


| Basic Information | |
|---|---|
| Family ID | F063424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAKGKGGAPAPKKTGDNSDRKNGKANKKRPKIFDAIKRRLVTK |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 81.20 % |
| % of genes near scaffold ends (potentially truncated) | 6.20 % |
| % of genes from short scaffolds (< 2000 bps) | 47.29 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (50.388 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (34.108 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.240 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.27% Coil/Unstructured: 88.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 13.18 |
| PF00271 | Helicase_C | 8.53 |
| PF01551 | Peptidase_M23 | 6.20 |
| PF00877 | NLPC_P60 | 3.10 |
| PF07691 | PA14 | 2.33 |
| PF09723 | Zn-ribbon_8 | 2.33 |
| PF08282 | Hydrolase_3 | 2.33 |
| PF02867 | Ribonuc_red_lgC | 2.33 |
| PF01050 | MannoseP_isomer | 1.55 |
| PF00011 | HSP20 | 1.55 |
| PF00462 | Glutaredoxin | 1.55 |
| PF07508 | Recombinase | 1.55 |
| PF05063 | MT-A70 | 1.55 |
| PF01844 | HNH | 1.55 |
| PF02511 | Thy1 | 0.78 |
| PF04984 | Phage_sheath_1 | 0.78 |
| PF11238 | DUF3039 | 0.78 |
| PF13392 | HNH_3 | 0.78 |
| PF05305 | DUF732 | 0.78 |
| PF09834 | DUF2061 | 0.78 |
| PF04138 | GtrA | 0.78 |
| PF01478 | Peptidase_A24 | 0.78 |
| PF02709 | Glyco_transf_7C | 0.78 |
| PF03332 | PMM | 0.78 |
| PF00145 | DNA_methylase | 0.78 |
| PF05050 | Methyltransf_21 | 0.78 |
| PF03237 | Terminase_6N | 0.78 |
| PF01471 | PG_binding_1 | 0.78 |
| PF01467 | CTP_transf_like | 0.78 |
| PF07659 | DUF1599 | 0.78 |
| PF13692 | Glyco_trans_1_4 | 0.78 |
| PF00154 | RecA | 0.78 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.78 |
| PF00166 | Cpn10 | 0.78 |
| PF05869 | Dam | 0.78 |
| PF13649 | Methyltransf_25 | 0.78 |
| PF04865 | Baseplate_J | 0.78 |
| PF05257 | CHAP | 0.78 |
| PF09250 | Prim-Pol | 0.78 |
| PF14359 | DUF4406 | 0.78 |
| PF00141 | peroxidase | 0.78 |
| PF06114 | Peptidase_M78 | 0.78 |
| PF04232 | SpoVS | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 3.10 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 3.10 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 3.10 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 2.33 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 2.33 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 2.33 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 2.33 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 2.33 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.55 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.78 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.78 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.78 |
| COG2359 | Stage V sporulation protein SpoVS, predicted DNA-binding, AlbA superfamily | Function unknown [S] | 0.78 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.99 % |
| Unclassified | root | N/A | 31.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000385|PR_CR_10_Liq_1_inCRDRAFT_1008525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3575 | Open in IMG/M |
| 3300002294|B570J29584_1006082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 798 | Open in IMG/M |
| 3300002408|B570J29032_109144224 | Not Available | 610 | Open in IMG/M |
| 3300002835|B570J40625_101736525 | Not Available | 507 | Open in IMG/M |
| 3300003430|JGI25921J50272_10032445 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300005527|Ga0068876_10114525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1602 | Open in IMG/M |
| 3300005527|Ga0068876_10162691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
| 3300005662|Ga0078894_10351651 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300005662|Ga0078894_10371193 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005662|Ga0078894_10522630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300005662|Ga0078894_11078705 | Not Available | 687 | Open in IMG/M |
| 3300005662|Ga0078894_11188408 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005662|Ga0078894_11635658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300005662|Ga0078894_11789768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300006030|Ga0075470_10180076 | Not Available | 610 | Open in IMG/M |
| 3300006875|Ga0075473_10068624 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300007609|Ga0102945_1021950 | Not Available | 1397 | Open in IMG/M |
| 3300008107|Ga0114340_1000014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 142186 | Open in IMG/M |
| 3300008448|Ga0114876_1126839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300008962|Ga0104242_1019001 | Not Available | 1193 | Open in IMG/M |
| 3300009068|Ga0114973_10000009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 137503 | Open in IMG/M |
| 3300009151|Ga0114962_10000053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 87236 | Open in IMG/M |
| 3300009151|Ga0114962_10000075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 76956 | Open in IMG/M |
| 3300009151|Ga0114962_10000923 | Not Available | 25472 | Open in IMG/M |
| 3300009151|Ga0114962_10001218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22443 | Open in IMG/M |
| 3300009152|Ga0114980_10002021 | Not Available | 14485 | Open in IMG/M |
| 3300009154|Ga0114963_10063554 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300009155|Ga0114968_10002861 | Not Available | 13058 | Open in IMG/M |
| 3300009158|Ga0114977_10088036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1892 | Open in IMG/M |
| 3300009182|Ga0114959_10058234 | All Organisms → Viruses → Predicted Viral | 2214 | Open in IMG/M |
| 3300009182|Ga0114959_10074232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1909 | Open in IMG/M |
| 3300009182|Ga0114959_10313765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300009184|Ga0114976_10085801 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300009184|Ga0114976_10090556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
| 3300009194|Ga0114983_1042906 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300009419|Ga0114982_1001626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10577 | Open in IMG/M |
| 3300009419|Ga0114982_1013015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2892 | Open in IMG/M |
| 3300009419|Ga0114982_1135366 | Not Available | 761 | Open in IMG/M |
| 3300010157|Ga0114964_10029985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3005 | Open in IMG/M |
| 3300010157|Ga0114964_10183965 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300010157|Ga0114964_10251585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300010157|Ga0114964_10358921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300010158|Ga0114960_10421561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300010160|Ga0114967_10014292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5795 | Open in IMG/M |
| 3300010160|Ga0114967_10015176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5586 | Open in IMG/M |
| 3300010160|Ga0114967_10050099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2641 | Open in IMG/M |
| 3300010388|Ga0136551_1000983 | Not Available | 7479 | Open in IMG/M |
| 3300010389|Ga0136549_10276021 | Not Available | 705 | Open in IMG/M |
| 3300010885|Ga0133913_11272176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1881 | Open in IMG/M |
| 3300010885|Ga0133913_13232063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300012347|Ga0157142_1005494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2269 | Open in IMG/M |
| 3300012352|Ga0157138_1000852 | Not Available | 5715 | Open in IMG/M |
| 3300012352|Ga0157138_1005093 | Not Available | 2211 | Open in IMG/M |
| 3300012665|Ga0157210_1000006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 127623 | Open in IMG/M |
| 3300013004|Ga0164293_10061515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2986 | Open in IMG/M |
| 3300013004|Ga0164293_10130726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
| 3300013285|Ga0136642_1003479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5826 | Open in IMG/M |
| 3300017766|Ga0181343_1017292 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300019784|Ga0181359_1121230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300020157|Ga0194049_1006295 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300020533|Ga0208364_1013342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1215 | Open in IMG/M |
| 3300021438|Ga0213920_1029585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1256 | Open in IMG/M |
| 3300021962|Ga0222713_10074699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2494 | Open in IMG/M |
| 3300021963|Ga0222712_10058469 | Not Available | 2839 | Open in IMG/M |
| 3300021963|Ga0222712_10732260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300022591|Ga0236341_1099592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 636 | Open in IMG/M |
| 3300022746|Ga0228701_1085396 | Not Available | 674 | Open in IMG/M |
| 3300022747|Ga0228703_1058570 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300022752|Ga0214917_10000621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 46146 | Open in IMG/M |
| 3300022752|Ga0214917_10075188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
| 3300023174|Ga0214921_10031560 | Not Available | 5166 | Open in IMG/M |
| 3300023311|Ga0256681_11627991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300027365|Ga0209300_1057069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
| 3300027708|Ga0209188_1000063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 127237 | Open in IMG/M |
| 3300027708|Ga0209188_1000120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 90217 | Open in IMG/M |
| 3300027708|Ga0209188_1000424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41040 | Open in IMG/M |
| 3300027708|Ga0209188_1009294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5695 | Open in IMG/M |
| 3300027708|Ga0209188_1039985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2159 | Open in IMG/M |
| 3300027708|Ga0209188_1281667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300027710|Ga0209599_10001453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11230 | Open in IMG/M |
| 3300027710|Ga0209599_10004542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5013 | Open in IMG/M |
| 3300027734|Ga0209087_1194086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300027741|Ga0209085_1107198 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300027764|Ga0209134_10159946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300027777|Ga0209829_10015429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4651 | Open in IMG/M |
| 3300027963|Ga0209400_1034962 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
| 3300027973|Ga0209298_10000577 | Not Available | 24507 | Open in IMG/M |
| 3300028025|Ga0247723_1005614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5620 | Open in IMG/M |
| 3300028025|Ga0247723_1015090 | Not Available | 2785 | Open in IMG/M |
| 3300028025|Ga0247723_1038075 | Not Available | 1454 | Open in IMG/M |
| 3300028025|Ga0247723_1142032 | Not Available | 569 | Open in IMG/M |
| 3300028027|Ga0247722_10124191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 942 | Open in IMG/M |
| 3300028392|Ga0304729_1057539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
| 3300028392|Ga0304729_1062550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1357 | Open in IMG/M |
| 3300028394|Ga0304730_1001092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21343 | Open in IMG/M |
| 3300028394|Ga0304730_1011054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5273 | Open in IMG/M |
| 3300028394|Ga0304730_1168091 | Not Available | 863 | Open in IMG/M |
| 3300031758|Ga0315907_10008420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10596 | Open in IMG/M |
| 3300031758|Ga0315907_10028975 | Not Available | 5021 | Open in IMG/M |
| 3300031857|Ga0315909_10708528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300031951|Ga0315904_10133492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2546 | Open in IMG/M |
| 3300032092|Ga0315905_10198492 | Not Available | 1976 | Open in IMG/M |
| 3300032092|Ga0315905_10351771 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300032092|Ga0315905_10870777 | Not Available | 774 | Open in IMG/M |
| 3300032093|Ga0315902_10197081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2027 | Open in IMG/M |
| 3300032116|Ga0315903_10891699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300033993|Ga0334994_0295982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300033994|Ga0334996_0000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 123830 | Open in IMG/M |
| 3300033994|Ga0334996_0001179 | Not Available | 17431 | Open in IMG/M |
| 3300033994|Ga0334996_0056995 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300034061|Ga0334987_0384739 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300034062|Ga0334995_0013052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7701 | Open in IMG/M |
| 3300034101|Ga0335027_0002408 | Not Available | 16341 | Open in IMG/M |
| 3300034102|Ga0335029_0037557 | All Organisms → Viruses → Predicted Viral | 3616 | Open in IMG/M |
| 3300034104|Ga0335031_0024950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4376 | Open in IMG/M |
| 3300034110|Ga0335055_0120352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1195 | Open in IMG/M |
| 3300034117|Ga0335033_0103608 | Not Available | 1640 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 34.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.98% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 5.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 3.10% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.88% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.55% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.78% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.78% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.78% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.78% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000385 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PR_CR_10_Liq_1_inCRDRAFT_10085254 | 3300000385 | Enviromental | MAKGKGKPSSAPKIDNSDRKSGKAYKKAPKVFDPVKRRLVRK* |
| B570J29584_10060822 | 3300002294 | Freshwater | MGKNKKAAPAAVKTTTDRKNGKASKKRPKVFDAVKRRLVTLKK* |
| B570J29032_1091442242 | 3300002408 | Freshwater | MAKGKGGAPAPKKTGDNSDRKNGKAFKKHPKVFDAVKRRLVNK* |
| B570J40625_1017365252 | 3300002835 | Freshwater | MAKGKGGAPAPKKTGDNSDRKNGKANKKRPKIFDAIKRRLVTK* |
| JGI25921J50272_100324452 | 3300003430 | Freshwater Lake | MAKGRGGAPAPVKSSSERKNGKASKKRPLVXDAVKRRXVRA* |
| Ga0068876_101145252 | 3300005527 | Freshwater Lake | MAKGSSGGGKPPAKGSNADRNNGKAFKKRPKIFDPVKRKLVNKQ* |
| Ga0068876_101626913 | 3300005527 | Freshwater Lake | MAKGKGKGGAPAPKKSNEGDRKNGKAFKKRPKIFDAIKRRLVRK* |
| Ga0078894_103516513 | 3300005662 | Freshwater Lake | MAKGKGGAPAPQKSSTDRQNGKASKKRPKVFDTEKRRLVVSK* |
| Ga0078894_103711935 | 3300005662 | Freshwater Lake | MAKGKGGGPKPPQKGDNSDRKNGKANKKTPKVFDPVKRRLVTKTK* |
| Ga0078894_105226302 | 3300005662 | Freshwater Lake | MAKGKGGGVKTAKGSNDSRPSGKANKKYPKIFDAIKRRLVTK* |
| Ga0078894_110787052 | 3300005662 | Freshwater Lake | MAKGKGGGGKPPVKGSNSDRKSGKANKKRPKIFDAIKRRLVTKKD* |
| Ga0078894_111884082 | 3300005662 | Freshwater Lake | MAKGRGAAPAPVKSGSDRKNGKASKKKPKVFDPAKRRLVTK* |
| Ga0078894_116356581 | 3300005662 | Freshwater Lake | MAKGKGGGPKPPQKGANSDRKNGKASKKTPKVFDAAKRRLVTKTK* |
| Ga0078894_117897682 | 3300005662 | Freshwater Lake | MAKGRGGAPAPVKSSSERKNGKASKKRPLVFDAVKRRLVRA* |
| Ga0075470_101800762 | 3300006030 | Aqueous | MAKGKGGGAKPPVKGANDDRVSSKKKAYKKRPKIFDAIKRRLVTKKD* |
| Ga0075473_100686242 | 3300006875 | Aqueous | MLLLYTETGAIMAKGKGGGAKPPVKGANDDRVSSKKKAYKKRPKIFDAIKRRLVTKKD* |
| Ga0102945_10219504 | 3300007609 | Pond Water | VAKGKGGKKPESQKSSADRRSGKAFKKRPKVFDSVNRRLVTVES* |
| Ga0114340_100001462 | 3300008107 | Freshwater, Plankton | MAKGKGGGKPTTPVKDNSGADRNNGKARKKHPKMFDPVKRRLVAVK* |
| Ga0114876_11268391 | 3300008448 | Freshwater Lake | KKVAPPPPKPSDDSKRNNGKAWKKRPKIFDKIKRRLVTKEK* |
| Ga0104242_10190012 | 3300008962 | Freshwater | MAKGKGGGSKPAAKGANDDRVSMKKKAYKKRPKIFDAIKRRLVTKKD* |
| Ga0114973_1000000910 | 3300009068 | Freshwater Lake | MAKGKPGGKPVPEVKSSGRQNGKAFKKRPKIFDKIKRKLVNITK* |
| Ga0114962_1000005316 | 3300009151 | Freshwater Lake | MAKGKSAPAPVTKASDGRNNGKAFKKHPKIFDAIKRKLVRKK* |
| Ga0114962_1000007556 | 3300009151 | Freshwater Lake | MAKGRGGAPAAPVRKGPDRNNGKAFKKHPKKFDAEKRRLVNA* |
| Ga0114962_1000092319 | 3300009151 | Freshwater Lake | MAKGKGGKPAPVVVKRTGDGRPSGKATKKRPKVFDAIKRRLVTKKD* |
| Ga0114962_1000121823 | 3300009151 | Freshwater Lake | MAIKKGGGPKPPVKGGNSDRKNGKANKKYPKVFDAIKRRLVTKTK* |
| Ga0114980_1000202113 | 3300009152 | Freshwater Lake | MAKGNGGGNKPAAKGANDDRVSMKKKAYKKRPKVFDAIKRRLVTKKD* |
| Ga0114963_100635545 | 3300009154 | Freshwater Lake | MAKGKSAPAPVTKSGDGRNNGKTPKKYPKIFDAIKRKLVRKK* |
| Ga0114968_100028612 | 3300009155 | Freshwater Lake | MAQGKGGGGQKSGPARNDDRVSSKKKAYKKRPKIWDPEKRRLVVGPPLGK* |
| Ga0114977_100880362 | 3300009158 | Freshwater Lake | MAKGKGGAPAPVKSTTTRNNGKASKKRPKFFDAIKRKLTTKKD* |
| Ga0114978_105141931 | 3300009159 | Freshwater Lake | VMIYIPKESRFMAKGSGGGKPAAKGSNADRNNGKASKKSPKVFDKEKRKLVNKN* |
| Ga0114959_100582341 | 3300009182 | Freshwater Lake | MAKGKGGKPAPVVTKRSGDDRPNGKAKKQRPKVWDAEKRRLVTKSE* |
| Ga0114959_100742323 | 3300009182 | Freshwater Lake | MALKKGGGPKPPVKGDNSDRKNGKANKKYPKVFDAIKRRLVTKSK* |
| Ga0114959_103137653 | 3300009182 | Freshwater Lake | MAIKKGGGPKPPVKGGNSDRKNGKANKKYPKVFDAIKRRLV |
| Ga0114976_100383685 | 3300009184 | Freshwater Lake | MAKGKGGGAKSAKGSNDSRPNGKANKKYPKIFDAVKRKLVNKN* |
| Ga0114976_100858013 | 3300009184 | Freshwater Lake | MAKGKPQAAPVKKNASERPNGKAVKKSPKIFDAIKRKLVRKK* |
| Ga0114976_100905562 | 3300009184 | Freshwater Lake | MAQGKGGGQKPAKGSNSDRKSGKGNKKNPKVFDPVKRRLVTKTS* |
| Ga0114983_10429063 | 3300009194 | Deep Subsurface | MAKGKGGGSAPAKGSNSDRNNKKAFKKRPKMFDAIKRRLVTKN* |
| Ga0114982_100162616 | 3300009419 | Deep Subsurface | MTMAKGKGGGSSIKRESNSDRNNKKAFKKRPKMFDAIKRRLVTKA* |
| Ga0114982_10130154 | 3300009419 | Deep Subsurface | MAKGSGGGKPAAKGANDDRLSSKKKAYKKRPKVWDPEKRRLVTKTN* |
| Ga0114982_11353662 | 3300009419 | Deep Subsurface | GSKPTAKDANDDRVSMKKKAYKKRPKIFDAIKRRLVTKKD* |
| Ga0114964_100299854 | 3300010157 | Freshwater Lake | MAIKKGGGGKPPVKGSNSDRKNGKAEKKYPKVFDAIKRKLVVKGK* |
| Ga0114964_101839653 | 3300010157 | Freshwater Lake | MAKGKPAPAPVKKAGDGRNNGKAPKKRPKIFDAIKRKLVRKK* |
| Ga0114964_102515852 | 3300010157 | Freshwater Lake | MAKGKPAPAPVKKAGDGRNNGKAFKKRPKIWDAIKRKLVVKK* |
| Ga0114964_103589213 | 3300010157 | Freshwater Lake | MAKGKGGAPAPAKSTTTRNNGKAFKKRPKVWDAIKRRLVTKKD* |
| Ga0114960_104215611 | 3300010158 | Freshwater Lake | MAKGKPQAAPVKKSGDGRNNGKALKKRPKIFDAIKRKLVRKK* |
| Ga0114967_100142923 | 3300010160 | Freshwater Lake | MAKGKPQAAPVKKNASERPNGKAVKKRPKIFDAIKRKLVRKK* |
| Ga0114967_100151762 | 3300010160 | Freshwater Lake | MAKGKPQAAPVKKSEGERPNGKAVKKRPKIFDAIKRKLVRKK* |
| Ga0114967_100500997 | 3300010160 | Freshwater Lake | MAKGKGGGGKPPVKGANDDRLSSKKKAYKKRPKVWDPEKRRLVTGPSQGK* |
| Ga0136551_100098310 | 3300010388 | Pond Fresh Water | MAKGKGGGGQKSGPARNDERTNGKATKKRPKIFDAIKRRLVTRD* |
| Ga0136549_102760211 | 3300010389 | Marine Methane Seep Sediment | PAPVKDTSGADRKNGKARKKRPKIFDAAKRRLVTNK* |
| Ga0133913_104030099 | 3300010885 | Freshwater Lake | MAKSKGGGKPVPEIKSAGRQNGKAPKKRPKVWDPEKRRLVTKV* |
| Ga0133913_112721765 | 3300010885 | Freshwater Lake | MAVKKGGGPKPPVKGANSDRKNGKANKKYPKVFDAIKRRLVTKSK* |
| Ga0133913_132320632 | 3300010885 | Freshwater Lake | MAKGKSAPAPVTKSGDGRNNGKAPKKYPKIFDAIKRKLVRKK* |
| Ga0157142_10054941 | 3300012347 | Freshwater | MAQKKSGGPVAKGSNSDRKNGKAAKKHPKVFDREKRRLVRAK* |
| Ga0157138_10008524 | 3300012352 | Freshwater | MAKGKGGAQAPQKTTTDRKNGKASKKRPKVWDSEKRRLVTAK* |
| Ga0157138_10050934 | 3300012352 | Freshwater | MAKGKGGAPAPQKTTTDRKNGKASKKRPKIFDAVKRRLVTKK* |
| Ga0157203_100011828 | 3300012663 | Freshwater | MAKNKGGGKPAPEVKSSGRQNGKASKKHPKVWDPIKRRLVTGEPNKG* |
| Ga0157210_100000690 | 3300012665 | Freshwater | MAKGKGGGGQTPQKTTTDRKNGKAEKKRPKFFDAIKRRLVTKKN* |
| Ga0157210_10032027 | 3300012665 | Freshwater | MAKNKGGGKPAPEVKSSGRQNGKAWKKHPKVWDPTKRRLVAGEPNKG* |
| Ga0164293_100615153 | 3300013004 | Freshwater | MAKGKGGAPAPQKTTTDRKNGKASKKRPKVFDAVKRRLVTKK* |
| Ga0164293_101307263 | 3300013004 | Freshwater | MAKGKGGAPAAKGGNSDRKNEKAFKKRPKIFDAIKRRLVTKQ* |
| Ga0136642_10034799 | 3300013285 | Freshwater | MAQAKGAPAPKKQGDNSNRKNGKASKKRPKIFDAIKRKLVTKKD* |
| Ga0181343_10172924 | 3300017766 | Freshwater Lake | MAKGKGGGPKPPQKGDNSDRKNGKANKKTPKVFDPVKRRLVTKTK |
| Ga0181359_11212303 | 3300019784 | Freshwater Lake | MAKGKGGGSKPAKGSNDSRPNGKANKKYPKIFDAVKRKLVNKN |
| Ga0194049_10062953 | 3300020157 | Anoxic Zone Freshwater | MAKGKPQAAPVKKAGDGRNNGKALKKRPKIFDAIKRKLVRKK |
| Ga0208364_10133422 | 3300020533 | Freshwater | MGKNKKAAPAAVKTTTDRKNGKASKKRPKVFDAVKRRLVTLKK |
| Ga0213920_100015426 | 3300021438 | Freshwater | MAKGKGGAKPAAPTKGSTDRPNQKAFKKHPKKFDPIKRRLVADN |
| Ga0213920_10295853 | 3300021438 | Freshwater | MAKGNGGGKPPVKSGNSDRKNGKAFKKRPKIWDAIKRRLVTKN |
| Ga0222714_101961742 | 3300021961 | Estuarine Water | MAKNKGGGKPAPEVKSSGRQNGKAWKKHPKVWDPTKRRLVAGEPNKG |
| Ga0222713_100746994 | 3300021962 | Estuarine Water | MAKGKGGAPAPAKSSNDRQNGKAFKKRPKVFDPVKRRLVTSK |
| Ga0222713_100918125 | 3300021962 | Estuarine Water | MAKNKGGAKPAPEVKSSGRQNGKAWKKRPKVWDPVKRRLVVGESRKD |
| Ga0222712_100584697 | 3300021963 | Estuarine Water | MAKGKGSAPAPVKTTTTRNNGKASKKRPKIFDKIKRKLVVKQN |
| Ga0222712_107322602 | 3300021963 | Estuarine Water | MAKGKGGGKPAAPVKSTTDRQNGKASKKRPKVFDAIKRRLVTKSE |
| Ga0236341_10995923 | 3300022591 | Freshwater | MAKGKGGKPAPVQAKRTGDDRPNGKATKKRPKVWDAEKRRLVTKSE |
| Ga0228701_10853961 | 3300022746 | Freshwater | KGKGGAPAQKKTGDNPDRKNGKAFKKRPKMFDAIKRRLVNKQ |
| Ga0228703_10585702 | 3300022747 | Freshwater | MAKGKGGPKAPVKGNNDGRKNGKAAKKHPKMFDPERRRLVSA |
| Ga0214917_1000062128 | 3300022752 | Freshwater | MAKGKPAPAPVKSTNSRNNGKAPKKRPKIFDAIKRKLVTKKD |
| Ga0214917_100751883 | 3300022752 | Freshwater | MAKGKPQAAPVKKSAGERPNGKAVKKSPKIFDAIKRKLVRKK |
| Ga0214921_1000014454 | 3300023174 | Freshwater | MAKSKGGGKPVPEVKSSGRQNGKASKKRPKIFDKEKRRLVVKTN |
| Ga0214921_100315608 | 3300023174 | Freshwater | MAKGKGGGQKPAKGSNSDRQNGKANKKRPKEFDVEKRRLVNKTT |
| Ga0256681_116279911 | 3300023311 | Freshwater | MAKGKGAPAPAKKGDNSERKNGKASKKRPKIFDAIKRRLVTKK |
| Ga0209300_10570691 | 3300027365 | Deep Subsurface | MAKGKGGGSAPAKGSNSDRNNKKAFKKRPKMFDAIKRRLVTKN |
| Ga0209188_10000636 | 3300027708 | Freshwater Lake | MAKGKGGKPAPVVVKRTGDGRPSGKATKKRPKVFDAIKRRLVTKKD |
| Ga0209188_100012075 | 3300027708 | Freshwater Lake | MAKGRGGAPAAPVRKGPDRNNGKAFKKHPKKFDAEKRRLVNA |
| Ga0209188_100042440 | 3300027708 | Freshwater Lake | MAKGKPAPAPVKKAGDGRNNGKAPKKRPKIFDAIKRKLVRKK |
| Ga0209188_10085989 | 3300027708 | Freshwater Lake | MAKGKPGGKPVPEVKSSGRQNGKAFKKRPKIFDKIKRKLVNITK |
| Ga0209188_100929410 | 3300027708 | Freshwater Lake | MAKGKSAPAPVTKASDGRNNGKAFKKHPKIFDAIKRKLVRKK |
| Ga0209188_10399854 | 3300027708 | Freshwater Lake | MAKGKGGKPAPVVTKRSGDDRPNGKAKKQRPKVWDAEKRRLVTKSE |
| Ga0209188_12816672 | 3300027708 | Freshwater Lake | MAIKKGGGPKPPVKGGNSDRKNGKANKKYPKVFDAIKRRLVTKSK |
| Ga0209599_100014538 | 3300027710 | Deep Subsurface | MAKGKGGGSSIKRESNSDRNNKKAFKKRPKMFDAIKRRLVTKA |
| Ga0209599_1000454212 | 3300027710 | Deep Subsurface | MAKGSGGGKPAAKGANDDRLSSKKKAYKKRPKVWDPEKRRLVTKTN |
| Ga0209087_11940861 | 3300027734 | Freshwater Lake | MAKGKGGGAKSAKGSNDSRPNGKANKKYPKIFDAVKRKLVNKN |
| Ga0209085_11071983 | 3300027741 | Freshwater Lake | VATGVKMAKGRGGAPAAPVRKGPDRNNGKAFKKHPKKFDAEKRRLVNA |
| Ga0209134_101599462 | 3300027764 | Freshwater Lake | MAKGKGGAPAPVSKGGDRQNGKAVKKHPKMFDATKRRLVSAK |
| Ga0209829_100154296 | 3300027777 | Freshwater Lake | MAKGKPAPAPVKKAGDGRNNGKAFKKRPKIWDAIKRKLVVKK |
| Ga0209400_10349622 | 3300027963 | Freshwater Lake | MAQGKGGGGQKSGPARNDDRVSSKKKAYKKRPKIWDPEKRRLVVGPPLGK |
| Ga0209298_1000057724 | 3300027973 | Freshwater Lake | MAKGNGGGNKPAAKGANDDRVSMKKKAYKKRPKVFDAIKRRLVTKKD |
| Ga0247723_10056146 | 3300028025 | Deep Subsurface Sediment | MAKGKGGGSAPAKGSNSDRNNKKAFKKRPKMFDAVKRRLVTKN |
| Ga0247723_10150907 | 3300028025 | Deep Subsurface Sediment | MAKGKGGGKPTTPVKDSSGADRNNGKARKKHPKMFDPVKRRLVAVK |
| Ga0247723_10380753 | 3300028025 | Deep Subsurface Sediment | MAKGKGGAPAPAAKNTSGEGRNNGKAVKKHPKVFDPVKRRLVNK |
| Ga0247723_11420321 | 3300028025 | Deep Subsurface Sediment | DMAKGKGGGQKPAKGSNSDRQNGKANKKRPKKFDLEKRRLVVVEN |
| Ga0247722_101241911 | 3300028027 | Deep Subsurface Sediment | MTMAKGKGGGSSIKRESNSDRNNKKAFKKRPKMFDAIKRRLVTKA |
| Ga0304729_10575393 | 3300028392 | Freshwater Lake | MAKGKGGAPAPAKSTTTRNNGKAFKKRPKVWDAIKRRLVTKKD |
| Ga0304729_10625504 | 3300028392 | Freshwater Lake | MAIKKGGGGKPPVKGSNSDRKNGKAEKKYPKVFDAIKRKLVVKGK |
| Ga0304730_100109219 | 3300028394 | Freshwater Lake | MAKGKPQAAPVKKNASERPNGKAVKKRPKIFDAIKRKLVRKK |
| Ga0304730_10110542 | 3300028394 | Freshwater Lake | MAKGKPQAAPVKKSEGERPNGKAVKKRPKIFDAIKRKLVRKK |
| Ga0304730_11680911 | 3300028394 | Freshwater Lake | MAKGKGGGGKPPVKGANDDRLSSKKKAYKKRPKVWDPEKRRLVTGPSQGK |
| Ga0315907_1000842016 | 3300031758 | Freshwater | MAKGKGKGGAPAPKKSNEGDRKNGKAFKKRPKIFDAIKRRLVRK |
| Ga0315907_100289759 | 3300031758 | Freshwater | MAKGSSGGGKPPAKGSNADRNNGKAFKKRPKIFDPVKRKLVNKQ |
| Ga0315909_107085282 | 3300031857 | Freshwater | MAKGKGGAPAPKKTGNDERKNGKASKKRPKIFDAIKRRLVAKN |
| Ga0315904_101334926 | 3300031951 | Freshwater | MAKGKGGAPAPKKTGNDERKNGKALKKRPKIFDAIKRRLVTKN |
| Ga0315905_101984921 | 3300032092 | Freshwater | MARGKGGAPAPQKTTTDRKNGKASKKRPKVFDAIKRRLVTKQ |
| Ga0315905_103517714 | 3300032092 | Freshwater | MAKGNGGGNKPAAKGANDDRVSMKKKAYKKRPKIFDAIKRRLVTKKD |
| Ga0315905_108707771 | 3300032092 | Freshwater | MAKGKGGAPAPQKTTTDRKNGKASKKRPKVFDAVKRRLVTKQ |
| Ga0315902_101970813 | 3300032093 | Freshwater | MGKPKKVAPPPPKPSDDSKRNNGKAWKKRPKIFDKIKRRLVTKEN |
| Ga0315903_108916992 | 3300032116 | Freshwater | MAKGKGGAPAPKKTGNDERKNGKAPKKRPKIFDAIKRRLVTKN |
| Ga0334994_0295982_546_674 | 3300033993 | Freshwater | MAKGKGGGPAPKKGGNDDRNNKKAFKKRPKIFDAIKRRLVSK |
| Ga0334996_0000007_14647_14778 | 3300033994 | Freshwater | MAKGKGGASAPVKTTTTRQNGKASKKRPKVFDKEKRKLVVQQN |
| Ga0334996_0001179_2422_2559 | 3300033994 | Freshwater | MTMAKGKGGGPAPKKGGNDDRNNKKAFKKRPKIFDAIKRRLITKS |
| Ga0334996_0056995_1223_1363 | 3300033994 | Freshwater | MAKGKGGGSQPSKSSNDDRLSSKKKANKKRPKIFDAIKRRLVTKKD |
| Ga0334996_0077212_1682_1825 | 3300033994 | Freshwater | MAKGKGGAKPAPEVKSSGRQNGKAWKKHPKVWDPIKRRLVAGEPNKG |
| Ga0334987_0097236_236_364 | 3300034061 | Freshwater | MAKGSGGGAKKKDGNDSRNNGKAAKKHPKIFDAVKRRLVTQK |
| Ga0334987_0384739_483_617 | 3300034061 | Freshwater | MAKGKGGGGQKSGPARNDSRTNGKAAKKRPKIFDAIKRRLVTRD |
| Ga0334995_0013052_24_155 | 3300034062 | Freshwater | MAKGKGGAPAPKKTGDNSNRKNGKANKKHPKVFDAVKRRLVNK |
| Ga0335027_0002408_6577_6729 | 3300034101 | Freshwater | MAKGKGGGAKPPAKGANDDRLSSKKKAYKKRPKVWDAIKRRLVTGESKGK |
| Ga0335029_0037557_3090_3230 | 3300034102 | Freshwater | MAKGSGGGKPAAKGNNDDRLSSKKKAYKKRPKVWDPEKRRLVTKTN |
| Ga0335031_0024950_1889_2017 | 3300034104 | Freshwater | MAKGKGPAPAAKGGNSDRKNEKAFKKRPKMFDAIKRRLVTNK |
| Ga0335055_0120352_192_329 | 3300034110 | Freshwater | MTMAKGKGGGPAPKKGGNDDRNNKKAFKKRPKIFDAIKRRLVTKA |
| Ga0335033_0103608_54_182 | 3300034117 | Freshwater | MAKGKGGGSAPAKGSNSDRNNKKAFKKRPKIFDAIKRRLVSK |
| ⦗Top⦘ |