


| Basic Information | |
|---|---|
| Family ID | F063555 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSVLRLTQFTDPHLYGSETESLRGVPTLPALRAALAHAR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 90.70 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 5.97% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00456 | Transketolase_N | 55.81 |
| PF02779 | Transket_pyr | 6.98 |
| PF02780 | Transketolase_C | 5.43 |
| PF01596 | Methyltransf_3 | 3.10 |
| PF00044 | Gp_dh_N | 1.55 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF01963 | TraB_PrgY_gumN | 0.78 |
| PF05221 | AdoHcyase | 0.78 |
| PF00162 | PGK | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 55.81 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 55.81 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 3.10 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 3.10 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 3.10 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 1.55 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.44 % |
| Unclassified | root | N/A | 32.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000837|AP72_2010_repI_A100DRAFT_1018778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 972 | Open in IMG/M |
| 3300001661|JGI12053J15887_10080027 | Not Available | 1801 | Open in IMG/M |
| 3300004635|Ga0062388_100759284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300005332|Ga0066388_108814285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005437|Ga0070710_10573862 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005440|Ga0070705_101145092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300005455|Ga0070663_101065464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300005536|Ga0070697_101668034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005569|Ga0066705_10720760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 600 | Open in IMG/M |
| 3300005577|Ga0068857_101114952 | Not Available | 762 | Open in IMG/M |
| 3300005578|Ga0068854_101679609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300005610|Ga0070763_10267494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 931 | Open in IMG/M |
| 3300005610|Ga0070763_10671233 | Not Available | 605 | Open in IMG/M |
| 3300005616|Ga0068852_100738961 | Not Available | 996 | Open in IMG/M |
| 3300005764|Ga0066903_106006543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300006791|Ga0066653_10265948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 872 | Open in IMG/M |
| 3300006804|Ga0079221_10657406 | Not Available | 720 | Open in IMG/M |
| 3300006893|Ga0073928_10240356 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300006903|Ga0075426_11284312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300006954|Ga0079219_11773226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300007258|Ga0099793_10323999 | Not Available | 751 | Open in IMG/M |
| 3300007265|Ga0099794_10169927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
| 3300009093|Ga0105240_10137890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2919 | Open in IMG/M |
| 3300009093|Ga0105240_11474367 | Not Available | 714 | Open in IMG/M |
| 3300009174|Ga0105241_10525788 | Not Available | 1058 | Open in IMG/M |
| 3300009624|Ga0116105_1247182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300009650|Ga0105857_1129419 | Not Available | 696 | Open in IMG/M |
| 3300009660|Ga0105854_1106021 | Not Available | 880 | Open in IMG/M |
| 3300009826|Ga0123355_11454363 | Not Available | 672 | Open in IMG/M |
| 3300010321|Ga0134067_10161526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300010358|Ga0126370_10163350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1639 | Open in IMG/M |
| 3300010360|Ga0126372_10833310 | Not Available | 917 | Open in IMG/M |
| 3300010360|Ga0126372_13224408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010362|Ga0126377_12883556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300010397|Ga0134124_11583457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300010401|Ga0134121_11123860 | Not Available | 780 | Open in IMG/M |
| 3300012205|Ga0137362_10302688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300012359|Ga0137385_11665182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012940|Ga0164243_10462413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300012971|Ga0126369_10082937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2851 | Open in IMG/M |
| 3300012971|Ga0126369_10330260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1539 | Open in IMG/M |
| 3300013105|Ga0157369_12376614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300013296|Ga0157374_11767675 | Not Available | 643 | Open in IMG/M |
| 3300013307|Ga0157372_12227302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300015373|Ga0132257_101058479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
| 3300016270|Ga0182036_10852077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300016404|Ga0182037_10693869 | Not Available | 871 | Open in IMG/M |
| 3300016422|Ga0182039_12099147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300016445|Ga0182038_10151293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1771 | Open in IMG/M |
| 3300017927|Ga0187824_10217142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300017959|Ga0187779_10034681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2912 | Open in IMG/M |
| 3300017966|Ga0187776_11049614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300017972|Ga0187781_10749238 | Not Available | 708 | Open in IMG/M |
| 3300017974|Ga0187777_11110461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300017993|Ga0187823_10107512 | Not Available | 841 | Open in IMG/M |
| 3300018006|Ga0187804_10167842 | Not Available | 929 | Open in IMG/M |
| 3300018058|Ga0187766_10923323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300018085|Ga0187772_11093814 | Not Available | 585 | Open in IMG/M |
| 3300020022|Ga0193733_1026646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
| 3300020170|Ga0179594_10212129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300020582|Ga0210395_10029976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3984 | Open in IMG/M |
| 3300021088|Ga0210404_10052104 | Not Available | 1929 | Open in IMG/M |
| 3300021171|Ga0210405_10688370 | Not Available | 791 | Open in IMG/M |
| 3300021178|Ga0210408_10991697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300021180|Ga0210396_11756261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300021402|Ga0210385_10453076 | Not Available | 969 | Open in IMG/M |
| 3300021402|Ga0210385_10872354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300021405|Ga0210387_10864042 | Not Available | 797 | Open in IMG/M |
| 3300021432|Ga0210384_10996886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300021476|Ga0187846_10201875 | Not Available | 833 | Open in IMG/M |
| 3300021560|Ga0126371_13434122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300022894|Ga0247778_1222108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300023259|Ga0224551_1031753 | Not Available | 910 | Open in IMG/M |
| 3300024290|Ga0247667_1094506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300024543|Ga0256348_1095327 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 506 | Open in IMG/M |
| 3300025912|Ga0207707_10041127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4036 | Open in IMG/M |
| 3300026329|Ga0209375_1244607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300026538|Ga0209056_10170148 | Not Available | 1637 | Open in IMG/M |
| 3300027383|Ga0209213_1074507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 634 | Open in IMG/M |
| 3300027616|Ga0209106_1032853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1147 | Open in IMG/M |
| 3300027727|Ga0209328_10099946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300027775|Ga0209177_10324773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300027855|Ga0209693_10409633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300027869|Ga0209579_10366502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → Mariprofundales → Mariprofundaceae → Mariprofundus → Mariprofundus micogutta | 780 | Open in IMG/M |
| 3300027894|Ga0209068_10446105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300028380|Ga0268265_10301783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter adjunctus | 1442 | Open in IMG/M |
| 3300028775|Ga0302231_10132944 | Not Available | 1038 | Open in IMG/M |
| 3300030520|Ga0311372_11658967 | Not Available | 774 | Open in IMG/M |
| 3300030524|Ga0311357_11084298 | Not Available | 699 | Open in IMG/M |
| 3300030580|Ga0311355_11523300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300030617|Ga0311356_10761890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300030646|Ga0302316_10105819 | Not Available | 1194 | Open in IMG/M |
| 3300031233|Ga0302307_10605287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031469|Ga0170819_12818942 | Not Available | 556 | Open in IMG/M |
| 3300031543|Ga0318516_10717287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031640|Ga0318555_10128283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1351 | Open in IMG/M |
| 3300031640|Ga0318555_10736252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300031680|Ga0318574_10080465 | Not Available | 1776 | Open in IMG/M |
| 3300031680|Ga0318574_10122147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
| 3300031680|Ga0318574_10127893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1430 | Open in IMG/M |
| 3300031680|Ga0318574_10485656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 723 | Open in IMG/M |
| 3300031681|Ga0318572_10141804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300031715|Ga0307476_10898280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300031747|Ga0318502_10012180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3934 | Open in IMG/M |
| 3300031748|Ga0318492_10038128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2193 | Open in IMG/M |
| 3300031770|Ga0318521_10127015 | Not Available | 1430 | Open in IMG/M |
| 3300031777|Ga0318543_10006516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3881 | Open in IMG/M |
| 3300031778|Ga0318498_10059208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1708 | Open in IMG/M |
| 3300031778|Ga0318498_10129666 | Not Available | 1147 | Open in IMG/M |
| 3300031793|Ga0318548_10061378 | Not Available | 1742 | Open in IMG/M |
| 3300031823|Ga0307478_10958343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 715 | Open in IMG/M |
| 3300031831|Ga0318564_10216921 | Not Available | 850 | Open in IMG/M |
| 3300031893|Ga0318536_10092781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1506 | Open in IMG/M |
| 3300031912|Ga0306921_11423804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → Mariprofundales → Mariprofundaceae → Mariprofundus → Mariprofundus micogutta | 761 | Open in IMG/M |
| 3300031945|Ga0310913_10048096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2775 | Open in IMG/M |
| 3300031962|Ga0307479_10407167 | Not Available | 1345 | Open in IMG/M |
| 3300031962|Ga0307479_10468760 | Not Available | 1243 | Open in IMG/M |
| 3300032009|Ga0318563_10170574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1170 | Open in IMG/M |
| 3300032025|Ga0318507_10230160 | Not Available | 802 | Open in IMG/M |
| 3300032054|Ga0318570_10041144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1883 | Open in IMG/M |
| 3300032055|Ga0318575_10028103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2437 | Open in IMG/M |
| 3300032060|Ga0318505_10126527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300032089|Ga0318525_10042723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2234 | Open in IMG/M |
| 3300032089|Ga0318525_10609792 | Not Available | 557 | Open in IMG/M |
| 3300032174|Ga0307470_10266583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300032893|Ga0335069_10948787 | Not Available | 958 | Open in IMG/M |
| 3300032893|Ga0335069_11941803 | Not Available | 622 | Open in IMG/M |
| 3300032896|Ga0335075_10205785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2344 | Open in IMG/M |
| 3300033289|Ga0310914_10700876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A100DRAFT_10187782 | 3300000837 | Forest Soil | MLCYPPLMSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARAREWPPDALLV |
| JGI12053J15887_100800272 | 3300001661 | Forest Soil | MSAVRLTHFTDPHLYGDENESLRGVATLPALTAALAHA |
| Ga0062388_1007592843 | 3300004635 | Bog Forest Soil | MSVVRLTHFTDPHLYGGEHESLRGVATLPALTAAIAHAQARDWPPDAVLV |
| Ga0066388_1088142851 | 3300005332 | Tropical Forest Soil | MSVVRLTQFTDPHLYGGESEMLRGVATLPALNAALAQARAR |
| Ga0070710_105738621 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAQARARDWPPD |
| Ga0070705_1011450921 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVLRLVQFTDPHLYGSESESLRGVPTLPALRAALAQARARDW |
| Ga0070663_1010654641 | 3300005455 | Corn Rhizosphere | MSVLRITHFTDPHLYGCETESLRGVATLPALKATLAHAQARDWPP |
| Ga0070697_1016680342 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVVRITHFTDPHLYGGEHETLRGVQTLPALTAALAHARARDWPP |
| Ga0066705_107207602 | 3300005569 | Soil | MSAVRLTHFTDTHLYGDENESLRGVATLPALTAALAHARARDWPPDALLVTGD |
| Ga0068857_1011149521 | 3300005577 | Corn Rhizosphere | MMYKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLTHAQTG |
| Ga0068854_1016796092 | 3300005578 | Corn Rhizosphere | MMDKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLTHAQ |
| Ga0070763_102674942 | 3300005610 | Soil | MSVVRLTHFTDPHLYGSETETLRGVATLPALIAALARAQSHDWPPD |
| Ga0070763_106712331 | 3300005610 | Soil | MSVVRLTHFTDPHLYGDETESLRGVATLPALTAALAH |
| Ga0068852_1007389613 | 3300005616 | Corn Rhizosphere | MDKSIRRLTHFTDPHLYGSETESLRGIATLPALTATLT |
| Ga0066903_1060065432 | 3300005764 | Tropical Forest Soil | MSVVRLTQFTDPHLYGGEHETLRGVATLPALQAALAHARGRDWP |
| Ga0066653_102659482 | 3300006791 | Soil | MGPAEVCYAVFMSAVRIIQFTDPHLYGGEGESLRGVATLPALTAAMAHAHAHAWPPH |
| Ga0079221_106574062 | 3300006804 | Agricultural Soil | MMDKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLTHA |
| Ga0073928_102403561 | 3300006893 | Iron-Sulfur Acid Spring | MSVLRLIQFTDPHLYGSETETLRGIATLPALKAALSDAQQSSA |
| Ga0075426_112843122 | 3300006903 | Populus Rhizosphere | MSVLRLIQFTDPHLYGNEAETLRGIATLPALKAALADAQQSSAWPPDVVL |
| Ga0079219_117732262 | 3300006954 | Agricultural Soil | MSVLRLVQFTDPHLYGSETETLRGIATLPALMRTLN |
| Ga0099793_103239991 | 3300007258 | Vadose Zone Soil | MSAVRLTHFTGPRLYGDENESLRGVATLPALTAALA |
| Ga0099794_101699271 | 3300007265 | Vadose Zone Soil | MSAVRLTHFTDPHLYGDEGESLRGVATLPALTAALAHARARDWPPDAVLV |
| Ga0105240_101378901 | 3300009093 | Corn Rhizosphere | MMEKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLTHAQDGDWP |
| Ga0105240_114743672 | 3300009093 | Corn Rhizosphere | MSGLRLIQFTDPHLYGSETETLRGIATLPALEAALADAQRSS |
| Ga0105241_105257882 | 3300009174 | Corn Rhizosphere | MSVLRLTHFTDPHLYGGESECLRGVATLPALKTALAHAQ |
| Ga0116105_12471821 | 3300009624 | Peatland | MSVVRLTHFTDPHLYGAEHESLRGVATLPALTAAIAHAQARDWPPD |
| Ga0105857_11294191 | 3300009650 | Permafrost Soil | MSVLRLIQFTDPHLYGSETESLRGVQTLAALTRTLCQAQQRDWPVDAVL |
| Ga0105854_11060212 | 3300009660 | Permafrost Soil | MSVVRLTHFTDPHLYGGEQEALRGVPTLPALKSALAQA |
| Ga0123355_114543631 | 3300009826 | Termite Gut | MSAVRLTHFTDPHLYGGENESLRGVATLPALRAALAHARARDW |
| Ga0134067_101615261 | 3300010321 | Grasslands Soil | MSVLRLIQFTDPHLYGSEAETLRGIATLPALKAALADAQQSSAWPPDVLLVTG |
| Ga0126370_101633502 | 3300010358 | Tropical Forest Soil | MSVVRVTHFTDPHLYGGETESLRGVATLPALTAAL |
| Ga0126372_108333102 | 3300010360 | Tropical Forest Soil | MSVVRITHFTDPHLYGGETETLRGVATLPALAAALARA |
| Ga0126372_132244081 | 3300010360 | Tropical Forest Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALWAALAHARARDWPPDALL |
| Ga0126377_128835562 | 3300010362 | Tropical Forest Soil | MSVVRLTHFTDPHLYGGETETLRGVATLPALAAALARAQA |
| Ga0134124_115834571 | 3300010397 | Terrestrial Soil | MSVLRLTHFTDPHLYGGESECLRGVATLPALRTALAHAQARDW |
| Ga0134121_111238601 | 3300010401 | Terrestrial Soil | MSGLRLIQFTDPHLYGSETETLRGIATLPALEAAL |
| Ga0137362_103026882 | 3300012205 | Vadose Zone Soil | MTAVRLTHFTDPHLYGDEGESLRGVATLPALTAALA |
| Ga0137385_116651821 | 3300012359 | Vadose Zone Soil | MDKSVLRLVHFTDPHLYGSETESLRGIATLPALTATLALAQARDWPPDALL |
| Ga0164243_104624131 | 3300012940 | Compost | MSVRLVQFTDPHLYGDESATLRGIATLPALMRTLD |
| Ga0126369_100829373 | 3300012971 | Tropical Forest Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARAREWPPDALLV |
| Ga0126369_103302602 | 3300012971 | Tropical Forest Soil | MSVLRLIQFTDPHLYGSEHESLRGVPTLPALRAALAHARA |
| Ga0157369_123766142 | 3300013105 | Corn Rhizosphere | MMGTKSVVRLTHLTDPHLYGGEAELLRGIATLPSLEATLAHA |
| Ga0157374_117676752 | 3300013296 | Miscanthus Rhizosphere | MMDKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLT |
| Ga0157372_122273021 | 3300013307 | Corn Rhizosphere | MSILRLTHFTDPHLYGSETESLRGVATLPALEATLAHAQQREWPP |
| Ga0132257_1010584791 | 3300015373 | Arabidopsis Rhizosphere | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHAR |
| Ga0182036_108520771 | 3300016270 | Soil | MSVLRLTQFTDPHLYGNESESLRGVPTLPALRAAL |
| Ga0182037_106938692 | 3300016404 | Soil | MSVLRIVQFTDPHLYGSENESLRGVPTLPALRAAL |
| Ga0182039_120991471 | 3300016422 | Soil | MSALRVTHFTDPHLYGDEKESLRGVPTLPALTAALAHARARDWPPDAV |
| Ga0182038_101512931 | 3300016445 | Soil | MSVLRLTQFTDPHLYGSENESLRGVPTLPALRAAL |
| Ga0187824_102171422 | 3300017927 | Freshwater Sediment | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAAL |
| Ga0187779_100346813 | 3300017959 | Tropical Peatland | MSVVRLTQFTDPHLYGGEHETLRGVATLPALQAALAHARARDWP |
| Ga0187776_110496141 | 3300017966 | Tropical Peatland | MSAVRLTHFTDPHLYGDPDEALRGVATLPALATAIAHARSHDWPPDA |
| Ga0187781_107492382 | 3300017972 | Tropical Peatland | MSGIRITQFTDPHLYGDEHESLRGVATLPALSAALAQARSRDWPPD |
| Ga0187777_111104612 | 3300017974 | Tropical Peatland | MSVLRLIQFTDPHLYGSENESLRGVPTLPALRAAL |
| Ga0187823_101075122 | 3300017993 | Freshwater Sediment | MSVVRLTHFTDPHLYGDETESLRGVATLPALTAALAAAQSRDWPPDALLV |
| Ga0187804_101678422 | 3300018006 | Freshwater Sediment | MSVLRLTQFTDPHLYGSETESLRGVPTLPALRAALAHAR |
| Ga0187766_109233232 | 3300018058 | Tropical Peatland | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHA |
| Ga0187772_110938141 | 3300018085 | Tropical Peatland | MSVVRLIQFTDPHLYADERGELRGIATLPALERTLAQARARDWPVEAL |
| Ga0193733_10266462 | 3300020022 | Soil | MSAVRLTHFTDPHLYGDERESLRGVATLPALTAALTHARARDWPPDA |
| Ga0179594_102121292 | 3300020170 | Vadose Zone Soil | MSVLRLIQFTDPHLYGSETETLRGIATLPALKAALADAQQSSAWP |
| Ga0210395_100299764 | 3300020582 | Soil | MSLLRLTHFTDPHLYGEADESLRGVATLPALSKAIAHAQG |
| Ga0210404_100521041 | 3300021088 | Soil | MTAVRLALFTDTHLYGDPRESLRGVVTLPALTAALAQA |
| Ga0210405_106883702 | 3300021171 | Soil | MSVVRLTHFTDPHLYGSEAEALRGVATLPALTAALARAQAQDWPPHAL |
| Ga0210408_109916971 | 3300021178 | Soil | MSVVRLTQFTDPHLYGGEHEALRGVATLPALTTAIAHARAR |
| Ga0210396_117562611 | 3300021180 | Soil | MSVVRLTHFTDPHLYASETEALRGVATLPALTAALARAQSH |
| Ga0210385_104530761 | 3300021402 | Soil | MDKSVLRLNHFTDPHLYGSETESLRGIATLPALKAT |
| Ga0210385_108723541 | 3300021402 | Soil | MSVVRLTHFTDPHLYGGELESLRGVATLPALTAAIAHAQ |
| Ga0210387_108640422 | 3300021405 | Soil | MDKSVLRLIQFTDPHLYGSETESLRGIATLPALTATLAQARSHDWPP |
| Ga0210384_109968861 | 3300021432 | Soil | MSAVRLTHFTDPHLYGDEKESLRGVATLPALTAALAQARARDWPPDAL |
| Ga0187846_102018751 | 3300021476 | Biofilm | MSVVRLTHLTDPHLYGSETETLRGVATLPALEAALAQARR |
| Ga0126371_134341221 | 3300021560 | Tropical Forest Soil | MSVLRLVQFTDPHLYGSENESLRGVPTLPALRAALAHARARD |
| Ga0247778_12221081 | 3300022894 | Plant Litter | MTVLRLIQFTDPHLYGSETETLRGIATLPALEAALGSAQASSGWPP |
| Ga0224551_10317531 | 3300023259 | Soil | MLRLIQFTDPHLYGSEAGSLRGVQTMAALERTLACARRRDWPV |
| Ga0247667_10945061 | 3300024290 | Soil | MSVVRITHFTDPHLYGDEHESLRGVQTLPALTAALAHARARDWPP |
| Ga0256348_10953271 | 3300024543 | Freshwater | MAVALLVQFTDTHLVGDPDGTLRGIATLSSLRRVLD |
| Ga0207707_100411274 | 3300025912 | Corn Rhizosphere | MMDKSVLRLTHFTDPHLYGSETESLRGIATLPALTATLTHAQTGDWPPDAVLVT |
| Ga0209375_12446072 | 3300026329 | Soil | MSAVRLTHFTDPHLYGDESGSLRGVATLPALTAALAHARARDWPPDAL |
| Ga0209056_101701482 | 3300026538 | Soil | MSVLRLTQFTDPHLYGDETGSLRGVVTLSSLTAALSHAQLRD |
| Ga0209213_10745071 | 3300027383 | Forest Soil | MSAVRLAHFTDPHLYGDERESLRGVVTLPALTAALAQARSRDWPP |
| Ga0209106_10328532 | 3300027616 | Forest Soil | MSAVRLAHFTDPHLYGDERESLRGVVTLPALAAALAHARSRDWPP |
| Ga0209328_100999462 | 3300027727 | Forest Soil | MSAVRLVHFTDTHLYGGEHELLRGVATLPALRAALAH |
| Ga0209177_103247732 | 3300027775 | Agricultural Soil | MSVLRLVQFTDPHLYGSESESLRGVPTLPALRAAL |
| Ga0209693_104096331 | 3300027855 | Soil | MSVVRLTHFTDPHLYGSETETLRGVATLPALIAALARAQSHDWPPDA |
| Ga0209579_103665022 | 3300027869 | Surface Soil | MSALRLVQFTDPHLYADEGGLLRGVATFPALLRTL |
| Ga0209068_104461052 | 3300027894 | Watersheds | MSVVRLTHFTDPHLYGGEQEALRGVPTLPALRAALAHAQRRDWPPS |
| Ga0268265_103017831 | 3300028380 | Switchgrass Rhizosphere | MSVLRLVQFTDPHLYGSETETLRGIATHPALLRTLNVAQ |
| Ga0302231_101329442 | 3300028775 | Palsa | MSHLRLIQFTDPHLYGSETESLRGVQTAPALAQALAQAR |
| Ga0311372_116589671 | 3300030520 | Palsa | MSLLRLVQFTDLHLYGSEAESLRGVRTVPALAHTLAQARARDWPVDA |
| Ga0311357_110842982 | 3300030524 | Palsa | MSAVRITHFTDPHLYGDENESLRGVATLPALTAALAHARARDWPPDAVLVT |
| Ga0311355_115233001 | 3300030580 | Palsa | MDKSVLRLNHFTDPHLYGSETESLRGIATLPALKATLGLAQARDWPPDALLVTG |
| Ga0311356_107618901 | 3300030617 | Palsa | MDKSVLRLNHFTDPHLYGSETESLRGIATLPALKATLGLAQARDW |
| Ga0302316_101058192 | 3300030646 | Palsa | MSVVRLTHFTDPHLYGGELESLRGVATLPALTAAIAH |
| Ga0302307_106052871 | 3300031233 | Palsa | MSVVRLTHFTDPHLYGGELESLRGVATLPALTAAIAHAQA |
| Ga0170819_128189421 | 3300031469 | Forest Soil | MSVLRLIQFTDPHLYGSETETLRGIATLPALKAALS |
| Ga0318516_107172871 | 3300031543 | Soil | MSVLRLIQFTDPHLYGSENESLRGVPTLPAVRAALAHARGRDWPPHA |
| Ga0318555_101282831 | 3300031640 | Soil | MSVLRITQFTDPHLYGSETESLRGVPTLPALRAARAPGRRMRCW |
| Ga0318555_107362521 | 3300031640 | Soil | MSVVRLTHFTDSHLYGDENGALRGVATLPALVAALASARTRDWPPDAL |
| Ga0318574_100804651 | 3300031680 | Soil | MSVLRIVQFTDPHLYGSENESLRGVPTLPALRAALAHAR |
| Ga0318574_101221471 | 3300031680 | Soil | MSVLRLTQFTDPHLYGNESESLRGVPTLPALRAALAHARARDWPPDA |
| Ga0318574_101278931 | 3300031680 | Soil | MSVLRLTQFTDPHLYGSENESLRGVPTLPALRAALAHARAREWPPHALLVTG |
| Ga0318574_104856561 | 3300031680 | Soil | MMAGVRIIQFTDPHLYGDENESLRGVATQPALAAAIAHARTRDWPPDAL |
| Ga0318572_101418041 | 3300031681 | Soil | MRRMSELRLIQFTDPHLYADESGALRGVMTLPALRRTLARAQARDWPV |
| Ga0307476_108982801 | 3300031715 | Hardwood Forest Soil | MDKSVIRLNHFTDPHLYGSETESLRGIATLPALKATLALAQARDWPP |
| Ga0318502_100121801 | 3300031747 | Soil | MSVLRLTQFTDPHLYGSENESLRGVPTLPALRAALA |
| Ga0318492_100381282 | 3300031748 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARTRDWPPDALLV |
| Ga0318521_101270151 | 3300031770 | Soil | MSVLRLIQFTDPHLYASESESLRGVPTLPALRAALAHARGRDWPPDALLV |
| Ga0318543_100065164 | 3300031777 | Soil | MSVLRLIQFTDPHLYGSEGESLRGVPTLPALRAALG |
| Ga0318498_100592081 | 3300031778 | Soil | MRRMSELRLIQFTDPHLYADESGALRGVMTLPALRRTLAHAQARDWP |
| Ga0318498_101296662 | 3300031778 | Soil | MSVVRLTHFTDSHLYGDENGALRGVATLPALVAALASARTRDWPPDALLV |
| Ga0318548_100613782 | 3300031793 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARARD |
| Ga0307478_109583432 | 3300031823 | Hardwood Forest Soil | MSAVRLIQFTDPHLYGDENEALRGVPTLPALRAALEHARARD |
| Ga0318564_102169211 | 3300031831 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALA |
| Ga0318536_100927812 | 3300031893 | Soil | MSVLRLIQFTDPHLYGSEGESLRGVPTLPALRAALGHARARDWPPDALLVT |
| Ga0306921_114238042 | 3300031912 | Soil | MRRMSELRLIQFTDPHLYADESGALRGVMTLPALRRTLAHAQA |
| Ga0310913_100480963 | 3300031945 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARARDWPPD |
| Ga0307479_104071672 | 3300031962 | Hardwood Forest Soil | MMDKSVLRLTHFTDPHLYGSESESLRGIATLPALTATLAHAQAHDW |
| Ga0307479_104687601 | 3300031962 | Hardwood Forest Soil | MSVLRLTQFTDPHLYGDETGSLRGVVTLSSLTAALSHARL |
| Ga0318563_101705741 | 3300032009 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALAHARARDWPPHALLVT |
| Ga0318507_102301601 | 3300032025 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALGHARARDWPPDA |
| Ga0318570_100411442 | 3300032054 | Soil | MSVLRLTQFTDPHLYGSENESLRGVPTLPALRAALAHARAREWP |
| Ga0318575_100281032 | 3300032055 | Soil | MSVLRLTQFTDPHLYGSENESLRGVPTLPALRAALAHARAREWPPHALLV |
| Ga0318505_101265271 | 3300032060 | Soil | MRRMSELRLIQFTDPHLYADESGALRGVMTLPALRRT |
| Ga0318525_100427232 | 3300032089 | Soil | MSVLRLVQFTDPHLYGSENESLRGVPTLPALRAALAHARARDWPPHA |
| Ga0318525_106097922 | 3300032089 | Soil | MRRMSELRLIQFTDPHLYADESGALRGVMTLPALRR |
| Ga0307470_102665832 | 3300032174 | Hardwood Forest Soil | MSAVRLTHFTDPHLYGDERESLRGVATLPALTAALAQARS |
| Ga0335069_109487871 | 3300032893 | Soil | MMSVVRLTHFTDPHLYGDATESLRGVATLPALAAAL |
| Ga0335069_119418031 | 3300032893 | Soil | MAMDKSVVRLTHFTDPHLYGSETESLRGIATFPAHKATLTHAQA |
| Ga0335075_102057852 | 3300032896 | Soil | MATSVVRLTHFTDPHLYGGEGELLRGIATLPSLEATLANAQRRDWPPD |
| Ga0310914_107008761 | 3300033289 | Soil | MSVLRLIQFTDPHLYGSESESLRGVPTLPALRAALGHARARDW |
| ⦗Top⦘ |