


| Basic Information | |
|---|---|
| Family ID | F063475 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FNQTALYGVVVGNQNGGSHGFPRTLQLSVSNRGTLADAD |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 96.90 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.450 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.558 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.411 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF08439 | Peptidase_M3_N | 42.64 |
| PF03741 | TerC | 10.08 |
| PF00072 | Response_reg | 0.78 |
| PF00145 | DNA_methylase | 0.78 |
| PF01381 | HTH_3 | 0.78 |
| PF01704 | UDPGP | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 42.64 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 10.08 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.78 |
| COG4284 | UDP-N-acetylglucosamine pyrophosphorylase | Carbohydrate transport and metabolism [G] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.45 % |
| Unclassified | root | N/A | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig33533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 2170459010|GIO7OMY01AVGFJ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300001664|P5cmW16_1003498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2893 | Open in IMG/M |
| 3300002532|JGI24019J35510_1022881 | Not Available | 972 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10476209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300003659|JGI25404J52841_10078230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300004633|Ga0066395_10976929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300005176|Ga0066679_10022550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3360 | Open in IMG/M |
| 3300005329|Ga0070683_102022468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300005332|Ga0066388_101368914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300005466|Ga0070685_10325016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300005557|Ga0066704_10572000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300005616|Ga0068852_102573173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300006804|Ga0079221_10860606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300006864|Ga0066797_1105234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | 988 | Open in IMG/M |
| 3300006904|Ga0075424_102813974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300007788|Ga0099795_10272420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300009101|Ga0105247_10222691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
| 3300009101|Ga0105247_10635820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300009143|Ga0099792_10517533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300009148|Ga0105243_11608070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300009545|Ga0105237_10733461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
| 3300009545|Ga0105237_10770327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300009551|Ga0105238_10288395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1623 | Open in IMG/M |
| 3300009551|Ga0105238_10489091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1230 | Open in IMG/M |
| 3300009624|Ga0116105_1207855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300009768|Ga0116193_1091771 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300010042|Ga0126314_11492511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300010321|Ga0134067_10344224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300010371|Ga0134125_12285300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300010373|Ga0134128_11979738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300010375|Ga0105239_11592333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300010376|Ga0126381_104359712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300010396|Ga0134126_10286337 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300010396|Ga0134126_12450453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300010398|Ga0126383_12027934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300010399|Ga0134127_12609251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300010403|Ga0134123_13326965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300011119|Ga0105246_10189721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1590 | Open in IMG/M |
| 3300011119|Ga0105246_10601812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300011270|Ga0137391_10836002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300012008|Ga0120174_1053970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1099 | Open in IMG/M |
| 3300012205|Ga0137362_10823577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300012208|Ga0137376_10679049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300012356|Ga0137371_10762401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300012469|Ga0150984_119311521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300012582|Ga0137358_10473147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
| 3300012683|Ga0137398_10367477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300012924|Ga0137413_10422053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300012944|Ga0137410_10724288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
| 3300012944|Ga0137410_11311646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300012951|Ga0164300_10577497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300012960|Ga0164301_11830926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300012986|Ga0164304_11232008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300012988|Ga0164306_11212280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300012989|Ga0164305_11097605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300012989|Ga0164305_12188837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300013102|Ga0157371_11512288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300013306|Ga0163162_10324576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1672 | Open in IMG/M |
| 3300013307|Ga0157372_10970505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 985 | Open in IMG/M |
| 3300013308|Ga0157375_10874479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300014157|Ga0134078_10126012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300014201|Ga0181537_10264473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
| 3300014325|Ga0163163_11507623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300014499|Ga0182012_10272114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1152 | Open in IMG/M |
| 3300014501|Ga0182024_12526857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300014587|Ga0135122_104726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300015199|Ga0167647_1152113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300015264|Ga0137403_10148019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2315 | Open in IMG/M |
| 3300015264|Ga0137403_10305306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1485 | Open in IMG/M |
| 3300015372|Ga0132256_103708688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300015374|Ga0132255_104284557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300016404|Ga0182037_11900870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300017965|Ga0190266_10262297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300018433|Ga0066667_11670414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300019996|Ga0193693_1027772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1007 | Open in IMG/M |
| 3300021082|Ga0210380_10058583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1670 | Open in IMG/M |
| 3300021180|Ga0210396_10552906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300021404|Ga0210389_10392657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
| 3300021405|Ga0210387_10722104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300021406|Ga0210386_11562018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300021420|Ga0210394_10426178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300021420|Ga0210394_11013573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300021475|Ga0210392_10896988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300021478|Ga0210402_10835948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300022529|Ga0242668_1134737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300022911|Ga0247783_1213502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300023068|Ga0224554_1113087 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300025893|Ga0207682_10225127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300025903|Ga0207680_10439471 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300025905|Ga0207685_10439854 | Not Available | 676 | Open in IMG/M |
| 3300025905|Ga0207685_10856633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300025914|Ga0207671_10355161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
| 3300025914|Ga0207671_10589178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 886 | Open in IMG/M |
| 3300025929|Ga0207664_11599054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300025938|Ga0207704_10335588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1171 | Open in IMG/M |
| 3300025944|Ga0207661_10414723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1223 | Open in IMG/M |
| 3300025949|Ga0207667_11240382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300026078|Ga0207702_10736849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 972 | Open in IMG/M |
| 3300026088|Ga0207641_12300852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300026274|Ga0209888_1053214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300026277|Ga0209350_1097039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300026306|Ga0209468_1128838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300026515|Ga0257158_1069109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300026527|Ga0209059_1179614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300026557|Ga0179587_11137734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300027334|Ga0209529_1019635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300027505|Ga0209218_1063725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300027651|Ga0209217_1215498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300027676|Ga0209333_1133846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300027853|Ga0209274_10290893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 839 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10324957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300028379|Ga0268266_11848399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300028380|Ga0268265_11989896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300028720|Ga0307317_10170396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300030580|Ga0311355_10984302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300030646|Ga0302316_10474906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031232|Ga0302323_102578784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300031235|Ga0265330_10019454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3111 | Open in IMG/M |
| 3300031239|Ga0265328_10067099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1318 | Open in IMG/M |
| 3300031446|Ga0170820_12764780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031446|Ga0170820_14783348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300031521|Ga0311364_12333705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300031715|Ga0307476_10844382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300031726|Ga0302321_101670711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300031833|Ga0310917_10953202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300031938|Ga0308175_102388003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300032076|Ga0306924_11042895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300032897|Ga0335071_10271237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6 | 1650 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.78% |
| Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Indoor Hospital Air | Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300002532 | Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362B_J2.571 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014587 | Indoor hospital air microbial communities from San Diego, USA - 248_D2_2014-9-5 | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026274 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00641990 | 2124908043 | Soil | AARHRVVIGDQNAGSHGVPRALQLSVSNRGTLADAD |
| F62_08339900 | 2170459010 | Grass Soil | VFNQTALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD |
| P5cmW16_10034984 | 3300001664 | Permafrost | LHHVLDQAALDRVVIDNQNGRRHGFPRTLQLFVSNRGTLADAD* |
| JGI24019J35510_10228812 | 3300002532 | Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | LHHILDEAPLYGIVVGNQNGRNHGIPRNSGLSQQHVSNRGTLADAD* |
| JGIcombinedJ51221_104762092 | 3300003505 | Forest Soil | HYRLIAAFLHHILDQAPLYGIIVGDQNAGSHGFPRNATLFVSNRGTLADAD* |
| JGI25404J52841_100782302 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LHHVFNQATLHGVIVGDQDGGSHWHSPHVTNLPVPNRVTVADAD* |
| Ga0066395_109769291 | 3300004633 | Tropical Forest Soil | AFLHHVLDQTALYWIVVGDQNDGSHGFLPALLLFVSNRGTLADAD* |
| Ga0066679_100225505 | 3300005176 | Soil | IAAFLHHVFNQATLYGIVVGNQNGGSHGIPRTLQLSVSNRGTLADAD* |
| Ga0070683_1020224682 | 3300005329 | Corn Rhizosphere | AFLHHVLDQAALYGVVVGDQNAGSHGFPRALRLSVSNRGTVADAD* |
| Ga0066388_1013689141 | 3300005332 | Tropical Forest Soil | AAFLHHVFNEATLNGVIVGNQDGGSHGTPRTYKLSVPNRGTVDDAD* |
| Ga0070685_103250162 | 3300005466 | Switchgrass Rhizosphere | DHDGFIAAFLHHVLNQATLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD* |
| Ga0066704_105720002 | 3300005557 | Soil | FLHHVFDQAARYGVIVGDQNAGSHGVPRTLQLSVSNRGTLAEAD* |
| Ga0068852_1025731732 | 3300005616 | Corn Rhizosphere | LYGVVIGNQNGGSHGFPHSLRLSVSNRGTLADAD* |
| Ga0079221_108606062 | 3300006804 | Agricultural Soil | QTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA* |
| Ga0066797_11052342 | 3300006864 | Soil | FLHHILDQATLDRVVVCDQNAGSHGFPRTLQLSVSNRGNVADAD* |
| Ga0075424_1028139741 | 3300006904 | Populus Rhizosphere | VFNQTALNGVVIGNQDGGSHGFPRTLQLSVSNRGTLADAD* |
| Ga0099795_102724201 | 3300007788 | Vadose Zone Soil | LYGVVIGNQNGGSHGFPRTLRLSVSNRGTVSDAD* |
| Ga0105247_102226912 | 3300009101 | Switchgrass Rhizosphere | LDRIIIGNQNTGSHGFPCTLRLSVSNRGTLADAD* |
| Ga0105247_106358201 | 3300009101 | Switchgrass Rhizosphere | LDQTALYWIVVGDQNGGSHGFPPALLLSVSNRGTVADGD* |
| Ga0099792_105175331 | 3300009143 | Vadose Zone Soil | LLHHVFNQATLYGVVVGNQNGGSHGVPRTLQLSVSNRGTLADAD* |
| Ga0105243_116080702 | 3300009148 | Miscanthus Rhizosphere | EGLITAFLHHVFNQTALYGVIVGNQNGGDHGFPRALRLSVSNRGTVADAD* |
| Ga0105237_107334611 | 3300009545 | Corn Rhizosphere | SLIAAFLHHILDEAALYGVVVCDQNAGSHGFPRNATLFVPNRGTFADAA* |
| Ga0105237_107703272 | 3300009545 | Corn Rhizosphere | AAFLNHVLYQPALDRIIISNQNTGSHGFPCTLRLSVSNRGTLADAD* |
| Ga0105238_102883951 | 3300009551 | Corn Rhizosphere | DQAALYGVVVGDQNAGSHGFPRALLLSVSNRGTVADAD* |
| Ga0105238_104890912 | 3300009551 | Corn Rhizosphere | LYGVVVGNQNGGSHGFPRTFLLSVSNRGTLADAD* |
| Ga0116105_12078552 | 3300009624 | Peatland | FDQAALYCVVIGNQNANRHGFPRALQLSVSNRVTVADAD* |
| Ga0116193_10917711 | 3300009768 | Anaerobic Digestor Sludge | HVFDEAALYGVVIGKQNGRNHGIPRNSGLSQQHVSNRGTLADAD* |
| Ga0126314_114925111 | 3300010042 | Serpentine Soil | AAFLHHVFDEPALYRVIVGDQNAGSHGFPRALQLSVSNRGTLADAD* |
| Ga0134067_103442241 | 3300010321 | Grasslands Soil | QAPCHSVVIDNQNAGSHGFPRTLQLSVLNRGTLADAD* |
| Ga0134125_122853002 | 3300010371 | Terrestrial Soil | GFLHHVLDQTALDCVIIDNQNGRRHGFPNLVQLFVSNRGTVADAD* |
| Ga0134128_119797381 | 3300010373 | Terrestrial Soil | ATLDRIVVGDQNAGSHGFARTLQLSVSSRGTVAAAD* |
| Ga0105239_115923332 | 3300010375 | Corn Rhizosphere | GYGVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD* |
| Ga0126381_1043597122 | 3300010376 | Tropical Forest Soil | LIAAFLHHILDQAPLYGVIVGDQNAGSHGFPRNATLFVSNRGTLADAD* |
| Ga0134126_102863371 | 3300010396 | Terrestrial Soil | HIFDEAPLDGVIIGDQNAGSHGFPRNATLSVSNRGTLADAD* |
| Ga0134126_124504532 | 3300010396 | Terrestrial Soil | ALDCVIIDNQNGRRHGFPHTLQLVVSNRGTLADAD* |
| Ga0126383_120279341 | 3300010398 | Tropical Forest Soil | VDNNRLITAFLHHVLDKAALYGVVVGDQNAGSHGFTPRATLSVSNRGNVADTD* |
| Ga0134127_126092511 | 3300010399 | Terrestrial Soil | QATLYGVVVGNQYGGSHGIPRTLQLFVPNRGTVADAD* |
| Ga0134123_133269652 | 3300010403 | Terrestrial Soil | VFNQTALHGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD* |
| Ga0105246_101897211 | 3300011119 | Miscanthus Rhizosphere | HVFNQTALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD* |
| Ga0105246_106018122 | 3300011119 | Miscanthus Rhizosphere | LYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD* |
| Ga0137391_108360021 | 3300011270 | Vadose Zone Soil | RYRVVVGNQNGGSHGIPRTLRLFVSNRGTLADAD* |
| Ga0120174_10539702 | 3300012008 | Permafrost | MAIAASAGIDDDGVIAAFLHHVFDQAAGDRVVVDNQNAGSHGFPRALQLSVSNRGNLADAD* |
| Ga0137362_108235771 | 3300012205 | Vadose Zone Soil | LDQAPCHSVVIDNQNAGSHGFPRTLQLFVLNRGTLADAD* |
| Ga0137376_106790491 | 3300012208 | Vadose Zone Soil | TARYRVVVGNQNAGSHGFPRAVQLFVLNRGTLADAD* |
| Ga0137371_107624011 | 3300012356 | Vadose Zone Soil | RLIAAFLHHVLDLAPCHSGGIDNQNAGSHGFPRTLQLSVLNRGTLADAD* |
| Ga0150984_1193115211 | 3300012469 | Avena Fatua Rhizosphere | PAGYSVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD* |
| Ga0137358_104731471 | 3300012582 | Vadose Zone Soil | TALYRIVVGDQNGGCHGFPPALLLFVSNRGTLADAD* |
| Ga0137398_103674772 | 3300012683 | Vadose Zone Soil | FNQTTLYGVVVGNQNGGSHGFPRTLRLSVSNRGTVADAD* |
| Ga0137413_104220531 | 3300012924 | Vadose Zone Soil | FKRALIGINQNAGSHGFPRTLQLAVLNRGTLADAD* |
| Ga0137410_107242882 | 3300012944 | Vadose Zone Soil | DHLRFIAAFLHHVFDQATLYGIVVGNQNGSSHGIPRTLQLSVSNRGTLADAD* |
| Ga0137410_113116461 | 3300012944 | Vadose Zone Soil | LYRVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD* |
| Ga0164300_105774972 | 3300012951 | Soil | GITAFDHEGLITAFLHHVFNQTALYGVIIGNQNGGDHGFPRALRLSVSNRGTLADAD* |
| Ga0164301_118309262 | 3300012960 | Soil | FLHHVFNQTALYGVIIGNQNGGDHGFPRALRLLVSNRGTLADAD* |
| Ga0164304_112320082 | 3300012986 | Soil | GVDDDGLIAAFLNHVFDQTALDRIVVGDQNAGSHGFPRTLRLSVLNRGTVADAD* |
| Ga0164306_112122802 | 3300012988 | Soil | AAALHHVFDQAARYRVIIGNQNGRSHGIPRTLQLSVSNRGTLADAD* |
| Ga0164305_110976052 | 3300012989 | Soil | TAFLHHVFNQTALYGVIIGNQNGGNHGFPRVLRLSVSNRGTLAEAD* |
| Ga0164305_121888371 | 3300012989 | Soil | LYGVIIGNQNGGDHGFPRALRLFVSNRGTLADAD* |
| Ga0157371_115122882 | 3300013102 | Corn Rhizosphere | ILDQATLHGIVVGNQNGGGHGVPHALQLSVSNRGTLADAD* |
| Ga0163162_103245761 | 3300013306 | Switchgrass Rhizosphere | AFNHEGLITAFLHHVFNQTALYGVIIGNQNGGNHGFPRALRLSVSNRGTLADAD* |
| Ga0157372_109705051 | 3300013307 | Corn Rhizosphere | FLHHILDQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA* |
| Ga0157375_108744792 | 3300013308 | Miscanthus Rhizosphere | EGLIAALLHHVFNQTALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLAEAD* |
| Ga0134078_101260122 | 3300014157 | Grasslands Soil | VDQPALYRVIVGYQNAGSHGFPRPLQLSVSNRGTLADAD* |
| Ga0181537_102644732 | 3300014201 | Bog | VLDQSPLHGIVIGNQNTGSHGFPRALQLSVSNRGTLADAD* |
| Ga0163163_115076231 | 3300014325 | Switchgrass Rhizosphere | ALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLAEAD* |
| Ga0182012_102721142 | 3300014499 | Bog | AAFLNHVFEQAASHGIIVGDQNAGSHGFPRALLLSVSNRGTLADAD* |
| Ga0182024_125268572 | 3300014501 | Permafrost | AARHRIVIGNQNAGSHGIPRTLQLSVSNRGTLADAD* |
| Ga0135122_1047262 | 3300014587 | Indoor Hospital Air | VDNGGFIAAFLHHVFNQATLYGVIVGDQNGGSHGTPRTLQLSVPNRGTVADAD* |
| Ga0167647_11521132 | 3300015199 | Glacier Forefield Soil | FDQPALYGVVIDDQDAGSHGVPRTLQLSVSNRGTLADAD* |
| Ga0137403_101480193 | 3300015264 | Vadose Zone Soil | FNQTALYGVVVGNQNGGSHGFPRTLRLSVSNRGTLADAD* |
| Ga0137403_103053061 | 3300015264 | Vadose Zone Soil | FNQTALYGVVVGNQNGGSHGFPRTLQLSVSNRGTLADAD* |
| Ga0132256_1037086881 | 3300015372 | Arabidopsis Rhizosphere | AALDHQGLIAALLHHDFNQTALYGVIIGNQNGGDHGFPRALRLFVSNRGTFADAD* |
| Ga0132255_1042845572 | 3300015374 | Arabidopsis Rhizosphere | ALYGVIIGNQNGGDHGFPRALRLFVSNRGTLADAD* |
| Ga0182037_119008702 | 3300016404 | Soil | VLEQPPGYSVVVGDQNTGSHGVPRTLLLFVSNRGTLAEAD |
| Ga0190266_102622972 | 3300017965 | Soil | FDQTPRYRIVIGNQNGRSHGFPRTLQLSVSNRGTLADAD |
| Ga0066667_116704142 | 3300018433 | Grasslands Soil | QTALYRVVVGNQNGGSHGFPRTLRLSVSNRGTLADAD |
| Ga0193693_10277721 | 3300019996 | Soil | TALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD |
| Ga0210380_100585832 | 3300021082 | Groundwater Sediment | VFNQTALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD |
| Ga0210396_105529062 | 3300021180 | Soil | FLHHIFNQAALHRIVVGDQNGSSHGVPHTQQLSVSNRGTLADAD |
| Ga0210389_103926571 | 3300021404 | Soil | LDETTLYWIVVNDQNGGSHGFLPALILSVSNRGTLADAD |
| Ga0210387_107221041 | 3300021405 | Soil | QAARHGIVIGNQNAGSHGFPRALQLSVSNRGTLAEAD |
| Ga0210386_115620182 | 3300021406 | Soil | QATLHRVVVGDQNPGSHGVPHSLQLSVSNRGTLADAD |
| Ga0210394_104261782 | 3300021420 | Soil | HHILYQAALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| Ga0210394_110135732 | 3300021420 | Soil | VLDQAALDRVVIDNQNGRRHGFPRTLQLFVSNRGTLADAD |
| Ga0210392_108969881 | 3300021475 | Soil | ALYGVIVGDQNAGSHGFPRNATLSVPNRGTLADAD |
| Ga0210402_108359482 | 3300021478 | Soil | FNQAALYGVVVGDQNAGSHGVPRTLQLSVSNRGTVADAD |
| Ga0242668_11347371 | 3300022529 | Soil | AALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| Ga0247783_12135022 | 3300022911 | Plant Litter | NQATLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD |
| Ga0224554_11130871 | 3300023068 | Soil | LHHILDEAPLYGIVVGNQNGRNHGIPRNSGLSQQHVSNRGTLADAD |
| Ga0207682_102251272 | 3300025893 | Miscanthus Rhizosphere | TLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD |
| Ga0207680_104394711 | 3300025903 | Switchgrass Rhizosphere | KAALNGVVVGNQNGRSHGVPRTSQLSVSNRGTLADAD |
| Ga0207685_104398542 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNQAALYGVVVGDQNAGSHGFPRALLLSVSNRGTVADAD |
| Ga0207685_108566332 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EAALYGVVVGDQNAGNHGFPCNATLSVPNRGTLADAD |
| Ga0207671_103551611 | 3300025914 | Corn Rhizosphere | DQPAGYSVVVGDQNTGSHGVPRTLLLSVSNRVTLAEAD |
| Ga0207671_105891782 | 3300025914 | Corn Rhizosphere | HQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA |
| Ga0207664_115990541 | 3300025929 | Agricultural Soil | LHHVFDKAALNRIVVRNQNGGSHGFPRALQLSVSNRGTLADAD |
| Ga0207704_103355883 | 3300025938 | Miscanthus Rhizosphere | ALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD |
| Ga0207661_104147231 | 3300025944 | Corn Rhizosphere | QPACYGIVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD |
| Ga0207667_112403822 | 3300025949 | Corn Rhizosphere | TALHCVVIGNQNGGSHGFPRTLRLFVSNRGTLADAD |
| Ga0207702_107368491 | 3300026078 | Corn Rhizosphere | DQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA |
| Ga0207641_123008522 | 3300026088 | Switchgrass Rhizosphere | QPALDRIIISNQNTGSHGFPCTLRLSVSNRGTLADAD |
| Ga0209888_10532142 | 3300026274 | Permafrost Soil | FDQPALYGVVIDNQDAGSHGVPRTLQLSVSNRGTLADAD |
| Ga0209350_10970391 | 3300026277 | Grasslands Soil | DQAPCHSVVIDNQNAGSHGFPRTLQLSVLNRGTLADAD |
| Ga0209468_11288382 | 3300026306 | Soil | VVEQPALDRVVVGYQNAGSHGFPRALQLSVSNRGTLADAD |
| Ga0257158_10691091 | 3300026515 | Soil | NEAALYGVVVGDQNAGSHGVPRTLQLSVSNRGTVADAD |
| Ga0209059_11796141 | 3300026527 | Soil | ALYGIVVGDQNAGSHGVPRTQQLSVSNRGTLADAD |
| Ga0179587_111377341 | 3300026557 | Vadose Zone Soil | TLHRVVIGDQNAGSHGVPHSLQLSVSNRGTLADAD |
| Ga0209529_10196352 | 3300027334 | Forest Soil | LYQAALHCIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| Ga0209218_10637252 | 3300027505 | Forest Soil | QAALHSIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| Ga0209217_12154981 | 3300027651 | Forest Soil | QAACHRIVVGNQNAGSHGVPRTLQLSVSNRGTVADAD |
| Ga0209333_11338461 | 3300027676 | Forest Soil | YHILYQAALHCIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| Ga0209274_102908931 | 3300027853 | Soil | NQAALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD |
| (restricted) Ga0233415_103249572 | 3300027861 | Seawater | LDQPAGYSVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD |
| Ga0268266_118483991 | 3300028379 | Switchgrass Rhizosphere | FYQTTLYGVIIGDQNGGSHGFPRTLRLFVSNRGTVADAD |
| Ga0268265_119898962 | 3300028380 | Switchgrass Rhizosphere | TRYRIVIGNQNGRSHGFPRTLQLSVSNRGTLADAD |
| Ga0307317_101703961 | 3300028720 | Soil | ALYRIIVGDQNAGSHGFPRALQLSVSNRGTLADAD |
| Ga0311355_109843022 | 3300030580 | Palsa | ILNQPALHCIVVGDQNGGGHGVPHTQQLSVSNRGTLADAD |
| Ga0302316_104749062 | 3300030646 | Palsa | HHVFDQAARHSIVIGNQNAGRHGFPRALQLSVSNRGTLADAD |
| Ga0302323_1025787841 | 3300031232 | Fen | QTALYRVVVDNQNGGSHGFPRTLRLSVSNRGTVADAD |
| Ga0265330_100194545 | 3300031235 | Rhizosphere | DQAAGDRIVVDNQNAGSHGFPRALQLSVSNRGNLADAD |
| Ga0265328_100670992 | 3300031239 | Rhizosphere | QAAGDRIVVDNQNAGSHGFPRALQLSVSNRGNLADAD |
| Ga0170820_127647801 | 3300031446 | Forest Soil | QAARHRVVVGNQNAGSHGFPRALQLSVSNRGTLADAD |
| Ga0170820_147833482 | 3300031446 | Forest Soil | SLHHILDQATLHCIVVGDQNAGSHGIPHALQLSVSNRGTLADAD |
| Ga0311364_123337051 | 3300031521 | Fen | QAAGHRVVVGDQNAGSHGVPRALQLSVSNRGTLADAD |
| Ga0307476_108443822 | 3300031715 | Hardwood Forest Soil | HIFYQAALHRIVVGDQNGGSHGVPHMQQLSVSNRGTLADAD |
| Ga0302321_1016707112 | 3300031726 | Fen | DQAARHRVVIGDQNAGSHGVPRALQLSVSNRGTLADAD |
| Ga0310917_109532021 | 3300031833 | Soil | LDEAALHGIIISDQNCGGHGFPPAMRLCVSNRGTLADEA |
| Ga0308175_1023880032 | 3300031938 | Soil | LHHVLDQAPRYGIIVGDQNTGSHGVPRTLLLFVSNRGTLAEAD |
| Ga0306924_110428951 | 3300032076 | Soil | TALYGVIVGDQNAGSHGFPRNATLFVSNRGTLADAD |
| Ga0335071_102712371 | 3300032897 | Soil | LYQPALHGIVVGDQNAGSHGFTPHATLCVSNRGNVADTD |
| ⦗Top⦘ |