


| Basic Information | |
|---|---|
| Family ID | F063423 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MDETGMSEADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.29 % |
| % of genes near scaffold ends (potentially truncated) | 32.56 % |
| % of genes from short scaffolds (< 2000 bps) | 96.12 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.690 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (27.132 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.209 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.713 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.11% β-sheet: 0.00% Coil/Unstructured: 57.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00805 | Pentapeptide | 5.43 |
| PF00589 | Phage_integrase | 1.55 |
| PF07592 | DDE_Tnp_ISAZ013 | 1.55 |
| PF13358 | DDE_3 | 1.55 |
| PF11294 | DUF3095 | 1.55 |
| PF09954 | DUF2188 | 1.55 |
| PF00072 | Response_reg | 0.78 |
| PF00106 | adh_short | 0.78 |
| PF13610 | DDE_Tnp_IS240 | 0.78 |
| PF03050 | DDE_Tnp_IS66 | 0.78 |
| PF02201 | SWIB | 0.78 |
| PF02371 | Transposase_20 | 0.78 |
| PF03992 | ABM | 0.78 |
| PF07929 | PRiA4_ORF3 | 0.78 |
| PF07332 | Phage_holin_3_6 | 0.78 |
| PF09361 | Phasin_2 | 0.78 |
| PF00239 | Resolvase | 0.78 |
| PF13546 | DDE_5 | 0.78 |
| PF03120 | DNA_ligase_OB | 0.78 |
| PF13683 | rve_3 | 0.78 |
| PF03330 | DPBB_1 | 0.78 |
| PF13340 | DUF4096 | 0.78 |
| PF02657 | SufE | 0.78 |
| PF00724 | Oxidored_FMN | 0.78 |
| PF00171 | Aldedh | 0.78 |
| PF13737 | DDE_Tnp_1_5 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 5.43 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.78 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.78 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.78 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.78 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.78 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.69 % |
| All Organisms | root | All Organisms | 40.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105766342 | Not Available | 543 | Open in IMG/M |
| 3300001305|C688J14111_10230389 | Not Available | 579 | Open in IMG/M |
| 3300001686|C688J18823_10575691 | Not Available | 719 | Open in IMG/M |
| 3300002568|C688J35102_117817000 | Not Available | 508 | Open in IMG/M |
| 3300002568|C688J35102_119954999 | Not Available | 826 | Open in IMG/M |
| 3300002568|C688J35102_120277674 | Not Available | 964 | Open in IMG/M |
| 3300002568|C688J35102_120737207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 1452 | Open in IMG/M |
| 3300002568|C688J35102_120856249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1844 | Open in IMG/M |
| 3300003575|Ga0007409J51694_1055139 | Not Available | 691 | Open in IMG/M |
| 3300003576|Ga0007413J51701_1074749 | Not Available | 647 | Open in IMG/M |
| 3300004153|Ga0063455_100296104 | Not Available | 884 | Open in IMG/M |
| 3300004153|Ga0063455_100376223 | Not Available | 824 | Open in IMG/M |
| 3300004479|Ga0062595_100186724 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300004479|Ga0062595_102221463 | Not Available | 538 | Open in IMG/M |
| 3300005093|Ga0062594_101799187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300005337|Ga0070682_101654946 | Not Available | 555 | Open in IMG/M |
| 3300005347|Ga0070668_101027163 | Not Available | 742 | Open in IMG/M |
| 3300005355|Ga0070671_100393792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300005356|Ga0070674_100065502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2550 | Open in IMG/M |
| 3300005367|Ga0070667_100973376 | Not Available | 791 | Open in IMG/M |
| 3300005455|Ga0070663_101997780 | Not Available | 522 | Open in IMG/M |
| 3300005457|Ga0070662_101126542 | Not Available | 674 | Open in IMG/M |
| 3300005543|Ga0070672_100170544 | Not Available | 1809 | Open in IMG/M |
| 3300005577|Ga0068857_100281526 | Not Available | 1530 | Open in IMG/M |
| 3300005618|Ga0068864_102132772 | Not Available | 567 | Open in IMG/M |
| 3300005834|Ga0068851_10754256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300005842|Ga0068858_101447934 | Not Available | 677 | Open in IMG/M |
| 3300005842|Ga0068858_102308515 | Not Available | 532 | Open in IMG/M |
| 3300005844|Ga0068862_102137774 | Not Available | 571 | Open in IMG/M |
| 3300006881|Ga0068865_100018416 | All Organisms → cellular organisms → Bacteria | 4505 | Open in IMG/M |
| 3300006881|Ga0068865_101933311 | Not Available | 535 | Open in IMG/M |
| 3300006881|Ga0068865_102186450 | Not Available | 503 | Open in IMG/M |
| 3300007004|Ga0079218_12636532 | Not Available | 598 | Open in IMG/M |
| 3300007790|Ga0105679_10606960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1082 | Open in IMG/M |
| 3300007790|Ga0105679_10718681 | Not Available | 1070 | Open in IMG/M |
| 3300009098|Ga0105245_10521375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300009098|Ga0105245_11273973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 784 | Open in IMG/M |
| 3300009101|Ga0105247_11000257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300009789|Ga0126307_10098641 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300009789|Ga0126307_10156440 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300009840|Ga0126313_11106909 | Not Available | 651 | Open in IMG/M |
| 3300009840|Ga0126313_11112226 | Not Available | 650 | Open in IMG/M |
| 3300009840|Ga0126313_11253210 | Not Available | 612 | Open in IMG/M |
| 3300010036|Ga0126305_10018235 | All Organisms → cellular organisms → Bacteria | 3651 | Open in IMG/M |
| 3300010036|Ga0126305_10169375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1370 | Open in IMG/M |
| 3300010036|Ga0126305_10192181 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300010036|Ga0126305_10820476 | Not Available | 633 | Open in IMG/M |
| 3300010036|Ga0126305_11088030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300010037|Ga0126304_10111659 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300010037|Ga0126304_10244282 | Not Available | 1180 | Open in IMG/M |
| 3300010037|Ga0126304_10346615 | Not Available | 987 | Open in IMG/M |
| 3300010037|Ga0126304_10734160 | Not Available | 668 | Open in IMG/M |
| 3300010039|Ga0126309_10196420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300010039|Ga0126309_10944454 | Not Available | 575 | Open in IMG/M |
| 3300010040|Ga0126308_10373075 | Not Available | 948 | Open in IMG/M |
| 3300010040|Ga0126308_10525157 | Not Available | 802 | Open in IMG/M |
| 3300010040|Ga0126308_11157800 | Not Available | 546 | Open in IMG/M |
| 3300010040|Ga0126308_11170769 | Not Available | 543 | Open in IMG/M |
| 3300010041|Ga0126312_10859251 | Not Available | 660 | Open in IMG/M |
| 3300010041|Ga0126312_10939064 | Not Available | 631 | Open in IMG/M |
| 3300010042|Ga0126314_10436967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 945 | Open in IMG/M |
| 3300010042|Ga0126314_11002052 | Not Available | 620 | Open in IMG/M |
| 3300010044|Ga0126310_10261975 | Not Available | 1172 | Open in IMG/M |
| 3300010044|Ga0126310_10376012 | Not Available | 1004 | Open in IMG/M |
| 3300010044|Ga0126310_11543303 | Not Available | 546 | Open in IMG/M |
| 3300010045|Ga0126311_10215171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1409 | Open in IMG/M |
| 3300010045|Ga0126311_10457336 | Not Available | 992 | Open in IMG/M |
| 3300010045|Ga0126311_10807400 | Not Available | 757 | Open in IMG/M |
| 3300010045|Ga0126311_11262564 | Not Available | 613 | Open in IMG/M |
| 3300010101|Ga0127481_1097906 | Not Available | 653 | Open in IMG/M |
| 3300010115|Ga0127495_1031745 | Not Available | 709 | Open in IMG/M |
| 3300010115|Ga0127495_1085516 | Not Available | 722 | Open in IMG/M |
| 3300010125|Ga0127443_1128743 | Not Available | 528 | Open in IMG/M |
| 3300010146|Ga0126320_1056411 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300010166|Ga0126306_10122646 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300010166|Ga0126306_10351881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. J-072 | 1144 | Open in IMG/M |
| 3300010166|Ga0126306_10638643 | Not Available | 850 | Open in IMG/M |
| 3300010166|Ga0126306_11837489 | Not Available | 508 | Open in IMG/M |
| 3300010371|Ga0134125_10665200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300010373|Ga0134128_12452495 | Not Available | 575 | Open in IMG/M |
| 3300010401|Ga0134121_11700968 | Not Available | 654 | Open in IMG/M |
| 3300011119|Ga0105246_11425779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 647 | Open in IMG/M |
| 3300012212|Ga0150985_100211240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 570 | Open in IMG/M |
| 3300012212|Ga0150985_107354093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 957 | Open in IMG/M |
| 3300012212|Ga0150985_114569718 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012212|Ga0150985_114748027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1799 | Open in IMG/M |
| 3300012212|Ga0150985_115544248 | Not Available | 620 | Open in IMG/M |
| 3300012212|Ga0150985_118169423 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012212|Ga0150985_121340830 | Not Available | 759 | Open in IMG/M |
| 3300012469|Ga0150984_100326846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 955 | Open in IMG/M |
| 3300012469|Ga0150984_100969878 | Not Available | 1309 | Open in IMG/M |
| 3300012469|Ga0150984_102961878 | Not Available | 552 | Open in IMG/M |
| 3300012469|Ga0150984_103189809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 1210 | Open in IMG/M |
| 3300012469|Ga0150984_103630201 | Not Available | 759 | Open in IMG/M |
| 3300012469|Ga0150984_105330850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300012469|Ga0150984_106136147 | Not Available | 500 | Open in IMG/M |
| 3300012469|Ga0150984_106365831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 702 | Open in IMG/M |
| 3300012469|Ga0150984_110722252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300012897|Ga0157285_10360703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 512 | Open in IMG/M |
| 3300013306|Ga0163162_10346409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
| 3300013308|Ga0157375_11806949 | Not Available | 725 | Open in IMG/M |
| 3300014497|Ga0182008_10226528 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300014497|Ga0182008_10254215 | Not Available | 907 | Open in IMG/M |
| 3300014968|Ga0157379_11832197 | Not Available | 597 | Open in IMG/M |
| 3300015265|Ga0182005_1250143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae | 548 | Open in IMG/M |
| 3300015374|Ga0132255_105113264 | Not Available | 555 | Open in IMG/M |
| 3300017792|Ga0163161_11736230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 554 | Open in IMG/M |
| 3300018466|Ga0190268_10336173 | Not Available | 931 | Open in IMG/M |
| 3300019767|Ga0190267_10289516 | Not Available | 841 | Open in IMG/M |
| 3300019767|Ga0190267_10478366 | Not Available | 727 | Open in IMG/M |
| 3300025899|Ga0207642_10620152 | Not Available | 675 | Open in IMG/M |
| 3300025901|Ga0207688_10068484 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300025901|Ga0207688_10746462 | Not Available | 620 | Open in IMG/M |
| 3300025901|Ga0207688_10833230 | Not Available | 584 | Open in IMG/M |
| 3300025914|Ga0207671_11387126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300025919|Ga0207657_10168566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1775 | Open in IMG/M |
| 3300025927|Ga0207687_10384372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1151 | Open in IMG/M |
| 3300025927|Ga0207687_10442971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300025927|Ga0207687_11156734 | Not Available | 665 | Open in IMG/M |
| 3300025927|Ga0207687_11486509 | Not Available | 582 | Open in IMG/M |
| 3300025933|Ga0207706_10815211 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300025938|Ga0207704_11890930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300025940|Ga0207691_11721796 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025942|Ga0207689_10183451 | Not Available | 1726 | Open in IMG/M |
| 3300025961|Ga0207712_11016264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300026067|Ga0207678_10278068 | Not Available | 1436 | Open in IMG/M |
| 3300026095|Ga0207676_10208641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1732 | Open in IMG/M |
| 3300028380|Ga0268265_11483122 | Not Available | 682 | Open in IMG/M |
| 3300034007|Ga0334936_058005 | Not Available | 800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 27.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 6.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 6.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003576 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1057663422 | 3300000364 | Soil | MDETGMSDADKIEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLXLQPQH* |
| C688J14111_102303892 | 3300001305 | Soil | LPILDEAAMDETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALTQEHGDIGPPSRH* |
| C688J18823_105756911 | 3300001686 | Soil | MAQGEVMMDETGMTYADKVGMIADVLLTWGEEAAQELADRYAVDLEALKDEGERSHRQ* |
| C688J35102_1178170001 | 3300002568 | Soil | MDDTGMSETDKIGFVEDVLLTWGEEAAQELAERYEVDLDALKREGARS* |
| C688J35102_1199549992 | 3300002568 | Soil | MDETGMSYADKLEFVDDVLRTWGEEAAREVAERYAVDLEALKREPDGLDRQPRH* |
| C688J35102_1202776742 | 3300002568 | Soil | MAQGEVMMDETGMTYADKVGMIADVLLTWGEEAAQELAERYAVDLEALKDEGERSHRQ* |
| C688J35102_1207372071 | 3300002568 | Soil | MDETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALTQEHGDIGPPSRH* |
| C688J35102_1208562491 | 3300002568 | Soil | RKMAQGEVMMDETGMTYADKVGMIADVLLTWGEEAAQELADRYAVDLEALKDEGERSHRQ |
| Ga0007409J51694_10551392 | 3300003575 | Avena Fatua Rhizosphere | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDEQA* |
| Ga0007413J51701_10747492 | 3300003576 | Avena Fatua Rhizosphere | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRE |
| Ga0063455_1002961042 | 3300004153 | Soil | MAQGEVMMDETGMTYADKVGMIADVLLTWGEEAAQELAERYAVDLEALKGEGERSHRQ* |
| Ga0063455_1003762231 | 3300004153 | Soil | MDETGMTYADKVGMIADVLLTWGEEAAQELADRYAIDLEALKDEGERSHRQ* |
| Ga0062595_1001867241 | 3300004479 | Soil | PEEAAMDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKQEHGDMGPPSRH* |
| Ga0062595_1022214632 | 3300004479 | Soil | MDETGMSDADKIEFVDDVLRTWGEEAAREFAERYRIDFDALKRE |
| Ga0062594_1017991872 | 3300005093 | Soil | MDETGMTDADKLEFVDDVLRTWGEEAAREVAERFEVDLDALKREPDGLERQPHR* |
| Ga0070682_1016549462 | 3300005337 | Corn Rhizosphere | MDETGISYADKLEFVDDVLRTWGEEAAREVAERYAVDLEALKREP |
| Ga0070668_1010271631 | 3300005347 | Switchgrass Rhizosphere | MDETGMSEADKREFIDDVVLTWGEEAAQEVAERYGVDLLALKPEHGDGPPSRP* |
| Ga0070671_1003937921 | 3300005355 | Switchgrass Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQQVNIPRQSRGL* |
| Ga0070674_1000655023 | 3300005356 | Miscanthus Rhizosphere | MDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKPEHGDMGPPSRH* |
| Ga0070667_1009733761 | 3300005367 | Switchgrass Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNL |
| Ga0070663_1019977801 | 3300005455 | Corn Rhizosphere | MDETGISYADKLEFVDDVLRTWGEEAAREVAERYAVDLEALKREPDGLDRQPRH* |
| Ga0070662_1011265422 | 3300005457 | Corn Rhizosphere | MDETGMSDADKIEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH* |
| Ga0070672_1001705441 | 3300005543 | Miscanthus Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH* |
| Ga0068857_1002815261 | 3300005577 | Corn Rhizosphere | MDETGMSEADKIEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH* |
| Ga0068864_1021327721 | 3300005618 | Switchgrass Rhizosphere | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE* |
| Ga0068851_107542562 | 3300005834 | Corn Rhizosphere | DDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE* |
| Ga0068858_1014479342 | 3300005842 | Switchgrass Rhizosphere | MDETGISYADKLEFVDDGLRTWGEEAAREVAERYAVDLEALKREPDGLDRQPRH* |
| Ga0068858_1023085153 | 3300005842 | Switchgrass Rhizosphere | MDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKPEPGDMGPPSRH* |
| Ga0068862_1021377741 | 3300005844 | Switchgrass Rhizosphere | MDEAGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKQEHGDMGPPSRH* |
| Ga0068865_1000184163 | 3300006881 | Miscanthus Rhizosphere | MDEAGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH* |
| Ga0068865_1019333112 | 3300006881 | Miscanthus Rhizosphere | MDETGMSEADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE* |
| Ga0068865_1021864501 | 3300006881 | Miscanthus Rhizosphere | AAMDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKPEHGDGPPSRP* |
| Ga0079218_126365321 | 3300007004 | Agricultural Soil | MDETDETGMSYADKIGFVEDVLRTWGEEAAQEIAERYAIDLQALKQEPACT |
| Ga0105679_106069602 | 3300007790 | Soil | MDDTGMSHADKIGFVEDVLMTWGEEAAREFAERYDVDLDALKREGEVSDPQ* |
| Ga0105679_107186811 | 3300007790 | Soil | MDETGMSYPEKVEFVDDVLRTWGEEAAQEVAERYAVDLQALKREGSDPQPQH* |
| Ga0105245_105213751 | 3300009098 | Miscanthus Rhizosphere | MDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKQEHGDMGPPSRH* |
| Ga0105245_112739731 | 3300009098 | Miscanthus Rhizosphere | MDETGMSEADKIEFVDDVLRTWGEEAAQELAERYGVDLQALKHEHGDMDPPSSH* |
| Ga0105247_110002572 | 3300009101 | Switchgrass Rhizosphere | MDETGMSEADKIGFVEDVLLTWDEEAAQELAERYEV |
| Ga0126307_100986416 | 3300009789 | Serpentine Soil | MDDTGMSHTDKIGFVEDVLVTWGEEAAREFAERYDVDLDALKREGEVSDPQ* |
| Ga0126307_101564401 | 3300009789 | Serpentine Soil | MSYADKVGFVEDVLLTWGEEAAQELAERYEVDLQVLKRGGEPSDSQSRH* |
| Ga0126313_111069091 | 3300009840 | Serpentine Soil | AAMDETGMSDADKVEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDMDPPSRP* |
| Ga0126313_111122262 | 3300009840 | Serpentine Soil | MDDETGMSDADKIEFVDDVLRTWGEEAAREVAERYAVDLPALKREGSDLPSRR* |
| Ga0126313_112532101 | 3300009840 | Serpentine Soil | MDDTGMTYADKAGFVEDVLLTWGEEAAQELAERYAVDLDALRREGSAPQSRH* |
| Ga0126305_100182357 | 3300010036 | Serpentine Soil | MDDTGMSHADKIGFVEDVLVTWGEGAAREFAERDDVDLNALKREGEVSDLQ* |
| Ga0126305_101693752 | 3300010036 | Serpentine Soil | MDDTGMTYADKVGFVEDVLLTWGEEAAQELAERYEVDLDALKREHEGSTTH* |
| Ga0126305_101921813 | 3300010036 | Serpentine Soil | MDETGMSDADKREFVDDVLRIWGEEAAQEIAERFAIDLQALKQE |
| Ga0126305_108204761 | 3300010036 | Serpentine Soil | MVDDTGMTYADKAGFVEDVLLTWGEEAAQELADRYAVDLGALKRDHEDSGWH* |
| Ga0126305_110880301 | 3300010036 | Serpentine Soil | MDHTGMTEADKAGLIEDVLVIWGEDAAQELAERYGVKLQALEHAAATDS* |
| Ga0126304_101116594 | 3300010037 | Serpentine Soil | AAMDETGMSDADKIEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDMDPPSRP* |
| Ga0126304_102442822 | 3300010037 | Serpentine Soil | MDDTGMTYADKVGFVEDVLLTWGEEAAQELAERYEADLDALKREHEGSTAH* |
| Ga0126304_103466151 | 3300010037 | Serpentine Soil | DADKLEFVDDVLRTWGEEAAQEVAERYAIDLQALKREGSDPQLQH* |
| Ga0126304_107341601 | 3300010037 | Serpentine Soil | MDETGMSDADKLEFVDDVLRIWGEEAAQEIAERFAI |
| Ga0126309_101964201 | 3300010039 | Serpentine Soil | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAEPYEVDLAVLKRPQAGSTLQPPN* |
| Ga0126309_109444541 | 3300010039 | Serpentine Soil | MDNTGMTDADKAGFVEDVLLTWGEEAAQELADRYAVDLDALKRDHEGSG* |
| Ga0126308_103730752 | 3300010040 | Serpentine Soil | MDETGMSDADKREFVDDVLRIWGEEAAQEIAERFAIDL |
| Ga0126308_105251572 | 3300010040 | Serpentine Soil | MDDETGMSDADKIEFVDDVLRTWGEEAAQEVAERYAVDL* |
| Ga0126308_111578001 | 3300010040 | Serpentine Soil | MDDTGMSHADKIGFVEDVLVTWGEEAAREFAERYDVDLDALKREGEVSDPQ* |
| Ga0126308_111707691 | 3300010040 | Serpentine Soil | MDDTGMTYADMVEFVDDVLRTWGEEAAQELAERYDVDLDALRRESGLSELQQQC* |
| Ga0126312_108592512 | 3300010041 | Serpentine Soil | MDETGMSDADKLEFVDDVLRTWGEEAAQEVAERYAVDLPALMREGSDPQLQH* |
| Ga0126312_109390641 | 3300010041 | Serpentine Soil | MDDTGMTYADKAGFVEDVLLTWGEEAAQELAERYAVDLAALRREGSAPQSRH* |
| Ga0126314_104369672 | 3300010042 | Serpentine Soil | MDDTGMTYADKAGFVEDVLLTWGEEAAQELAERYAVDLDALKGENAQA* |
| Ga0126314_110020522 | 3300010042 | Serpentine Soil | MDETGMSDADKIEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDMDPPS* |
| Ga0126310_102619751 | 3300010044 | Serpentine Soil | MSYADKVGFVEDVLLTWGEEAAQELAECYEIDLPALKRGGEPSDSQSRH* |
| Ga0126310_103760121 | 3300010044 | Serpentine Soil | MDETGMSEADKIEFVDDVLLTWGEEAAQELAERYGVDLLALKHKHGDMDPPS* |
| Ga0126310_115433031 | 3300010044 | Serpentine Soil | NRHKEATMDDTGMSHTDKIGFVEDVLVTWGEEAAREFAERYDVDLDALKREGEVSDPQ* |
| Ga0126311_102151711 | 3300010045 | Serpentine Soil | MDETGMSEADKIEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDMDPPS* |
| Ga0126311_104573362 | 3300010045 | Serpentine Soil | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRHQEGLNLQPQH* |
| Ga0126311_108074001 | 3300010045 | Serpentine Soil | MDDTGMSEADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESARS* |
| Ga0126311_112625642 | 3300010045 | Serpentine Soil | MDDIGMTYADKAGFVEDVLLTWGEEAAQELADRYAVDLGALKRDHEDSGWH* |
| Ga0127481_10979062 | 3300010101 | Grasslands Soil | EGMDETGMSRADKIGIVKDALRTWGEEAAQELAERYAVDIQLLSENATADSQAQN* |
| Ga0127495_10317451 | 3300010115 | Grasslands Soil | MDDTGMSHADKIEFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE* |
| Ga0127495_10855161 | 3300010115 | Grasslands Soil | AMDETGMSEADKIGFVEDVLLTWDEEAAQELAERYEVDLDALRREGARS* |
| Ga0127443_11287432 | 3300010125 | Grasslands Soil | MDDTGMSHADKIGFVEDVLLTWGKEAAQELAERYAVDLDALKRESPDE* |
| Ga0126320_10564111 | 3300010146 | Soil | AAMDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH* |
| Ga0126306_101226462 | 3300010166 | Serpentine Soil | MDETGMSDADKIEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDMDPPSRP* |
| Ga0126306_103518812 | 3300010166 | Serpentine Soil | MDDTGMTYADKVGFVEDVLLTWGEEAAQELAERYEVDLDGLKREHEGSTTH* |
| Ga0126306_106386432 | 3300010166 | Serpentine Soil | MDDTGMTYADMVEFVDEVLRTWGEEAAQELAERYDVDLDALRRESGLSELQQQC* |
| Ga0126306_118374891 | 3300010166 | Serpentine Soil | MMDDTGMTYADKAGFVEDVLLTWGEEAAQELADRYAVDLDALKRDHEDSGWH* |
| Ga0134125_106652004 | 3300010371 | Terrestrial Soil | MDETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKQERGDAGPPSRH* |
| Ga0134128_124524951 | 3300010373 | Terrestrial Soil | MDETGMSDADKIEFVDDVLRTWGEEAAREFAERYRIDFDA |
| Ga0134121_117009681 | 3300010401 | Terrestrial Soil | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDK* |
| Ga0105246_114257792 | 3300011119 | Miscanthus Rhizosphere | MDETGMSEADKIGFVEDVLLTWGEEAAQELAERYAVDLDALRREDARS* |
| Ga0150985_1002112402 | 3300012212 | Avena Fatua Rhizosphere | MDETGMSEADKIEFVDDVLRTWGEEAAQELAERYGVDLQALKHEHGDMDPPS* |
| Ga0150985_1073540931 | 3300012212 | Avena Fatua Rhizosphere | RREATMDDTGMSHGDKIGFVEDVLLTWGEEAAQELAERYAVDLDALKREGEVSDPQ* |
| Ga0150985_1145697181 | 3300012212 | Avena Fatua Rhizosphere | ADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQAQH* |
| Ga0150985_1147480272 | 3300012212 | Avena Fatua Rhizosphere | MDETGMSEADKIGFVEDVLLTWDEEAAQELAERYEVDLDALRREGARS* |
| Ga0150985_1155442481 | 3300012212 | Avena Fatua Rhizosphere | AMDETGMTYADKAGFVEDVLLTWGEEAAQELAERYEVDLDALRREDARS* |
| Ga0150985_1181694231 | 3300012212 | Avena Fatua Rhizosphere | MDDTGMSEADKIGFVEDVLLTWGEEAAQEVAERYGVDLEALKQEHGGTAAPSRH* |
| Ga0150985_1213408302 | 3300012212 | Avena Fatua Rhizosphere | MDETGMTDADKLEFVDDVLRTWGEEAAREVAERFEIDLEALKREPDGLDRQPRR* |
| Ga0150984_1003268461 | 3300012469 | Avena Fatua Rhizosphere | ERYREAAMDETGMSEADKIGFVEDVLLTWDEEAAQELAERYEVDLDALRREGARS* |
| Ga0150984_1009698783 | 3300012469 | Avena Fatua Rhizosphere | MDETGMSYADKLEFVDDVLRTWGEEAAREVAERFEVDLDALKHEPDGLERQPRC* |
| Ga0150984_1029618781 | 3300012469 | Avena Fatua Rhizosphere | ETGMTDADKVGHVEEVLLTWGTEAAQELADRYEVKLDALERKREGSDPQRGS* |
| Ga0150984_1031898091 | 3300012469 | Avena Fatua Rhizosphere | ETGMTDADKVGHVEEVLLTWGTEAAQELADRYEVKLDALEREREGSDPKRGS* |
| Ga0150984_1036302011 | 3300012469 | Avena Fatua Rhizosphere | DDTGMSEADKIGLVEEALLIWGEEAAQELADRYAVDLDALKREDAPV* |
| Ga0150984_1053308502 | 3300012469 | Avena Fatua Rhizosphere | MDETGMTDETGMTYADKAGFVEDVLLTWGEEAAQELAERYEVDLDALKGENAQA* |
| Ga0150984_1061361471 | 3300012469 | Avena Fatua Rhizosphere | EEAAMDETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKPEPGDMGPPSRP* |
| Ga0150984_1063658311 | 3300012469 | Avena Fatua Rhizosphere | MDETGMSEADKIEFVDDVLLTWGEEAAQELAERYGVDLQALKHEHGDKDPPS* |
| Ga0150984_1107222522 | 3300012469 | Avena Fatua Rhizosphere | MDDTGMSEADKIGLVEDALLIWGEEAAQELADRYAVDLQALKREDAPA* |
| Ga0157285_103607032 | 3300012897 | Soil | GMSEADKREFIDDVLLTWGEEAAQEVAERYGVDLLALKPEHEDAGAPSRP* |
| Ga0163162_103464094 | 3300013306 | Switchgrass Rhizosphere | MDETGMSEADKREFVDDVLLTWGEEVAQEVAERYGVDLLALKQEHGDMGPPSRH* |
| Ga0157375_118069492 | 3300013308 | Miscanthus Rhizosphere | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDEQ |
| Ga0182008_102265282 | 3300014497 | Rhizosphere | MDDTGMSETDKIGFVEDVLLTWGEEAAQELGERYAVDLDALKRESPDEQA* |
| Ga0182008_102542152 | 3300014497 | Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAHEVAERYEVDLEVLKRQQEGLTLQPQH* |
| Ga0157379_118321971 | 3300014968 | Switchgrass Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNHQPQH* |
| Ga0182005_12501432 | 3300015265 | Rhizosphere | MSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLTRQQEGLNLPPQH* |
| Ga0132255_1051132642 | 3300015374 | Arabidopsis Rhizosphere | MDETGMTDADKLEFVDDVLRTWGEEAAREVAERFEVDLEALKREPDGLDCQPQH* |
| Ga0163161_117362302 | 3300017792 | Switchgrass Rhizosphere | MDETGMSDADKIEFVDDVLRTWGEEAAQEVAERYAVDLKVLK |
| Ga0190268_103361731 | 3300018466 | Soil | MSYADKVGFVEDVLLTWGEEAAQELAERYEVDLQALKRGGEPSDSQSRH |
| Ga0190267_102895161 | 3300019767 | Soil | MDETGMSEADKVEFVDDVLRTWGEEAAQEVAERYAVD |
| Ga0190267_104783661 | 3300019767 | Soil | MDETGMSYGDKLEFVDDVLRTWGEEAAREVAERFEVDLEALKREPDGLDRQLQH |
| Ga0207642_106201521 | 3300025899 | Miscanthus Rhizosphere | MDETGMSEADKIGFVEDVLLTWDEEAAQELAERYEVYLDALRREGARS |
| Ga0207688_100684843 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDTGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDEQA |
| Ga0207688_107464621 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDETGMSDADKIEFVDDVLRTWGEEAAREFAERYRIDFDALKRERETSAE |
| Ga0207688_108332301 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH |
| Ga0207671_113871262 | 3300025914 | Corn Rhizosphere | MDDTGMSEADKIGLVEDALLIWSEEAAQELADRYAVDLDALKREDAPA |
| Ga0207657_101685662 | 3300025919 | Corn Rhizosphere | MDETGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQRP |
| Ga0207687_103843723 | 3300025927 | Miscanthus Rhizosphere | MDETGMSEADKREFVDDVLLTWGEEAAQEVAERYGVDLLALKQEHGDMGPPSRH |
| Ga0207687_104429711 | 3300025927 | Miscanthus Rhizosphere | MDETGMSEADKIEFVDDVLRTWGEEAAQELAERYGV |
| Ga0207687_111567342 | 3300025927 | Miscanthus Rhizosphere | MDETGMSDADKIEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLTLQPQH |
| Ga0207687_114865092 | 3300025927 | Miscanthus Rhizosphere | MDETGMSDADKIEFVDDVLRTWGEEAAREFAERYRIDFD |
| Ga0207706_108152111 | 3300025933 | Corn Rhizosphere | MDETGMSEADKIEFVDDVLRTWGEEAAQELAERYGVDLQALKHEHG |
| Ga0207704_118909302 | 3300025938 | Miscanthus Rhizosphere | TGMSHADKIGFVEDVLLTWGEEAAQELAERYAVDLDALKRESPDE |
| Ga0207691_117217961 | 3300025940 | Miscanthus Rhizosphere | MDETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKPEHGGMGPP |
| Ga0207689_101834512 | 3300025942 | Miscanthus Rhizosphere | MDEAGMSDADKMEFVDDVLRTWGEEAAQEVAERYEVDLEVLKRQQEGLNLQPQH |
| Ga0207712_110162641 | 3300025961 | Switchgrass Rhizosphere | DETGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKPEHGGMGPPSRP |
| Ga0207678_102780682 | 3300026067 | Corn Rhizosphere | MDETGISYADKLEFVDDVLRTWGEEAAREVAERYAVDLEALKREPDGLDRQPRH |
| Ga0207676_102086411 | 3300026095 | Switchgrass Rhizosphere | MDETGMSYADKLEFVGDVLRTWGEEAAREVAERYAVDLEALKREPDGLDRQPRR |
| Ga0268265_114831222 | 3300028380 | Switchgrass Rhizosphere | MDEAGMSEADKREFVEDVLLTWGEEAAQEVAERYGVDLLALKQEHGDMGPPSRH |
| Ga0334936_058005_599_775 | 3300034007 | Biocrust | MDEAGMSYADKVEFVDDVLRTWGEEAAREVAERYAVDLQALTREGSDPQPNPGENRVC |
| ⦗Top⦘ |