 | 3300005446 | Soil | GRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0066689_105321841 | 3300005447 | Soil | LLQEAEAELADLDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0070706_1021023453 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KEAQSGRARAEARCRELTSDVERLSAAGAALEALETLVRRSP* |
| Ga0070707_1008277912 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAELADLDGRLKEAQSGRARAEARCRELTADVERLSAAGEALEALETLVRRSH* |
| Ga0070698_1001987662 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALETLVRRSP* |
| Ga0070699_1007251123 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ELADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSR* |
| Ga0070699_1007300831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLDGRLKEAQSGRARAEARCRELTSEVERLSAAGEALEALETLVRRSP* |
| Ga0070699_1008424091 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLDGRLKEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRNR* |
| Ga0073909_104836161 | 3300005526 | Surface Soil | GRLKEAQSGRTRAEARCRELTANVERLSAAGEALEALETLVRRSP* |
| Ga0066697_105829721 | 3300005540 | Soil | LLQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0066707_101410661 | 3300005556 | Soil | GRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0066693_104388211 | 3300005566 | Soil | LLQEAEAELADLDGRLQEAQSARARAEARCRELTAEVERLSAAGEALEGLESLVRRSP* |
| Ga0066691_100986794 | 3300005586 | Soil | EAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0066905_1003652462 | 3300005713 | Tropical Forest Soil | RAEARCRELTADVERLSAASEALEGLESLVRRSH* |
| Ga0075280_101306561 | 3300005904 | Rice Paddy Soil | LPARAEARCGELVAEVERLSAAGEAIEALEVLMKRGR* |
| Ga0066651_103607851 | 3300006031 | Soil | EAQSGRARAEARCRELTSDVERLSAAGEALEGLESLVRRSP* |
| Ga0066656_110888691 | 3300006034 | Soil | EAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0079222_100037907 | 3300006755 | Agricultural Soil | AEAELADLDGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALETLVRRSQ* |
| Ga0066653_106232332 | 3300006791 | Soil | SGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0079221_103300582 | 3300006804 | Agricultural Soil | ADLDGRLKEAQSGRARAEARCRELTAEVERLSAAGAALEALESLVRRSP* |
| Ga0075428_1006572763 | 3300006844 | Populus Rhizosphere | LADLDGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALESLVKRSH* |
| Ga0075428_1008345313 | 3300006844 | Populus Rhizosphere | MRQEAELADLDGRLREVQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSH* |
| Ga0075433_111338541 | 3300006852 | Populus Rhizosphere | GRLKEAQSGRTRAEARCRELTAEVERLSAAGEALEALETLVRRSP* |
| Ga0075425_1011080713 | 3300006854 | Populus Rhizosphere | LDGRLKEAQYGRTRAEARCRELTADVERLSAAGEALEALETLVRRSP* |
| Ga0075425_1025821261 | 3300006854 | Populus Rhizosphere | LQEAEAELADLDGRLKEAQYGRTRAEARCRELTADVERLSAAGEALEALETLVRRRH* |
| Ga0075426_107221761 | 3300006903 | Populus Rhizosphere | LDGRLKEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRNR* |
| Ga0075424_1002007173 | 3300006904 | Populus Rhizosphere | ARAEARCRELTSEVERLSAAGEALEALETLVRRSP* |
| Ga0075424_1005433591 | 3300006904 | Populus Rhizosphere | EAELADLDGRLKEAQSGRARAEARCRELTADVERLSAAGEALEALETLVRRSR* |
| Ga0075424_1005883101 | 3300006904 | Populus Rhizosphere | LKEAQSARARAEARCRELTADVERLSAAGEALEALETLVRRSP* |
| Ga0075436_1001079321 | 3300006914 | Populus Rhizosphere | DGRLKEAQSGRARAEARCRELTAEVERLSAAGEALEALETLVRRSP* |
| Ga0075436_1009776562 | 3300006914 | Populus Rhizosphere | DLDGRLKEAQSGRARAEARCRELTADVERLSAAGEALEALETLVRRSP* |
| Ga0079219_105017792 | 3300006954 | Agricultural Soil | DLDGRLKEAQSGRARAEARCRELTADVERLSAAGEALEALETLVRRSH* |
| Ga0075435_1000910716 | 3300007076 | Populus Rhizosphere | KEAQSGRTRAEARCRELTADVERLSAAGEALEALETLVRRRH* |
| Ga0075435_1006688172 | 3300007076 | Populus Rhizosphere | RARAEARCRELTSDVERLSAAGAALEALESLVKRNR* |
| Ga0099793_100664371 | 3300007258 | Vadose Zone Soil | ARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0066710_1003040181 | 3300009012 | Grasslands Soil | EAELADLDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESVVKRNR |
| Ga0066710_1004426891 | 3300009012 | Grasslands Soil | LDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRNH |
| Ga0066710_1006726921 | 3300009012 | Grasslands Soil | LADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Ga0099828_115016701 | 3300009089 | Vadose Zone Soil | EAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRNR* |
| Ga0099828_118688922 | 3300009089 | Vadose Zone Soil | LQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0099827_103906543 | 3300009090 | Vadose Zone Soil | ADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRNH* |
| Ga0111539_124194102 | 3300009094 | Populus Rhizosphere | LQEAEAELADLDGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALESLVKRSH* |
| Ga0114129_104211223 | 3300009147 | Populus Rhizosphere | RLKEAQSGRTRAEARCRELTSDVERLSAAGEALEALETLVRRSP* |
| Ga0114129_110536523 | 3300009147 | Populus Rhizosphere | LADLDGRLKEAQSGRARAEARCRELTAEVERLSAAGEALEALETLVRRSP* |
| Ga0075423_121497141 | 3300009162 | Populus Rhizosphere | AELADLDGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALESLVKRSH* |
| Ga0134109_100422143 | 3300010320 | Grasslands Soil | ADLDGRLKEAESGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134084_100893713 | 3300010322 | Grasslands Soil | LDGRLKEAESGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134111_105462422 | 3300010329 | Grasslands Soil | RARDLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134062_107133251 | 3300010337 | Grasslands Soil | DGRLQEAQSARARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134125_115784371 | 3300010371 | Terrestrial Soil | AQSGRARAEARCRELTADVERLSAAGEALEALETLVRRSP* |
| Ga0134128_122245261 | 3300010373 | Terrestrial Soil | AELADLDGRLKEAQAGRARAEARCRELTSDVERLSAAGEALEALETLVRRSP* |
| Ga0134127_126048712 | 3300010399 | Terrestrial Soil | RMQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRNR* |
| Ga0134123_116180332 | 3300010403 | Terrestrial Soil | ELADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGEALEALETLVRRSP* |
| Ga0137391_106934681 | 3300011270 | Vadose Zone Soil | LQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVKRNR* |
| Ga0137391_108105601 | 3300011270 | Vadose Zone Soil | LLQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVKRNR* |
| Ga0137313_10150561 | 3300011403 | Soil | TRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSS* |
| Ga0137389_111431602 | 3300012096 | Vadose Zone Soil | GRARAEARCRELTSDVERLSAAGEALEALESLVTRNR* |
| Ga0137321_10619422 | 3300012175 | Soil | LLQEAEAELADLDGRLREAQSARARAEARCRELTSEVERLSAAGEALEALESLVRRSS* |
| Ga0137364_105660441 | 3300012198 | Vadose Zone Soil | QSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137383_100501254 | 3300012199 | Vadose Zone Soil | LQEAEAELADLDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALETLESLVKRNR* |
| Ga0137383_101950872 | 3300012199 | Vadose Zone Soil | LQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137383_110487391 | 3300012199 | Vadose Zone Soil | ALLQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVKRNR* |
| Ga0137382_109515691 | 3300012200 | Vadose Zone Soil | LLQEAEAELADLDTRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRNR* |
| Ga0137363_117416251 | 3300012202 | Vadose Zone Soil | LADLDGRLQEAQSGRARAEARCRELTAEVERLSAAGEALEALESLVRRSP* |
| Ga0137399_100428735 | 3300012203 | Vadose Zone Soil | MPRDQVLEEMELADLDARLREAQSVRARAEARCRELTSDVERLSATGEALEGLESLVRRNR* |
| Ga0137399_101443961 | 3300012203 | Vadose Zone Soil | EAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137399_102697103 | 3300012203 | Vadose Zone Soil | QEAEAELADLDGRLREAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSR* |
| Ga0137381_104311601 | 3300012207 | Vadose Zone Soil | AQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137376_107528591 | 3300012208 | Vadose Zone Soil | EAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEGLESLVRRNP* |
| Ga0137378_106549561 | 3300012210 | Vadose Zone Soil | EAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSH* |
| Ga0150985_1051973542 | 3300012212 | Avena Fatua Rhizosphere | ELADLDGRLQEAQSARARSEARCRDLTAEVERLSAAGGALEALESLVKRNR* |
| Ga0137387_105551991 | 3300012349 | Vadose Zone Soil | LDGRLKEAQSGRARADARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137372_108959531 | 3300012350 | Vadose Zone Soil | EAELADLDGRLQEAQSGRARADARCRELTSDVERLCATGEALEAL* |
| Ga0137386_105161631 | 3300012351 | Vadose Zone Soil | GRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137366_106206751 | 3300012354 | Vadose Zone Soil | DLDGRLQEAQSGRARAEARCRELTTDVERLSAAGEALEALESLVRRSP* |
| Ga0137371_108146392 | 3300012356 | Vadose Zone Soil | EAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSH* |
| Ga0137371_110187431 | 3300012356 | Vadose Zone Soil | RLQEAQSGRARAEARCRELTSDVERLSAAGEALEGLESLVRRSP* |
| Ga0137368_103779671 | 3300012358 | Vadose Zone Soil | LADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137385_100486167 | 3300012359 | Vadose Zone Soil | RLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137361_110945013 | 3300012362 | Vadose Zone Soil | AQSGRARAEARCRELTAEVERLSAAGEALEALESLVRRSP* |
| Ga0137390_107196111 | 3300012363 | Vadose Zone Soil | LDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSH* |
| Ga0150984_1127559662 | 3300012469 | Avena Fatua Rhizosphere | LADLDTRLQEAQSARARAEAQCRELTSEVERLSAAGEALEGLETLVRRGNAVS* |
| Ga0137397_103551091 | 3300012685 | Vadose Zone Soil | KDAGSANTRCRELTSEVERLSAAGEALEGLESLVKRNR* |
| Ga0137396_112701222 | 3300012918 | Vadose Zone Soil | QEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSH* |
| Ga0137413_111944271 | 3300012924 | Vadose Zone Soil | LLQEAEAELADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137419_100311216 | 3300012925 | Vadose Zone Soil | EAELADLDGRLHEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137419_117019681 | 3300012925 | Vadose Zone Soil | AQSGRARAEARCRELTSEVERLSAAGEALEALESLVRHSH* |
| Ga0137416_102370011 | 3300012927 | Vadose Zone Soil | QEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAAEALEALESLVRRSH* |
| Ga0137416_108535773 | 3300012927 | Vadose Zone Soil | ADLDGRLQEAQSGRARAEARCRELTTEVERLSAAGEALEALESLVRRSP* |
| Ga0137416_118060662 | 3300012927 | Vadose Zone Soil | DGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRSP* |
| Ga0137410_100232361 | 3300012944 | Vadose Zone Soil | DGRLQEAQSARARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0137410_103791373 | 3300012944 | Vadose Zone Soil | LLQEAEAELADLDGRLQEAQSAQARAEARCRELTAEVERLSAAGEALEALESLVRRSP* |
| Ga0134077_103662052 | 3300012972 | Grasslands Soil | RARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134076_101948382 | 3300012976 | Grasslands Soil | LQEAEAELADLDGRLQEAQTGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0134075_105795122 | 3300014154 | Grasslands Soil | DGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP* |
| Ga0137418_100606761 | 3300015241 | Vadose Zone Soil | EAEAELADLDGRLQEAQTGRARAEARCRELTSDVERLSAAGEALEALESLVRRSH* |
| Ga0134085_104885181 | 3300015359 | Grasslands Soil | AEAELADLDGRLKEAESGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP* |
| Ga0134069_11008922 | 3300017654 | Grasslands Soil | EAELADLDGRLQEAQSGRARAEARCWELTSDVERLSAAGEALEALESLVRRSP |
| Ga0134074_11871712 | 3300017657 | Grasslands Soil | LLQEAEAELADLDGRLKEAESGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Ga0184608_100072375 | 3300018028 | Groundwater Sediment | LLQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSR |
| Ga0184608_101356401 | 3300018028 | Groundwater Sediment | ESGRARAEARCRELTSDVERLSAAGEALEGLESLVRRSR |
| Ga0184623_102244002 | 3300018056 | Groundwater Sediment | LQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVKRSR |
| Ga0184632_100057741 | 3300018075 | Groundwater Sediment | LQEAEAELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALETLVRRSH |
| Ga0210378_100386671 | 3300021073 | Groundwater Sediment | AELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSR |
| Ga0137417_10104932 | 3300024330 | Vadose Zone Soil | EAEAELADLDGRLKEAQLGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP |
| Ga0207660_104922002 | 3300025917 | Corn Rhizosphere | LDGRLKEAESARARADARCRELTSEVERLSAAGEALEGLESLVRRSP |
| Ga0207675_1018880032 | 3300026118 | Switchgrass Rhizosphere | EAQSGRARAEARCRELTAEVERLSAAGEALEALESLVKRNR |
| Ga0209131_11025501 | 3300026320 | Grasslands Soil | ELADLDGRLQEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Ga0209131_12677371 | 3300026320 | Grasslands Soil | LLQEAEAELADLDGRLQEAQSDRARAEARCRELTSEVERLSAAGEALEALESLVRRSP |
| Ga0209266_11973672 | 3300026327 | Soil | QEAQAELADLDGRLQEALSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Ga0209056_105448862 | 3300026538 | Soil | EAEAELADLDGRLQEAQSGRARAEARCRELTSEVERLSAAGEALEALESLVRRSP |
| Ga0209178_13329112 | 3300027725 | Agricultural Soil | ELADLDGRLKEAQSGRARADARCRELTAEVERLSAAGEALEALETLVRRSP |
| Ga0209074_101410971 | 3300027787 | Agricultural Soil | LLQEAEAELADLDGRLKEAQSGRTRAEARCRELTADVERLSAAGEALEALETLVRRSQ |
| Ga0137415_101082065 | 3300028536 | Vadose Zone Soil | EAEAELADLDGRLKEAQSGRARAEARCRELTADVERLSAAGEALEALESLVKHNR |
| Ga0137415_105283011 | 3300028536 | Vadose Zone Soil | ARAEARCRELTSDVERLSAAGEALEALESLVRRSP |
| Ga0307308_103323431 | 3300028884 | Soil | AEAERADLDGRLQEAQSARARAEARCRELTAEVERLSAAGEALEALESLVKRSR |
| Ga0307473_100978592 | 3300031820 | Hardwood Forest Soil | QEAEAELADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGEALEALESLVRRSR |
| Ga0307473_101307441 | 3300031820 | Hardwood Forest Soil | EAELADLDGRLKEAQSGRTRAEARCRELTSDVERLSAAGAALEALETLVRRNH |
| Ga0315912_113890151 | 3300032157 | Soil | AEAQLADLDTRLQESESGRARSEARCRELTSEVERLSAAGAALEGLESLVSRPAAPNAS |
| Ga0307471_1009769681 | 3300032180 | Hardwood Forest Soil | LADLDGRLKEAQSGRARAEARCRELTSDVERLSAAGAALEALETLVRRSH |
| Ga0310810_114864032 | 3300033412 | Soil | EAQSARARAEARCRELTSEVERLSAAGEALEALESLVKRSR |
| ⦗Top⦘ |