


| Basic Information | |
|---|---|
| Family ID | F063437 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.29 % |
| % of genes near scaffold ends (potentially truncated) | 23.26 % |
| % of genes from short scaffolds (< 2000 bps) | 82.17 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.341 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.233 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.085 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 14.29% Coil/Unstructured: 76.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 15.50 |
| PF08734 | GYD | 7.75 |
| PF00903 | Glyoxalase | 3.10 |
| PF00027 | cNMP_binding | 3.10 |
| PF11249 | DUF3047 | 3.10 |
| PF00487 | FA_desaturase | 2.33 |
| PF11154 | DUF2934 | 1.55 |
| PF02675 | AdoMet_dc | 1.55 |
| PF00941 | FAD_binding_5 | 1.55 |
| PF13408 | Zn_ribbon_recom | 0.78 |
| PF00072 | Response_reg | 0.78 |
| PF04392 | ABC_sub_bind | 0.78 |
| PF03795 | YCII | 0.78 |
| PF13545 | HTH_Crp_2 | 0.78 |
| PF04226 | Transgly_assoc | 0.78 |
| PF13701 | DDE_Tnp_1_4 | 0.78 |
| PF00011 | HSP20 | 0.78 |
| PF11897 | DUF3417 | 0.78 |
| PF07238 | PilZ | 0.78 |
| PF03448 | MgtE_N | 0.78 |
| PF00005 | ABC_tran | 0.78 |
| PF00528 | BPD_transp_1 | 0.78 |
| PF06305 | LapA_dom | 0.78 |
| PF13384 | HTH_23 | 0.78 |
| PF14499 | DUF4437 | 0.78 |
| PF00166 | Cpn10 | 0.78 |
| PF12681 | Glyoxalase_2 | 0.78 |
| PF13683 | rve_3 | 0.78 |
| PF13649 | Methyltransf_25 | 0.78 |
| PF01070 | FMN_dh | 0.78 |
| PF07355 | GRDB | 0.78 |
| PF01068 | DNA_ligase_A_M | 0.78 |
| PF12867 | DinB_2 | 0.78 |
| PF13492 | GAF_3 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 15.50 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 7.75 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 2.33 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 2.33 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.55 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.78 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.78 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.78 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.78 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.78 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.34 % |
| Unclassified | root | N/A | 35.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10032811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Bipolaricaulota → Candidatus Bipolaricaulis → Candidatus Bipolaricaulis anaerobius | 1004 | Open in IMG/M |
| 3300000550|F24TB_10625698 | Not Available | 745 | Open in IMG/M |
| 3300000550|F24TB_11647641 | Not Available | 743 | Open in IMG/M |
| 3300000574|JGI1357J11328_10194006 | Not Available | 551 | Open in IMG/M |
| 3300000956|JGI10216J12902_108499302 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300002122|C687J26623_10074980 | Not Available | 920 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101589430 | Not Available | 551 | Open in IMG/M |
| 3300002886|JGI25612J43240_1055814 | Not Available | 593 | Open in IMG/M |
| 3300004099|Ga0058900_1408987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 920 | Open in IMG/M |
| 3300004117|Ga0058893_1004743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300005294|Ga0065705_10586497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
| 3300005406|Ga0070703_10011802 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300005440|Ga0070705_101098836 | Not Available | 650 | Open in IMG/M |
| 3300005444|Ga0070694_100006034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7352 | Open in IMG/M |
| 3300005445|Ga0070708_101628881 | Not Available | 600 | Open in IMG/M |
| 3300005467|Ga0070706_100299531 | Not Available | 1500 | Open in IMG/M |
| 3300005467|Ga0070706_100364476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
| 3300005468|Ga0070707_101292531 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005471|Ga0070698_100926025 | Not Available | 817 | Open in IMG/M |
| 3300005471|Ga0070698_101737088 | Not Available | 576 | Open in IMG/M |
| 3300005518|Ga0070699_101166951 | Not Available | 706 | Open in IMG/M |
| 3300005526|Ga0073909_10271892 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005564|Ga0070664_100120540 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300006041|Ga0075023_100071718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300006047|Ga0075024_100193154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 950 | Open in IMG/M |
| 3300006845|Ga0075421_102766068 | Not Available | 506 | Open in IMG/M |
| 3300006852|Ga0075433_10388738 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300006854|Ga0075425_100747032 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300007265|Ga0099794_10089521 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300007265|Ga0099794_10535411 | Not Available | 618 | Open in IMG/M |
| 3300009078|Ga0105106_10186510 | All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Desulfurobacteriales → Desulfurobacteriaceae | 1517 | Open in IMG/M |
| 3300009088|Ga0099830_10141929 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300009088|Ga0099830_11262541 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 614 | Open in IMG/M |
| 3300009090|Ga0099827_10693749 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300009143|Ga0099792_10027257 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
| 3300009143|Ga0099792_10166038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1229 | Open in IMG/M |
| 3300009147|Ga0114129_12744771 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009171|Ga0105101_10265596 | All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae | 829 | Open in IMG/M |
| 3300009804|Ga0105063_1039920 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009816|Ga0105076_1020857 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300009837|Ga0105058_1123113 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010159|Ga0099796_10184699 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010391|Ga0136847_12701155 | Not Available | 838 | Open in IMG/M |
| 3300010400|Ga0134122_11068110 | Not Available | 797 | Open in IMG/M |
| 3300010400|Ga0134122_12399452 | Not Available | 575 | Open in IMG/M |
| 3300011120|Ga0150983_15941910 | Not Available | 617 | Open in IMG/M |
| 3300011270|Ga0137391_10508344 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300011271|Ga0137393_11321606 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012034|Ga0137453_1019283 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012174|Ga0137338_1102444 | Not Available | 630 | Open in IMG/M |
| 3300012189|Ga0137388_10064275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3031 | Open in IMG/M |
| 3300012199|Ga0137383_11074663 | Not Available | 584 | Open in IMG/M |
| 3300012203|Ga0137399_10166539 | Not Available | 1771 | Open in IMG/M |
| 3300012205|Ga0137362_10201269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1714 | Open in IMG/M |
| 3300012355|Ga0137369_10714238 | Not Available | 688 | Open in IMG/M |
| 3300012582|Ga0137358_10555129 | Not Available | 772 | Open in IMG/M |
| 3300012683|Ga0137398_11125959 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012685|Ga0137397_10047316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3083 | Open in IMG/M |
| 3300012917|Ga0137395_11198138 | Not Available | 532 | Open in IMG/M |
| 3300012923|Ga0137359_10287267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1466 | Open in IMG/M |
| 3300012958|Ga0164299_11414571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300012960|Ga0164301_10251568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1161 | Open in IMG/M |
| 3300015241|Ga0137418_10057192 | All Organisms → cellular organisms → Bacteria | 3574 | Open in IMG/M |
| 3300015259|Ga0180085_1113744 | Not Available | 802 | Open in IMG/M |
| 3300015371|Ga0132258_10004794 | All Organisms → cellular organisms → Bacteria | 26341 | Open in IMG/M |
| 3300018052|Ga0184638_1116390 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300018063|Ga0184637_10042932 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300018071|Ga0184618_10159472 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300018077|Ga0184633_10621329 | Not Available | 508 | Open in IMG/M |
| 3300018078|Ga0184612_10527939 | Not Available | 571 | Open in IMG/M |
| 3300018084|Ga0184629_10197203 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300018422|Ga0190265_11099049 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018422|Ga0190265_11678653 | Not Available | 746 | Open in IMG/M |
| 3300018469|Ga0190270_13238830 | Not Available | 516 | Open in IMG/M |
| 3300019877|Ga0193722_1088618 | Not Available | 752 | Open in IMG/M |
| 3300019879|Ga0193723_1015973 | Not Available | 2334 | Open in IMG/M |
| 3300019881|Ga0193707_1087285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 948 | Open in IMG/M |
| 3300019882|Ga0193713_1198330 | Not Available | 513 | Open in IMG/M |
| 3300019887|Ga0193729_1213491 | Not Available | 646 | Open in IMG/M |
| 3300020579|Ga0210407_11039188 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300020580|Ga0210403_10308006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1298 | Open in IMG/M |
| 3300020580|Ga0210403_10515336 | Not Available | 971 | Open in IMG/M |
| 3300021081|Ga0210379_10268098 | Not Available | 743 | Open in IMG/M |
| 3300021178|Ga0210408_10500222 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300021432|Ga0210384_10001094 | All Organisms → cellular organisms → Bacteria | 38227 | Open in IMG/M |
| 3300021432|Ga0210384_10136583 | Not Available | 2200 | Open in IMG/M |
| 3300025160|Ga0209109_10159788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1130 | Open in IMG/M |
| 3300025165|Ga0209108_10256337 | Not Available | 888 | Open in IMG/M |
| 3300025324|Ga0209640_10552417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 934 | Open in IMG/M |
| 3300025885|Ga0207653_10062909 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300025910|Ga0207684_10002275 | All Organisms → cellular organisms → Bacteria | 19537 | Open in IMG/M |
| 3300025910|Ga0207684_10013441 | All Organisms → cellular organisms → Bacteria | 7080 | Open in IMG/M |
| 3300025910|Ga0207684_10209051 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300025910|Ga0207684_10241380 | Not Available | 1559 | Open in IMG/M |
| 3300025922|Ga0207646_10011144 | All Organisms → cellular organisms → Bacteria | 8727 | Open in IMG/M |
| 3300025922|Ga0207646_10245437 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1617 | Open in IMG/M |
| 3300025922|Ga0207646_10994277 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300026369|Ga0257152_1000115 | All Organisms → cellular organisms → Bacteria | 4445 | Open in IMG/M |
| 3300026481|Ga0257155_1045296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
| 3300026481|Ga0257155_1060682 | Not Available | 599 | Open in IMG/M |
| 3300026482|Ga0257172_1027524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300026496|Ga0257157_1023907 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300026551|Ga0209648_10414965 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300027013|Ga0209884_1008346 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300027273|Ga0209886_1084131 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027277|Ga0209846_1030084 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300027655|Ga0209388_1145907 | Not Available | 670 | Open in IMG/M |
| 3300027727|Ga0209328_10028973 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300027727|Ga0209328_10275267 | Not Available | 500 | Open in IMG/M |
| 3300027818|Ga0209706_10151372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300027882|Ga0209590_10438123 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
| 3300027894|Ga0209068_10000887 | All Organisms → cellular organisms → Bacteria | 15333 | Open in IMG/M |
| 3300027903|Ga0209488_11233070 | Not Available | 502 | Open in IMG/M |
| 3300027909|Ga0209382_10394750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1542 | Open in IMG/M |
| 3300027915|Ga0209069_10039834 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300027915|Ga0209069_10203152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1012 | Open in IMG/M |
| 3300028792|Ga0307504_10167443 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300029636|Ga0222749_10018920 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2834 | Open in IMG/M |
| 3300030006|Ga0299907_10179037 | Not Available | 1752 | Open in IMG/M |
| 3300030990|Ga0308178_1020807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300031720|Ga0307469_11065582 | Not Available | 758 | Open in IMG/M |
| 3300031949|Ga0214473_10047476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5030 | Open in IMG/M |
| 3300032017|Ga0310899_10311719 | Not Available | 733 | Open in IMG/M |
| 3300032180|Ga0307471_101049694 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300032205|Ga0307472_100933487 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300033433|Ga0326726_10011479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7811 | Open in IMG/M |
| 3300033433|Ga0326726_10039785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4105 | Open in IMG/M |
| 3300033433|Ga0326726_10143848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2169 | Open in IMG/M |
| 3300033486|Ga0316624_11568817 | Not Available | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.30% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.33% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.33% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.78% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004117 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF222 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_100328112 | 3300000443 | Soil | MPKVLVCGFCSEEIEAEEKWLEVPGRGNEVAHLKCWKESNRPEVRSRSL* |
| F24TB_106256983 | 3300000550 | Soil | MPKVLVCVFCSEEIEAEEKWLEVPGRGNEVAHLKCWKESNRPEVRSRSL* |
| F24TB_116476411 | 3300000550 | Soil | MPKVLVCVFCSQEIDAKEKWLDVPGRGNEVAHLNCWKDSNRPEVRTRSL* |
| JGI1357J11328_101940062 | 3300000574 | Groundwater | VFCAEEIGTEEKWLDVPGKVNEIAHLKCWKDNMRPEVRSRSV* |
| JGI10216J12902_1084993023 | 3300000956 | Soil | MPKVLVCVFCSQEIDAEEKWLDVPGKGNEVAHLNCWKESNRPEV |
| C687J26623_100749803 | 3300002122 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST* |
| JGIcombinedJ26739_1015894302 | 3300002245 | Forest Soil | MPKVLVCVFCFEEIDGMEKWIDAPGRMNEVAHLKCWKENVRPEVRTRSV* |
| JGI25612J43240_10558142 | 3300002886 | Grasslands Soil | HMPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0058900_14089871 | 3300004099 | Forest Soil | MPKVLVCVFCFEEIAMEEKWLDVPGRMNEVAHLKCWKDHSRPEVRSRSI* |
| Ga0058893_10047431 | 3300004117 | Forest Soil | MPKVLVCAFCFEEIDGMEKWLDVPGRMNEAAHLKCWKENVRPEVRTRSV* |
| Ga0065705_105864972 | 3300005294 | Switchgrass Rhizosphere | MPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENIRPEVRSRSV* |
| Ga0070703_100118022 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST* |
| Ga0070705_1010988362 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEINAKEKWVDVPGRMNEVAHLKCWKENIRPEVRSRSI* |
| Ga0070694_1000060343 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEANEKWLDVPGRVNEVAHLKCWKENSRPEVRSRST* |
| Ga0070708_1016288811 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0070706_1002995312 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRVNEVAHLKCWKENIRPEVRSRSV* |
| Ga0070706_1003644763 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEVKEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0070707_1012925311 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKESNRPEVRSRST* |
| Ga0070698_1009260252 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWKENIRPEVRSRSV* |
| Ga0070698_1017370881 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKALVCVFGSEEIEAQEKWLDLPGRTNEVAHLKCWKENNRFEVRSRST* |
| Ga0070699_1011669512 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MCVFCAEEIEAKEKWLDVPGRMNEVAHLKCWKENNRPEVRSRST* |
| Ga0073909_102718922 | 3300005526 | Surface Soil | VPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENTRPEVRSRST* |
| Ga0070664_1001205402 | 3300005564 | Corn Rhizosphere | MPKVSVCVFCSQEIQAKEKWLDVPSRMNEVAHLKCWKESIRPEVRSRSV* |
| Ga0075023_1000717182 | 3300006041 | Watersheds | MPKVLVCVFCSEEIEAQEKWLNVPGRTNEAAHLKCWKENNRPEVRSRST* |
| Ga0075024_1001931541 | 3300006047 | Watersheds | MPKVLVCVFCSEEIEAKEKWLDVPGRINEVAHLKCWKESNRPEVRSRST* |
| Ga0075421_1027660682 | 3300006845 | Populus Rhizosphere | MPKVLVCVFCSEEIAAKEKWLDVPGRMNEVAHLKCWKENSRPEVRTRST* |
| Ga0075433_103887382 | 3300006852 | Populus Rhizosphere | MPKVLVCAFCFEEIDGMEKWLDVPGRMNEMAHLKCWKENVRPEVRTRSV* |
| Ga0075425_1007470322 | 3300006854 | Populus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLCWKENIRPEVRSRSV* |
| Ga0099794_100895212 | 3300007265 | Vadose Zone Soil | MPKVLVGVFCSEEIEAQEQWLDVPGRTNEVAHLTCWKENNRPEVCSRST* |
| Ga0099794_105354111 | 3300007265 | Vadose Zone Soil | VLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0105106_101865101 | 3300009078 | Freshwater Sediment | MPKVLVCVFCSEEIEEKEKWLDVPGRMNELAHLKCWKESNRPEVRSRSTYS* |
| Ga0099830_101419292 | 3300009088 | Vadose Zone Soil | MPKVLVGVFCSEEIEAQEKWLDVPGRTNEVAHLTCWKENNRPEVCSRST* |
| Ga0099830_112625412 | 3300009088 | Vadose Zone Soil | MPKVLVCVFCFEEINAQEKWVDVPGRVNEAAHLKCWKENIRPEVRSRSI* |
| Ga0099827_106937493 | 3300009090 | Vadose Zone Soil | LVCVFCFEEIGAKEKWVDVPGRMNEVAHLKCWKENIRPEVRSRSI* |
| Ga0099792_100272573 | 3300009143 | Vadose Zone Soil | MPKVLVGVFCSEEIEAQEQWLDVPGRTNEVAHLTCWKENNRPEVRSRST* |
| Ga0099792_101660381 | 3300009143 | Vadose Zone Soil | MPKVLVCVLCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0114129_127447712 | 3300009147 | Populus Rhizosphere | MPKVLVCVFCSQEIDAEEKWLDVPGKGNEVAHLNCWKESNRPEVRTRSL* |
| Ga0105101_102655962 | 3300009171 | Freshwater Sediment | MCGFCSEEIEEKEKWLDVPGRMNELAHLKCWKESNRPEVRSRSTYS* |
| Ga0105063_10399202 | 3300009804 | Groundwater Sand | CHMPKVLVCVFCLEEINVKEKWLDVPGRVNDVAHLKCWKENIRPEVRSRST* |
| Ga0105076_10208573 | 3300009816 | Groundwater Sand | MPKVLVCVFCSEEIEVKEKWLDVPGRMNEVAHLKCWKENNRPEVRSRSV* |
| Ga0105058_11231132 | 3300009837 | Groundwater Sand | FCSEEIEAKEKWLDVPGRMNEVAHLKCWKENNRPEVRSRST* |
| Ga0099796_101846991 | 3300010159 | Vadose Zone Soil | FCSEEIEAQEKWLDVPGRTNEVAHLTCWKENNRPEVRSRST* |
| Ga0136847_127011552 | 3300010391 | Freshwater Sediment | MPKVLVCVFCSEEIEAKEKWLDVPGRVNEAAHLKCWKENNRPEVRSRST* |
| Ga0134122_110681101 | 3300010400 | Terrestrial Soil | ARRTRRCSMPKVLVCVFCSDEISDEEKCLDVPGKVNEVAHLKCWKENNRPEVRSRST* |
| Ga0134122_123994521 | 3300010400 | Terrestrial Soil | TRRSCHMPKVLVCVFCSEEIEAQEKWLDVPGRTNEVVHLKCWKENNRPEVRSRST* |
| Ga0150983_159419101 | 3300011120 | Forest Soil | RRGHMPKVLVCAFCFEEIDGMEKWLDVPGRMNEAAHLKCWKENVRPEVRTRSV* |
| Ga0137391_105083442 | 3300011270 | Vadose Zone Soil | MPKVLVGVFCSEEIEAQEQWLDVPGRTNEVAHLTCWKENNRHEVCSRST* |
| Ga0137393_113216061 | 3300011271 | Vadose Zone Soil | MPKVLVCVFCSEEIEPKEQWLDVPGRTNEVAHLTCGKENNRPEVCSRST* |
| Ga0137453_10192832 | 3300012034 | Soil | MPKVLVCVFCSDEISAEEKCLDVPGKMNEVAHLKCWKENNRPEVRSRST* |
| Ga0137338_11024442 | 3300012174 | Soil | MPKVLVCVFCSEEIEEKEKWLDVPGRMNELAHLKCWKESNRPEVRSRST* |
| Ga0137388_100642758 | 3300012189 | Vadose Zone Soil | MPKVLVCLFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137383_110746631 | 3300012199 | Vadose Zone Soil | VCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137399_101665393 | 3300012203 | Vadose Zone Soil | MPKVLVGVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137362_102012691 | 3300012205 | Vadose Zone Soil | CHMPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137369_107142382 | 3300012355 | Vadose Zone Soil | MPKVLVRVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENSRPEVRSCST* |
| Ga0137358_105551291 | 3300012582 | Vadose Zone Soil | FCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137398_111259591 | 3300012683 | Vadose Zone Soil | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLTCWKENNRPEVRSRST* |
| Ga0137397_100473161 | 3300012685 | Vadose Zone Soil | AQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST* |
| Ga0137395_111981381 | 3300012917 | Vadose Zone Soil | MPKVLVCVFCSEEIEVKEKWLDVPGRTNEVAHLKCWKENNRPEVR |
| Ga0137359_102872673 | 3300012923 | Vadose Zone Soil | VLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKESNRPEVRSRST* |
| Ga0164299_114145711 | 3300012958 | Soil | VCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKESNRPEVRSRST* |
| Ga0164301_102515682 | 3300012960 | Soil | MPKVSVCVFCSQEIQAKEKWLDVPSRMNEVAHLKCWKESIPPEVRSRSV* |
| Ga0137418_100571924 | 3300015241 | Vadose Zone Soil | MPKVLVCVFCSEEIEEKEKWLDVPGRINELAHLKCWNESNRPEVRSRST* |
| Ga0180085_11137442 | 3300015259 | Soil | VLVCVFCVEEIGPEEKWLDVPGKVNEIAHLKCWKDNMRPEVRSRSV* |
| Ga0132258_1000479412 | 3300015371 | Arabidopsis Rhizosphere | MHNVEVNREVHMPKVIVCVFCSQEIDANEKWLDVPGRANEVAHLNCWKESNRPEVRTRSL |
| Ga0184638_11163902 | 3300018052 | Groundwater Sediment | MPKVLVCVFCSEEIEEKEKWLDVPGRINELAHLKCWKESNRPEVRSRST |
| Ga0184637_100429322 | 3300018063 | Groundwater Sediment | MPKVLVCVFCFEEINVKEKWLDVPGRVNDVAHLKCWKENIRPEVRSRST |
| Ga0184618_101594722 | 3300018071 | Groundwater Sediment | MPKILVCVFCSDEISTEEKCLDVPGKMNEIAHLKCWKENNRPEVRSRST |
| Ga0184633_106213291 | 3300018077 | Groundwater Sediment | MPKVLVCVFCAEEIGTEEKWLDVPGRVNDVAHLKCWKENIRPEVRSRST |
| Ga0184612_105279391 | 3300018078 | Groundwater Sediment | CSEEIEAEEKWLDVPGKMNELAHLKCWKESNRPEVRSRST |
| Ga0184629_101972032 | 3300018084 | Groundwater Sediment | MPKVLVCVFCAEEIGPEEKWLDVPGKVNEIAHLKCWKDNMRPEVRSRSV |
| Ga0190265_110990492 | 3300018422 | Soil | MPKVLVCVFCSEEIAAEEKWLDVPGRGSEVAHLKCWKDSNRPEVRSRSV |
| Ga0190265_116786532 | 3300018422 | Soil | MPKVLVCIFCSEEIETEEKWLDVPDKMNEVAHLKCWKENNRPEVRSRST |
| Ga0190270_132388301 | 3300018469 | Soil | MPKVLVCIFCSEEIEEKEKWLDVPGRMNELAHLKCWKESNRPEVRSRST |
| Ga0193722_10886182 | 3300019877 | Soil | MPKVLACVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0193723_10159733 | 3300019879 | Soil | MPKVLVCVFCSQEIEEKEKWLDVPGRINELAHLKCWKESNRPEVRSRST |
| Ga0193707_10872853 | 3300019881 | Soil | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0193713_11983301 | 3300019882 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGRVNEAAHLKCWKENNRPEVRSRST |
| Ga0193729_12134911 | 3300019887 | Soil | MPKVLVCVFCSEEIEAQEKWLDVPGKMNEVAHLKCWKENNRPEVRSRST |
| Ga0210407_110391881 | 3300020579 | Soil | RRHMPKVLVCVFCFEEIAMEEKWLDVPGRMNEVAHLKCWKDHSRPEVRSRSI |
| Ga0210403_103080063 | 3300020580 | Soil | FCFEEIAMEEKWLDVPGRMNEVAHLKCWKDHSRPEVRSRSI |
| Ga0210403_105153363 | 3300020580 | Soil | MPKVLVCVFCFEEIAMEEKWLDVPGRMNEVAHLKCWKDHSRPEVRSRSI |
| Ga0210379_102680982 | 3300021081 | Groundwater Sediment | MPKVLVCVFCAEEIGTEEKWLDVPGKVNEIAHLKCWKDNMRPEVRSRSV |
| Ga0210408_105002222 | 3300021178 | Soil | MPKVLVCVFGSEEIEAQEKWLDVPGRTNEGAHLKSWKENNRLEIRSRST |
| Ga0210384_100010946 | 3300021432 | Soil | MPKVVVCVFCSEEIEAKEQWLDVPGRMNDVAHLTCWKENSRPEVRSRST |
| Ga0210384_101365833 | 3300021432 | Soil | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWKENIRPEVRSRSV |
| Ga0209109_101597882 | 3300025160 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGRMNELAHLKCWKESNRPEVRSRST |
| Ga0209108_102563372 | 3300025165 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST |
| Ga0209640_105524172 | 3300025324 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGRMNEVAHLKCWKESNRPEVRSRST |
| Ga0207653_100629092 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST |
| Ga0207684_1000227510 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEINAKEKWVDVPGRMNEVAHLKCWKENIRPEVRSRSI |
| Ga0207684_100134412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEVKEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0207684_102090512 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCFEEIETKEKWLDVPGRVNEVAHLKCWKENIRPEVRSRSV |
| Ga0207684_102413803 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKESNRPEVRSRST |
| Ga0207646_1001114415 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVCVFCAEEIEAKEKWLDVPSRMNEVAHLKCWKENNRPEVRSRST |
| Ga0207646_102454372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MCVFCAEEIEAKEKWLDVPGRMNEVAHLKCWKENNRPEVRSRST |
| Ga0207646_109942771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKVLVRLFCSEEIEAQEKWLDGPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0257152_10001155 | 3300026369 | Soil | MPKVLVCVLCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0257155_10452962 | 3300026481 | Soil | MPKVLVCVFCFEEIEAQEKWLDVPGRTNEVAHLTCWKENNRPEVRSRST |
| Ga0257155_10606822 | 3300026481 | Soil | MPKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLTCWKENNRPEVRSRS |
| Ga0257172_10275242 | 3300026482 | Soil | MPKVLVCVFGSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0257157_10239073 | 3300026496 | Soil | MPKVLVCLFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0209648_104149653 | 3300026551 | Grasslands Soil | MPKVLVGVFCSEEIEAQEQWLDVPGRTNEVAHLTCWKENNRPEVCSRST |
| Ga0209884_10083462 | 3300027013 | Groundwater Sand | MPKVLVCVFCSEEIEVKEKWLDVPGRMNEVAHLKCWKENNRPEVRSRSV |
| Ga0209886_10841312 | 3300027273 | Groundwater Sand | VCVFCLEEINVKEKWLDVPGRVNDVAHLKCWKENIRPEVRSRST |
| Ga0209846_10300842 | 3300027277 | Groundwater Sand | MPKVLVCVFCLEEINVKEKWLDVPGRVNDVAHLKCWKENIRPEVRSRST |
| Ga0209388_11459072 | 3300027655 | Vadose Zone Soil | PKVLVCVFCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0209328_100289732 | 3300027727 | Forest Soil | MPKVLVCVFGSEEFEAQEKWLDVPGRTNEGAHLKSWKENNRLEIRSRST |
| Ga0209328_102752672 | 3300027727 | Forest Soil | MPKVLVCVFCFEEIDGMEKWIDAPGRMNEVAHLKCWKENVRPEVRTRSV |
| Ga0209706_101513721 | 3300027818 | Freshwater Sediment | MPKVLVCVFCSEEIEEKEKWLDVPGRMNELAHLKCWKESNRPEVRSRST |
| Ga0209590_104381233 | 3300027882 | Vadose Zone Soil | CFEEIGAKEKWVDVPGRMNEVAHLKCWKENIRPEVRSRSI |
| Ga0209068_100008872 | 3300027894 | Watersheds | MPKVLVCVFCSEEIEAQEKWLNVPGRTNEAAHLKCWKENNRPEVRSRST |
| Ga0209488_112330702 | 3300027903 | Vadose Zone Soil | FCSEEIEAQEKWLDVPGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0209382_103947503 | 3300027909 | Populus Rhizosphere | MPKVSVCVFCSQEIQAKEKWLDVPSRMNEVAHLKCWKESIRPEVRSRSV |
| Ga0209069_100398342 | 3300027915 | Watersheds | MPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWMENSRPEVRSRST |
| Ga0209069_102031521 | 3300027915 | Watersheds | MPKVLVCVFCSEEIEAKEKWLDVPGRINEVAHLKCWKESNRPEVRSRST |
| Ga0307504_101674431 | 3300028792 | Soil | MPKVLVCIFCSEEIEAKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST |
| Ga0222749_100189204 | 3300029636 | Soil | MPKVLVCVFGSEEIEAQEKWLDVLGRTNEVAHLKCWKENNRPEVRSRST |
| Ga0299907_101790373 | 3300030006 | Soil | MPKVLVCVFCSEEIEEKEKWLDVPGRINELAHLKCWKESNRPEVRSRSI |
| Ga0308178_10208071 | 3300030990 | Soil | MPKILVCVFCSDEISAEEKCLDVPGKMNEVAHLKCWKENNRPEVRSRST |
| Ga0307469_110655822 | 3300031720 | Hardwood Forest Soil | MPKVLVCVFCSEEIGAKEKWLDVPGRMSETAHLKCWKENNRPEVRSRST |
| Ga0214473_100474765 | 3300031949 | Soil | MPKVLVCVFCFEEINTKEKWLDVPGRVNEVAHLKCWKENMRPEVRSRSI |
| Ga0310899_103117191 | 3300032017 | Soil | EEIEAAEKWLDVPGRGNEVAHLSCWKENNRPEVRSRSL |
| Ga0307471_1010496942 | 3300032180 | Hardwood Forest Soil | MPKVLVCVFCSEEIEAEEKWLEVPGRGNEVAHLKCWKESNRPEVRSRSL |
| Ga0307472_1009334871 | 3300032205 | Hardwood Forest Soil | RGRWAQRTRRYNMPKVLVCVFCFEEIETKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRS |
| Ga0326726_100114797 | 3300033433 | Peat Soil | MPKVLVCVFCSEEIEAKEKWLDVPGKLNEVAHLKCWKENIRPEVRTRST |
| Ga0326726_100397857 | 3300033433 | Peat Soil | MPKVLVCVFCSEEIEANEKWLDVPGRVNEVAHLKCWKENSRPEVRSRST |
| Ga0326726_101438482 | 3300033433 | Peat Soil | MPKVLVCVFCSEEIETKEKWLDVPGRMNEVAHLKCWKENSRPEVRSRST |
| Ga0316624_115688171 | 3300033486 | Soil | MPKVLVCVFCSEEIEAKEKWLDVPGKLNEVAHLKCWKENSRPEVRTRST |
| ⦗Top⦘ |