


| Basic Information | |
|---|---|
| Family ID | F063404 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MDHISRSDIITMLSFKGFTTDALMKKSDEELDNLYIEYIVLAEDYV |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.74 % |
| % of genes near scaffold ends (potentially truncated) | 32.56 % |
| % of genes from short scaffolds (< 2000 bps) | 71.32 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.163 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (37.209 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.744 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.496 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.24% β-sheet: 0.00% Coil/Unstructured: 56.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 3.10 |
| PF08406 | CbbQ_C | 3.10 |
| PF13759 | 2OG-FeII_Oxy_5 | 3.10 |
| PF07728 | AAA_5 | 2.33 |
| PF12850 | Metallophos_2 | 1.55 |
| PF02562 | PhoH | 1.55 |
| PF00487 | FA_desaturase | 0.78 |
| PF10544 | T5orf172 | 0.78 |
| PF16075 | DUF4815 | 0.78 |
| PF00268 | Ribonuc_red_sm | 0.78 |
| PF07486 | Hydrolase_2 | 0.78 |
| PF13392 | HNH_3 | 0.78 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 3.10 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.55 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.55 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.78 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.78 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.16 % |
| All Organisms | root | All Organisms | 48.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c000236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17354 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10014680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6974 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10021739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5075 | Open in IMG/M |
| 3300002933|G310J44882_10010322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2792 | Open in IMG/M |
| 3300002933|G310J44882_10052991 | Not Available | 898 | Open in IMG/M |
| 3300003277|JGI25908J49247_10021725 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
| 3300003375|JGI26470J50227_1001411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8470 | Open in IMG/M |
| 3300003393|JGI25909J50240_1076360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 674 | Open in IMG/M |
| 3300003783|Ga0007850_1005069 | Not Available | 1166 | Open in IMG/M |
| 3300003785|Ga0007851_100179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5198 | Open in IMG/M |
| 3300003789|Ga0007835_1004680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1414 | Open in IMG/M |
| 3300004095|Ga0007829_10000341 | Not Available | 9110 | Open in IMG/M |
| 3300004095|Ga0007829_10000365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8900 | Open in IMG/M |
| 3300004095|Ga0007829_10014085 | Not Available | 1537 | Open in IMG/M |
| 3300004461|Ga0066223_1134830 | Not Available | 1004 | Open in IMG/M |
| 3300005527|Ga0068876_10047053 | Not Available | 2638 | Open in IMG/M |
| 3300005582|Ga0049080_10095193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1014 | Open in IMG/M |
| 3300005662|Ga0078894_10022855 | Not Available | 5080 | Open in IMG/M |
| 3300005805|Ga0079957_1093225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1663 | Open in IMG/M |
| 3300006101|Ga0007810_1088376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300006103|Ga0007813_1007232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2951 | Open in IMG/M |
| 3300006103|Ga0007813_1036030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300006116|Ga0007807_1004982 | Not Available | 3539 | Open in IMG/M |
| 3300007177|Ga0102978_1383719 | Not Available | 1131 | Open in IMG/M |
| 3300008107|Ga0114340_1028866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2557 | Open in IMG/M |
| 3300008107|Ga0114340_1090420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3014 | Open in IMG/M |
| 3300008110|Ga0114343_1070314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1287 | Open in IMG/M |
| 3300008111|Ga0114344_1193864 | Not Available | 651 | Open in IMG/M |
| 3300008113|Ga0114346_1046048 | Not Available | 2201 | Open in IMG/M |
| 3300008261|Ga0114336_1084499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2312 | Open in IMG/M |
| 3300008266|Ga0114363_1150694 | Not Available | 772 | Open in IMG/M |
| 3300008450|Ga0114880_1073088 | Not Available | 1388 | Open in IMG/M |
| 3300009068|Ga0114973_10069501 | Not Available | 2040 | Open in IMG/M |
| 3300009068|Ga0114973_10143263 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300009068|Ga0114973_10186022 | Not Available | 1140 | Open in IMG/M |
| 3300009151|Ga0114962_10057887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2526 | Open in IMG/M |
| 3300009151|Ga0114962_10134198 | Not Available | 1503 | Open in IMG/M |
| 3300009151|Ga0114962_10197854 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
| 3300009154|Ga0114963_10077058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2073 | Open in IMG/M |
| 3300009158|Ga0114977_10000519 | All Organisms → Viruses | 25791 | Open in IMG/M |
| 3300009158|Ga0114977_10480845 | Not Available | 682 | Open in IMG/M |
| 3300009159|Ga0114978_10004839 | Not Available | 10818 | Open in IMG/M |
| 3300009160|Ga0114981_10514748 | Not Available | 639 | Open in IMG/M |
| 3300009164|Ga0114975_10007085 | Not Available | 7158 | Open in IMG/M |
| 3300009168|Ga0105104_10649150 | Not Available | 603 | Open in IMG/M |
| 3300009182|Ga0114959_10276116 | Not Available | 845 | Open in IMG/M |
| 3300009183|Ga0114974_10778147 | Not Available | 515 | Open in IMG/M |
| 3300009502|Ga0114951_10499648 | Not Available | 594 | Open in IMG/M |
| 3300010157|Ga0114964_10227639 | Not Available | 891 | Open in IMG/M |
| 3300010160|Ga0114967_10069312 | Not Available | 2140 | Open in IMG/M |
| 3300010334|Ga0136644_10273810 | Not Available | 985 | Open in IMG/M |
| 3300010334|Ga0136644_10424665 | Not Available | 751 | Open in IMG/M |
| 3300010354|Ga0129333_10251317 | Not Available | 1594 | Open in IMG/M |
| 3300010885|Ga0133913_12352831 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300011011|Ga0139556_1063229 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 554 | Open in IMG/M |
| 3300012663|Ga0157203_1035435 | Not Available | 692 | Open in IMG/M |
| 3300012665|Ga0157210_1005597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2539 | Open in IMG/M |
| 3300013093|Ga0164296_1026317 | All Organisms → Viruses → Predicted Viral | 3396 | Open in IMG/M |
| 3300013093|Ga0164296_1098898 | Not Available | 1230 | Open in IMG/M |
| 3300013093|Ga0164296_1198330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300013094|Ga0164297_10173933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300013295|Ga0170791_14221974 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300017784|Ga0181348_1331637 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 501 | Open in IMG/M |
| 3300018413|Ga0181560_10342882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 692 | Open in IMG/M |
| 3300018790|Ga0187842_1156855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300020519|Ga0208223_1020931 | Not Available | 907 | Open in IMG/M |
| 3300020571|Ga0208723_1057716 | Not Available | 525 | Open in IMG/M |
| 3300020686|Ga0214194_123597 | Not Available | 508 | Open in IMG/M |
| 3300020711|Ga0214237_1014952 | Not Available | 986 | Open in IMG/M |
| 3300020715|Ga0214254_1009958 | Not Available | 1480 | Open in IMG/M |
| 3300020726|Ga0214220_1053284 | Not Available | 514 | Open in IMG/M |
| 3300021139|Ga0214166_1045891 | Not Available | 969 | Open in IMG/M |
| 3300021519|Ga0194048_10294748 | Not Available | 585 | Open in IMG/M |
| 3300021961|Ga0222714_10624582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 535 | Open in IMG/M |
| 3300022752|Ga0214917_10281519 | Not Available | 753 | Open in IMG/M |
| 3300023174|Ga0214921_10183356 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1343 | Open in IMG/M |
| 3300025353|Ga0208255_100002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 56201 | Open in IMG/M |
| 3300025368|Ga0208620_1007035 | Not Available | 1466 | Open in IMG/M |
| 3300025402|Ga0208876_1049528 | Not Available | 644 | Open in IMG/M |
| 3300025450|Ga0208744_1101346 | Not Available | 546 | Open in IMG/M |
| 3300025773|Ga0208104_1023589 | Not Available | 758 | Open in IMG/M |
| 3300025781|Ga0208386_1002622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3821 | Open in IMG/M |
| 3300027586|Ga0208966_1196611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
| 3300027608|Ga0208974_1045447 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300027708|Ga0209188_1000612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33423 | Open in IMG/M |
| 3300027708|Ga0209188_1069317 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300027708|Ga0209188_1143563 | Not Available | 908 | Open in IMG/M |
| 3300027708|Ga0209188_1146421 | Not Available | 896 | Open in IMG/M |
| 3300027712|Ga0209499_1018210 | Not Available | 3319 | Open in IMG/M |
| 3300027733|Ga0209297_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105579 | Open in IMG/M |
| 3300027733|Ga0209297_1016749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3519 | Open in IMG/M |
| 3300027733|Ga0209297_1049877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1894 | Open in IMG/M |
| 3300027733|Ga0209297_1071549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
| 3300027736|Ga0209190_1093611 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300027736|Ga0209190_1107339 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300027741|Ga0209085_1043297 | Not Available | 2101 | Open in IMG/M |
| 3300027741|Ga0209085_1165839 | Not Available | 922 | Open in IMG/M |
| 3300027741|Ga0209085_1239006 | Not Available | 718 | Open in IMG/M |
| 3300027744|Ga0209355_1154593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 978 | Open in IMG/M |
| 3300027749|Ga0209084_1034786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2554 | Open in IMG/M |
| 3300027749|Ga0209084_1155916 | Not Available | 953 | Open in IMG/M |
| 3300027749|Ga0209084_1240555 | Not Available | 708 | Open in IMG/M |
| 3300027754|Ga0209596_1012101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5604 | Open in IMG/M |
| 3300027759|Ga0209296_1075606 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300027759|Ga0209296_1236927 | Not Available | 759 | Open in IMG/M |
| 3300027777|Ga0209829_10021533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3786 | Open in IMG/M |
| 3300027782|Ga0209500_10001670 | All Organisms → Viruses | 16419 | Open in IMG/M |
| 3300027963|Ga0209400_1082561 | All Organisms → Viruses → Predicted Viral | 1546 | Open in IMG/M |
| 3300027963|Ga0209400_1174200 | Not Available | 915 | Open in IMG/M |
| 3300027969|Ga0209191_1031193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2556 | Open in IMG/M |
| 3300027969|Ga0209191_1104049 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300027971|Ga0209401_1245209 | Not Available | 646 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1187009 | Not Available | 796 | Open in IMG/M |
| 3300028392|Ga0304729_1100791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300028393|Ga0304728_1098338 | Not Available | 1123 | Open in IMG/M |
| 3300031758|Ga0315907_10492436 | Not Available | 972 | Open in IMG/M |
| 3300031758|Ga0315907_10655398 | Not Available | 805 | Open in IMG/M |
| 3300031784|Ga0315899_11437086 | Not Available | 582 | Open in IMG/M |
| 3300031787|Ga0315900_10784041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
| 3300031857|Ga0315909_10176138 | Not Available | 1725 | Open in IMG/M |
| 3300031857|Ga0315909_10314167 | Not Available | 1164 | Open in IMG/M |
| 3300031857|Ga0315909_10587509 | Not Available | 747 | Open in IMG/M |
| 3300031884|Ga0316220_1075260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata | 1320 | Open in IMG/M |
| 3300031884|Ga0316220_1316475 | Not Available | 505 | Open in IMG/M |
| 3300031951|Ga0315904_11043281 | Not Available | 644 | Open in IMG/M |
| 3300032092|Ga0315905_10385669 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300032092|Ga0315905_10724964 | Not Available | 877 | Open in IMG/M |
| 3300032092|Ga0315905_11183002 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 626 | Open in IMG/M |
| 3300032675|Ga0316225_1077267 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 37.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 13.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 7.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.43% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.78% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020715 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_00023632 | 3300000176 | Freshwater | MDHISREEIITMLSFKGFTTEALIKKSDEELDNLYIEYIVLHEDYV* |
| TBL_comb47_HYPODRAFT_100146808 | 3300000553 | Freshwater | MDHISREEIITMLSFKGFTTXALIKKSDEELDNLYIEYIVLHEDYV* |
| TBL_comb47_HYPODRAFT_1002173911 | 3300000553 | Freshwater | MDHISREEIITMLSFKGFTTDTLIKKSDEELDNLYIEYIVLAEDYV* |
| G310J44882_100103224 | 3300002933 | Freshwater | MDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLHEDYV* |
| G310J44882_100529912 | 3300002933 | Freshwater | MDHISRKDIILMLSMKGFTTDALMKKSDEELDNLYIEYIVLAEDYV* |
| JGI25908J49247_100217255 | 3300003277 | Freshwater Lake | MDTISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV* |
| JGI26470J50227_100141110 | 3300003375 | Freshwater | MDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLAEDYV* |
| JGI25909J50240_10763602 | 3300003393 | Freshwater Lake | MDTISREDLILMLSFKGWTSDELSLMDTETLDNLYIEYIVLENDYV* |
| Ga0007850_10050691 | 3300003783 | Freshwater | DHISRSDIILMLSMKGFTTDSLIKKSDEELDNLYIEYIVLAEDYV* |
| Ga0007851_1001791 | 3300003785 | Freshwater | MDHISRQDIMLMLSVKGYFSTDSLVKMSDEELDNLYIEYVVLEEQYA* |
| Ga0007835_10046803 | 3300003789 | Freshwater | MDHISRSDIILMLSMKGFTTDSLIKKSDEELDNLYIEYIVLAEDYV* |
| Ga0007829_1000034121 | 3300004095 | Freshwater | IMDHISRQDIMLMLSVKGYFSTDSLVKMSDEELDNLYIEYVVLEEQYA* |
| Ga0007829_100003651 | 3300004095 | Freshwater | MDHISRNDIITMLSFKGFTTDTLNKKSDEELDNLYIEYIVLAEDYV* |
| Ga0007829_100140857 | 3300004095 | Freshwater | EFFMDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLHEDYV* |
| Ga0066223_11348301 | 3300004461 | Marine | LFILLYNGGSMITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0068876_100470533 | 3300005527 | Freshwater Lake | VDTIEREDLIFMLSFKGFTTDQLSKMDDETIDNLYIEHIVLGGDYE* |
| Ga0049080_100951931 | 3300005582 | Freshwater Lentic | MDTISREDLILMLSFKGWTSDELSLMDNETLDNLYIE |
| Ga0078894_100228554 | 3300005662 | Freshwater Lake | MDTIERQDLIFMLSFKGFTSDQLQKMDDETLDNLYIEHVVLCGEYE* |
| Ga0079957_10932253 | 3300005805 | Lake | MDTISREDLIFMLSFKGWTSDELSLMDDETLDNLYIEYIVLENDYV* |
| Ga0007810_10883763 | 3300006101 | Freshwater | MDHISRSDIILMLSMKGFTTDSLIKKSDEELDNLYIEYIVLAE |
| Ga0007813_10072325 | 3300006103 | Freshwater | MDTISKQDIMLMLSCKGFASDTLVKMSDEELDNLYIEYIVLAEDYV* |
| Ga0007813_10360301 | 3300006103 | Freshwater | MDHISRSDIILMLSMKGFTTDSLIKKSDEELDNLYI |
| Ga0007807_10049821 | 3300006116 | Freshwater | FMDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLAEDYV* |
| Ga0102978_13837194 | 3300007177 | Freshwater Lake | MDTISRSELIFMLSFKGFTTDELSTKSDEELENLYIEYIVLEEV* |
| Ga0114340_10288662 | 3300008107 | Freshwater, Plankton | MDSISRSDIILMLSVKGYFTTDSLMKKSDEELDNLYIEYIVLEEDYI* |
| Ga0114340_10904204 | 3300008107 | Freshwater, Plankton | VDTIEREDLIFMLSFKGFTTEQLSKMDNETIDNLYIEHIVLNGDYE* |
| Ga0114343_10703144 | 3300008110 | Freshwater, Plankton | IKWELCLMDTISREDLILMLSFKGWTSDELSLMDTETLDNLYIEYIVLENDYV* |
| Ga0114344_11938642 | 3300008111 | Freshwater, Plankton | VDTIEREDLIFMLSFKGFTTEQLSKMDNETIDNLYIEHIVLGGDYE* |
| Ga0114346_10460482 | 3300008113 | Freshwater, Plankton | MITKSREELIYMLSFKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114336_10844996 | 3300008261 | Freshwater, Plankton | VDTIEREDLIFMLSFKGFTTDQLSKMDDETIDNLYIEHIVLNGDYE* |
| Ga0114363_11506942 | 3300008266 | Freshwater, Plankton | MDTISRQELIFMLSFKGFTSDELSTKTDEELDNLYIEYIVLEDV* |
| Ga0114880_10730885 | 3300008450 | Freshwater Lake | MITKSREELIYMLSFKGFTTDYLMTKDDETLENLYIEYIILAEDYV* |
| Ga0114973_100695011 | 3300009068 | Freshwater Lake | KSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYV* |
| Ga0114973_101432634 | 3300009068 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYV* |
| Ga0114973_101860223 | 3300009068 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114962_100578875 | 3300009151 | Freshwater Lake | MQTDEIRYIKSHRNDIIFMLSMKGFTTDALMLKSDEELDNLYIEYIILAEDYV* |
| Ga0114962_101341985 | 3300009151 | Freshwater Lake | MITKNREELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114962_101978542 | 3300009151 | Freshwater Lake | MITKDRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114963_100770581 | 3300009154 | Freshwater Lake | MVQYEPVCYTKSHRNDIIFMLSMKGFTTDALMLKSDEELDNLYIEYIILAEDYV* |
| Ga0114977_1000051938 | 3300009158 | Freshwater Lake | MITLNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114977_104808452 | 3300009158 | Freshwater Lake | MDHISRSDIILMLSVKGYFTTDSLMKKSDEELDNLYIEYIVLEEDYV* |
| Ga0114978_100048396 | 3300009159 | Freshwater Lake | MDHISRSDIITMLSFKGFTTDALMKKSDEELDNLYIEYIVLAEDYV* |
| Ga0114981_105147482 | 3300009160 | Freshwater Lake | LIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114975_100070853 | 3300009164 | Freshwater Lake | MDHISRNDVILMLSFKGFTTDSLMKKSDEELDNLYIEYVVLHEDYV* |
| Ga0105104_106491501 | 3300009168 | Freshwater Sediment | RDELIFMLSFKGFTSDYLMTKDDETLENLYIEYIVLEEDYV* |
| Ga0114959_102761163 | 3300009182 | Freshwater Lake | MITKNREELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLA |
| Ga0114974_107781472 | 3300009183 | Freshwater Lake | SGFFILLYNGGSMITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV* |
| Ga0114951_104996483 | 3300009502 | Freshwater | MDHISRSDIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLAEDYV* |
| Ga0114964_102276391 | 3300010157 | Freshwater Lake | MITKDRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAED |
| Ga0114967_100693122 | 3300010160 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDTV* |
| Ga0136644_102738104 | 3300010334 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAED |
| Ga0136644_104246651 | 3300010334 | Freshwater Lake | IRYIKSHRDDIIFMLSFKGFTTDALMLKSDEELDNLYIEYIILAEDYV* |
| Ga0129333_102513173 | 3300010354 | Freshwater To Marine Saline Gradient | MDTISRQELIFMLSFKGFTSDELSTKTDEELDNLYIEYIVLEEV* |
| Ga0133913_123528315 | 3300010885 | Freshwater Lake | MDSISRSDIILMLSVKGYFTTDSLMKKSDEELDNLYIEYVVLEEDYV* |
| Ga0139556_10632291 | 3300011011 | Freshwater | IMDTISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV* |
| Ga0157203_10354351 | 3300012663 | Freshwater | MDHISRSDIITMLSFKGFTTDTLMKKSDEELDNLYIEYIVLAEDYV* |
| Ga0157210_10055973 | 3300012665 | Freshwater | MDHISRSDIILMLSVKGYFTTDSLMKKSDEELDNLYIEYIVLAEDYV* |
| Ga0164296_10263172 | 3300013093 | Freshwater | MDTINREGLILMLSFKGFTTDYLMTLSDETLDNLYIECIVLGEDYYDVA* |
| Ga0164296_10988981 | 3300013093 | Freshwater | MDTISRNDLITMLSFKGFTTDYLMKQSDDTLDNLYIEYIVLEEDYV* |
| Ga0164296_11983303 | 3300013093 | Freshwater | MDTISRNDLITMLSFKGFTTDYLMKQSDDTLDNLYIEYIVL |
| Ga0164297_101739332 | 3300013094 | Freshwater | MDTISRNDLITMLSFKGFTTDYLMKQSDDTLDNLYIEYIVLAEDYV* |
| Ga0170791_142219745 | 3300013295 | Freshwater | MDSISRSDIILMLSVKGYFTTDALMKMSDEVLDNLYIEYVVLEEDYV* |
| Ga0181348_13316371 | 3300017784 | Freshwater Lake | ISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0181560_103428822 | 3300018413 | Salt Marsh | MDTISREDLILLLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0187842_11568552 | 3300018790 | Freshwater | MDHISRKDIILMLSVKGFTTDALVAKSDEELDNLYIEYIILAEDYV |
| Ga0208223_10209313 | 3300020519 | Freshwater | MDTIERQDLIFMLSFKGFTSDQLQKMDDETLDNLYIEHVVLCGEYE |
| Ga0208723_10577163 | 3300020571 | Freshwater | MDTIERQDLIFMLSFKGFTSDQLQKMDDETLDNLY |
| Ga0214194_1235972 | 3300020686 | Freshwater | MDHISRSDIILMLSMKGFTTDSLIKKSDEELDNLYIEYIVLAEDYV |
| Ga0214237_10149521 | 3300020711 | Freshwater | MDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLH |
| Ga0214254_10099587 | 3300020715 | Freshwater | MDHISREEIITMLSFKGFTTEALIKKSDEELDNLYIEYIVLHEDYV |
| Ga0214220_10532841 | 3300020726 | Freshwater | HISRKDIILMLSMKGFTTDALMKKSDEELDNLYIEYIVLAEDYV |
| Ga0214166_10458915 | 3300021139 | Freshwater | HISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLAEDYV |
| Ga0194048_102947481 | 3300021519 | Anoxic Zone Freshwater | MDHISRKDIILMLSVKGFTTDALMLKSDEELDNLYIEYVILAEDYV |
| Ga0222714_106245822 | 3300021961 | Estuarine Water | MDTISREDLIFMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0214917_102815192 | 3300022752 | Freshwater | VINMDTISRQELIFMLSFKGFTSDELSAKTDEELDNLYIEYIVLEDV |
| Ga0214921_101833564 | 3300023174 | Freshwater | RLMDTISREDLIFMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0208255_10000244 | 3300025353 | Freshwater | MDHISRQDIMLMLSVKGYFSTDSLVKMSDEELDNLYIEYVVLEEQYA |
| Ga0208620_10070356 | 3300025368 | Freshwater | MDTISKQDIMLMLSCKGFASDTLVKMSDEELDNLYIEYIVLAEDYV |
| Ga0208876_10495282 | 3300025402 | Freshwater | MDHISRNDIITMLSFKGFTTDTLNKKSDEELDNLYIEYIVLAEDYV |
| Ga0208744_11013462 | 3300025450 | Freshwater | MDHISREEIITMLSFKGFTTDALIKKSDEELDNLYIEYIVLHEDYVXLTLLPALF |
| Ga0208104_10235895 | 3300025773 | Freshwater | IITMLSFKGFTTDTLNKKSDEELDNLYIEYIVLAEDYV |
| Ga0208386_10026226 | 3300025781 | Freshwater | MDHISRNDIILMLSMKGFTTDALIKKSDEELDNLYIEYIVLAEDYV |
| Ga0208966_11966111 | 3300027586 | Freshwater Lentic | MDTISREDLILMLSFKGWTSDELSLMDTETLDNLYIEYIVLENDYV |
| Ga0208974_10454472 | 3300027608 | Freshwater Lentic | MDTISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0209188_100061274 | 3300027708 | Freshwater Lake | MDHISRSDIITMLSFKGFTTDALMKKSDEELDNLYIEYIVLAEDYV |
| Ga0209188_10693173 | 3300027708 | Freshwater Lake | MITKDRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXARWLNYH |
| Ga0209188_11435632 | 3300027708 | Freshwater Lake | MXLMITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYVXARWLNYH |
| Ga0209188_11464212 | 3300027708 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209499_101821011 | 3300027712 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYV |
| Ga0209297_1000041136 | 3300027733 | Freshwater Lake | MITLNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209297_10167496 | 3300027733 | Freshwater Lake | MDSISRSDIILMLSVKGYFTTDALMKMSDEVLDNLYIEYVVLEEDYV |
| Ga0209297_10498777 | 3300027733 | Freshwater Lake | YNGGSMITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209297_10715493 | 3300027733 | Freshwater Lake | MDHISRSDIILMLSVKGYFTTDSLMKKSDEELDNLYIEYIVLEEDYV |
| Ga0209190_10936115 | 3300027736 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYVXVLPILNEW |
| Ga0209190_11073394 | 3300027736 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXVKCRNYH |
| Ga0209085_10432971 | 3300027741 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAE |
| Ga0209085_11658393 | 3300027741 | Freshwater Lake | MITKNREELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209085_12390064 | 3300027741 | Freshwater Lake | FMQTDEIRYIKSHRNDIIFMLSMKGFTTDALMLKSDEELDNLYIEYIILAEDYV |
| Ga0209355_11545934 | 3300027744 | Freshwater Lake | DLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0209084_10347865 | 3300027749 | Freshwater Lake | MQTDEIRYIKSHRNDIIFMLSMKGFTTDALMLKSDEELDNLYIEYIILAEDYV |
| Ga0209084_11559161 | 3300027749 | Freshwater Lake | MITKNREELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXVK |
| Ga0209084_12405553 | 3300027749 | Freshwater Lake | MXLMITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDYV |
| Ga0209596_10121018 | 3300027754 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDTV |
| Ga0209296_10756065 | 3300027759 | Freshwater Lake | MITLNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXAEXKT |
| Ga0209296_12369271 | 3300027759 | Freshwater Lake | TKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209829_100215333 | 3300027777 | Freshwater Lake | MQTDEIRYTKSHRNDIIFMLSFKGFTTDALMLKSDEELDNLYIEYIILAEDYV |
| Ga0209500_1000167037 | 3300027782 | Freshwater Lake | VLVASLRNNMITLNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209400_10825615 | 3300027963 | Freshwater Lake | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYIVLAEDTVXTN |
| Ga0209400_11742003 | 3300027963 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXVKXKNYPLRWMSMRII |
| Ga0209191_10311938 | 3300027969 | Freshwater Lake | LIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0209191_11040494 | 3300027969 | Freshwater Lake | MDHISRNDVILMLSFKGFTTDSLMKKSDEELDNLYIEYVVLHEDYV |
| Ga0209401_12452091 | 3300027971 | Freshwater Lake | MITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYVXVKXKNYPL |
| (restricted) Ga0247834_11870094 | 3300027977 | Freshwater | MITKSRAELIELLSYKGFTSDELSQKDDETLENLYIEYVVLAEDYVXVQLKRKHY |
| Ga0304729_11007911 | 3300028392 | Freshwater Lake | MVQYEPVCYTKSHRNDIIFMLSFKGFTTDALMLKSDEELDNLYIEYIILAEDYV |
| Ga0304728_10983384 | 3300028393 | Freshwater Lake | ITKNRAELIELLSYKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0315907_104924362 | 3300031758 | Freshwater | MDTISRSELIFMLSFKGFTSDELSTKSDEELENLYIEYIVLEEV |
| Ga0315907_106553981 | 3300031758 | Freshwater | VDTIEREDLIFMLSFKGFTTEQLSKMDNETIDNLYIEHIVLNGDYE |
| Ga0315899_114370863 | 3300031784 | Freshwater | MDTIERQDLIFMLSFKGFTSDQLQKMDDETLDNLYIEHVVLCGE |
| Ga0315900_107840412 | 3300031787 | Freshwater | MNTISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0315909_101761383 | 3300031857 | Freshwater | MDTISRSELIFMLSFKGFTTDELSTKSDEELENLYIEYIVLEEV |
| Ga0315909_103141673 | 3300031857 | Freshwater | MITKSREELIYMLSFKGFTTDYLMTKDDETLENLYIEYIILAEDYV |
| Ga0315909_105875091 | 3300031857 | Freshwater | MDTISRQELIYMLSFKGFTSDELSTKTDEELDNLYIEYIVLENV |
| Ga0316220_10752602 | 3300031884 | Freshwater | MDTINREGLILMLSFKGFTTDYLMTLCDETLDNLYIECIVLGEDYYDVA |
| Ga0316220_13164752 | 3300031884 | Freshwater | MDTISRNDLITMLSFKGFTTDYLMKQSDDTLDNLYIEYIVLEEDYV |
| Ga0315904_110432811 | 3300031951 | Freshwater | MITKSREELIYMLSFKGFTTDYLMTKDDETLENLYIEYIILAEDYVXVKWLNYH |
| Ga0315905_103856691 | 3300032092 | Freshwater | MDTISREDLILMLSFKGWTSDELSLMDNETLDNLYI |
| Ga0315905_107249643 | 3300032092 | Freshwater | GGSMITKSREELIYMLSFKGFTTDYLMTKDDETLENLYIEYIVLAEDYV |
| Ga0315905_111830021 | 3300032092 | Freshwater | LCLMDTISREDLILMLSFKGWTSDELSLMDNETLDNLYIEYIVLENDYV |
| Ga0316225_10772674 | 3300032675 | Freshwater | MDTINREGLILMLSFKGFTTDYLMTLSDETLDNLYIECIVLGEDYYDVA |
| ⦗Top⦘ |