


| Basic Information | |
|---|---|
| Family ID | F063167 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.38 % |
| % of genes near scaffold ends (potentially truncated) | 23.08 % |
| % of genes from short scaffolds (< 2000 bps) | 73.85 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.538 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (41.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 4.62 |
| PF08401 | ArdcN | 2.31 |
| PF03796 | DnaB_C | 1.54 |
| PF10507 | TMEM65 | 1.54 |
| PF10544 | T5orf172 | 0.77 |
| PF07486 | Hydrolase_2 | 0.77 |
| PF04404 | ERF | 0.77 |
| PF12705 | PDDEXK_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 2.31 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.54 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.54 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.54 % |
| All Organisms | root | All Organisms | 28.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 41.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.54% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 20.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.85% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.31% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.77% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.77% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.77% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031597 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_102243043 | 3300000115 | Marine | PTRLVKTDKQAESALIVFFSMIAGSLLIAVAIILH* |
| DelMOSpr2010_100606851 | 3300000116 | Marine | MKKEKPTKLVKTDKQEESAFIVFWSIIIAGILLAVSIILNYL* |
| DelMOSpr2010_100735975 | 3300000116 | Marine | MKIKKPTRLVKTDKQAESALIVFFSMIAGSLLIAVAII |
| DelMOSpr2010_101058782 | 3300000116 | Marine | MKKETTKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| LPaug09P1610mDRAFT_10155351 | 3300000149 | Marine | MKKETNKLVKTDKQEENAFIVFWSIIIAGILLAVSIIMHYL* |
| OpTDRAFT_102843313 | 3300000928 | Freshwater And Marine | MKSHKPNKLVKTDKQEESAFIVFCSIIIAGILLAVSIIMHYL* |
| JGI24006J15134_100479435 | 3300001450 | Marine | MKTNKPTRLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24006J15134_100694603 | 3300001450 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIILNYL* |
| JGI24006J15134_100903234 | 3300001450 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24003J15210_100452152 | 3300001460 | Marine | MKINKPTRLVKTDKHEESAFVVFWSIIVGGILLAVTIISHYL* |
| JGI24003J15210_100476041 | 3300001460 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIINYL* |
| JGI24003J15210_100756873 | 3300001460 | Marine | MKSHKPNKLVKLVKTNKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24003J15210_101831503 | 3300001460 | Marine | IMKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24004J15324_100104266 | 3300001472 | Marine | MKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24004J15324_100412702 | 3300001472 | Marine | MKKETNKLVKTDEQEESAFIVFWSIIIAGILLTVSIIMHYL* |
| JGI24004J15324_101002743 | 3300001472 | Marine | MKIHKQNKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24004J15324_101355952 | 3300001472 | Marine | MKTNKPTKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24005J15628_100775401 | 3300001589 | Marine | MKTNKPTKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| JGI24005J15628_102086393 | 3300001589 | Marine | MKTNKPTKLVKTDEQEESAFIVLWSIIIAGILLAVSIIMHYL* |
| JGI25127J35165_10164833 | 3300002482 | Marine | MKIKKPNKLVKTDKQEESAFIVFWSIIVGGILLAVTIIAEYL* |
| JGI25127J35165_10181416 | 3300002482 | Marine | MKIKKPNRLVKTDKQEESAYIVIWSMIVGGILLAVTIIVEYL* |
| JGI25127J35165_10644822 | 3300002482 | Marine | MKIKKPNRLVKTDKQEESAYIVIWSMIVGXILLAVTIIVEYX* |
| JGI25127J35165_11220182 | 3300002482 | Marine | MKIKKPNKLVKTDKQEESAFIVFWSIIVGGILLAVTIIVEYL* |
| JGI25128J35275_11142212 | 3300002488 | Marine | MKIKKENRLVKTDKQEESAYIVIWSIVVGGILLAVSIIMHYL* |
| Ga0065861_10137873 | 3300004448 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| Ga0065861_10499783 | 3300004448 | Marine | MKTFKPNKLVKLVKTDKQEESAFIVFWSIIIAGILLVVSIIMHYL* |
| Ga0066224_10223002 | 3300004457 | Marine | MKSHKPNKLVKLVKTDEQEENAFIVFCSIIIAGILLVVSIIMHYL* |
| Ga0075478_1000445612 | 3300006026 | Aqueous | MKSHKPNKLVKTDEQEENAFIVFCSIIIAGILLVVSIIMHYL* |
| Ga0075478_100466321 | 3300006026 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVSIIINYL* |
| Ga0075478_101840021 | 3300006026 | Aqueous | PTRLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL* |
| Ga0075466_10527303 | 3300006029 | Aqueous | MKIKKPNRLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL* |
| Ga0098038_11225512 | 3300006735 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL* |
| Ga0070749_102052975 | 3300006802 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL* |
| Ga0070749_102885591 | 3300006802 | Aqueous | INDTMKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL* |
| Ga0070754_100267924 | 3300006810 | Aqueous | MKIKKPNKLVKTDKQEESAYIVLWSIIIAGILLGVTIIAEYL* |
| Ga0070754_101089128 | 3300006810 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAV |
| Ga0070750_102912232 | 3300006916 | Aqueous | MKIHKPNKLVKTDKQEESAFIVFWSIIVGGILLAVSIIIHYL* |
| Ga0070750_103274831 | 3300006916 | Aqueous | KEPNKQVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| Ga0070746_100204528 | 3300006919 | Aqueous | MKIKEPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| Ga0070746_100941285 | 3300006919 | Aqueous | MKIKKPNRLVKTDKQEESAFIVFWSIIIAGILLVVSIIMHYL* |
| Ga0070748_11875572 | 3300006920 | Aqueous | MKINKQNKLVKTDKQEESAYIVFWSIIVGGILLAVSIISHYL* |
| Ga0098036_12066482 | 3300006929 | Marine | MKIKKPTRLVKTDKQAESAFIVFFSIIIGSILIAVAIISHYL* |
| Ga0070753_12579932 | 3300007346 | Aqueous | MKINKQNKLVKTDKQEESAYIVFWSIIVGGILLAVTIISHY |
| Ga0070751_100254517 | 3300007640 | Aqueous | MKSHKPNKLVKTDEQEENAFIVFCSIIIAGILLVVS |
| Ga0070751_11971814 | 3300007640 | Aqueous | KIKKPNKLVKTDKQEESAYIVLWSIIIAGILLGVTIIAEYL* |
| Ga0075480_103544171 | 3300008012 | Aqueous | MKIKEPNKLVKTDKQEESAFIVFWSIIIAGILLAVSII |
| Ga0114995_1001899313 | 3300009172 | Marine | MKIHKPNKLVKTDSQTESAFIVFSCIIVAGILLIVTVIMENL* |
| Ga0114998_101740823 | 3300009422 | Marine | MKKETNKLVKTDKQEENAFIVFWSIIIAGILLAVSIILNYL* |
| Ga0114998_104127361 | 3300009422 | Marine | TTKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL* |
| Ga0115008_100404313 | 3300009436 | Marine | MKTNKPTKLVKTDEQEENAFIVFWSIIIAGILLSVSIIMHYL* |
| Ga0115004_107064182 | 3300009526 | Marine | MKTNKPTKLVKTDEQEENAFIVFWSIIIAGILLAVSIIINYL* |
| Ga0115001_105664703 | 3300009785 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIILNYL* |
| Ga0118731_1078885963 | 3300010392 | Marine | MKKETNKLVKTDRQEESAFIVFWSIIIAGLLLAVSIIMHYL* |
| Ga0118733_1004396403 | 3300010430 | Marine Sediment | MKIHKPTKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL* |
| Ga0151675_10003349 | 3300011254 | Marine | MKIKKPNKLVKTDKQEESAFIVFWSIIIGGILLAVSIIMHYL* |
| Ga0163179_115205312 | 3300012953 | Seawater | MKKETNKLVKTDKQEESAFIVFWSIIIAGLLLAVSIIMHYL* |
| Ga0129327_102776651 | 3300013010 | Freshwater To Marine Saline Gradient | MKSHKPNKLVKTDKQEESAFIVFWSIIIAGILLVVSIIMHYL* |
| Ga0181387_100048717 | 3300017709 | Seawater | MKSHKPNKLVKLVKTNKQEESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0181387_10043612 | 3300017709 | Seawater | MKIKKQNRLVKTDKQAESAFIVFFSMITAGLLIAVSLIMHYL |
| Ga0181387_10716212 | 3300017709 | Seawater | MWRRDLVIMKIKKPNKLVKTDKQEESAYIVFWSIIVGGILLAVTIISHYL |
| Ga0181403_10130326 | 3300017710 | Seawater | FYGISIVKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0181391_10221314 | 3300017713 | Seawater | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMQYL |
| Ga0181412_10059877 | 3300017714 | Seawater | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMQYL |
| Ga0181390_10916952 | 3300017719 | Seawater | MKIKPTRLVKTEKQEESAYVVFWSIIVGGILLAVTIISHYL |
| Ga0181398_10921171 | 3300017725 | Seawater | KETNKLVKTDEQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0181401_10038076 | 3300017727 | Seawater | MKIHKPNKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0181417_10016919 | 3300017730 | Seawater | MKIKKPNKLVKTDRQEESAYIVLWSMIIGGILLAVTIIVEYL |
| Ga0181421_10535371 | 3300017741 | Seawater | DTMKINKPTRLVKTDKQAENAYVVFWSIIVGGILLAVTIISHYL |
| Ga0181402_10025158 | 3300017743 | Seawater | MKIHKPNKLVKTDEQEENAFIVFWRIIIAGILLAVSIIMHYL |
| Ga0181402_10459573 | 3300017743 | Seawater | INDTMKIKKQNRLVKTDKQAESALIVFFSMITAGLLIAVSIIMHYL |
| Ga0181392_11321682 | 3300017749 | Seawater | MKIHKPNKLVKTDKQTESAFIVFSSIIVAGILLIVTVIMENL |
| Ga0181405_11361341 | 3300017750 | Seawater | TMKKETNKLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL |
| Ga0187219_10180822 | 3300017751 | Seawater | MKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMQYL |
| Ga0181411_10146727 | 3300017755 | Seawater | MKKETNKLVKTDKQEESAYIVFWSITIAGILLAVSIIMHYL |
| Ga0181411_11072212 | 3300017755 | Seawater | MKIKPTRLVKTDKQAESALIVFFSMITAGLLIAVAIISH |
| Ga0181408_10247565 | 3300017760 | Seawater | MKIKKPNKLVKTDKQAESALIVFFSMITAGLLIAVAIISHYL |
| Ga0181422_12698972 | 3300017762 | Seawater | MKSHKPNKLVKLVKTNKQEESAFIVFWSIIVGAILLAVSIIMHYL |
| Ga0181410_12178803 | 3300017763 | Seawater | MKIKPTRLVKTDKQAESALIVFFSMIAGSLLIAVAII |
| Ga0181430_12305312 | 3300017772 | Seawater | MKIHKPNKLVNLVKTDKQEESAFIVFWSIIVGGILLAVSIIVEYL |
| Ga0181386_11339641 | 3300017773 | Seawater | TMKIKKPNKLVKTDKQEESAYIVFWSIIVGGILLAVTIIAEYL |
| Ga0181394_12163701 | 3300017776 | Seawater | MKKETNKLVKTDKQEESAFIVFWSIIIGSILLAVSIIMHYL |
| Ga0181380_10503174 | 3300017782 | Seawater | MKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0211708_104568132 | 3300020436 | Marine | MKIKKPNKLVKTDKQEESAYIVFWSIIVGGILLAVTIIAEYL |
| Ga0211577_107726042 | 3300020469 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0212026_10376281 | 3300022069 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVTII |
| Ga0224906_100063720 | 3300022074 | Seawater | MKIKKPNKLVKTDKQAESAFIVFFSIITAGLLLAVSIIMHYL |
| Ga0224906_100121115 | 3300022074 | Seawater | MKIKKPNKLVKTDQQEESAFIVFWSIAVGGILLAVSIIMHYL |
| Ga0196899_10536741 | 3300022187 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL |
| Ga0196899_10746742 | 3300022187 | Aqueous | MKSHKPNKLVKTDKQEESAFIVFWSIIIAGILLVVSIIMHYL |
| Ga0207905_10070195 | 3300025048 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0207905_10092042 | 3300025048 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIINYL |
| Ga0207896_10106935 | 3300025071 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIILNYL |
| Ga0208159_10266872 | 3300025101 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0209535_101173614 | 3300025120 | Marine | MKSHKPNKLVKLVKTNKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0209535_10132003 | 3300025120 | Marine | MKKETNKLVKTDKQEENAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0209535_10197006 | 3300025120 | Marine | MKIHKQNKLVKTDKQEESAFIVFWSIIIGGILLAVSIIMHYL |
| Ga0209535_11632413 | 3300025120 | Marine | MKKEKPTKLVKTDEQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0209535_11894671 | 3300025120 | Marine | MKIHKQNKLVKTDKQEESAFIVFWSIIIAGILLAVSII |
| Ga0209348_10047855 | 3300025127 | Marine | MKIKKPNKLVKTDKQEESAFIVFWSIIVGGILLAVTIIAEYL |
| Ga0209348_10103284 | 3300025127 | Marine | MKIKKPNKLVKTDKQEESAFIVFWSIIVGGILLAVTIIVEYL |
| Ga0209348_10243873 | 3300025127 | Marine | MKIKKPNRLVKTDKQEESAYIVIWSMIVGGILLAVTIIVEYL |
| Ga0209348_10325091 | 3300025127 | Marine | MKIKPTRLVKTEKQEESAYVVFWSIIVGGILLAVTII |
| Ga0209348_12094942 | 3300025127 | Marine | MKIKKENRLVKTDKQEESAYIVIWSIVVGGILLAVSIIMHYL |
| Ga0209232_10203186 | 3300025132 | Marine | MKIHKPNRLVKTDKQAESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0209232_11230953 | 3300025132 | Marine | MKIKKPNRLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0209336_101063461 | 3300025137 | Marine | MKKETNKLVKTDEQEESAFIVFWSIIIAGILLTVSIIMHYL |
| Ga0209336_101067482 | 3300025137 | Marine | MKIHKQNKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0208450_11165151 | 3300025301 | Deep Ocean | NMKIHKQNRLVKTDKQEESAFIVFWSIIVGGILLAVTIISNYL |
| Ga0208148_11128021 | 3300025508 | Aqueous | NRLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0208149_10742152 | 3300025610 | Aqueous | MKSHKPNKLVKTDEQEENAFIVFCSIIIAGILLVVSIIMHYL |
| Ga0208149_11132841 | 3300025610 | Aqueous | INDTMKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVTIISHYL |
| Ga0208162_100024345 | 3300025674 | Aqueous | MKIKKPNKLVKTDKQEESAYIVLWSIIIAGILLGVTIIAEYL |
| Ga0208767_100830316 | 3300025769 | Aqueous | NKLVKTDKQEESAFIVFWSIIIAGILLVVSIIMHYL |
| Ga0208767_10664103 | 3300025769 | Aqueous | MKIKEPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0208767_12041873 | 3300025769 | Aqueous | RKPISDTMKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVSIIINYL |
| Ga0209192_1001353310 | 3300027752 | Marine | MKIHKPNKLVKTDSQTESAFIVFSCIIVAGILLIVTVIMENL |
| Ga0209192_102669032 | 3300027752 | Marine | MKKETTKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0209830_1002199711 | 3300027791 | Marine | MKKETNKLVKTDKQEENAFIVFWSIIIAGILLAVSIILNYL |
| Ga0209830_100336162 | 3300027791 | Marine | MKTNKPTKLVKTDEQEENAFIVFWSIIIAGILLAVSIIINYL |
| Ga0183755_100105919 | 3300029448 | Marine | MKIKKPNRLVKTDKQEESAFIVFWSIIVGGILLAVTIIAEYL |
| Ga0183755_10225032 | 3300029448 | Marine | MKIKKPNRLVKTDKQEESAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0183755_10850922 | 3300029448 | Marine | MKKETNKLVKTDKQAESAFIVFWSIIIAGLLLAVTIIMHYL |
| Ga0302116_11054243 | 3300031597 | Marine | MKKEKPTKLVKTDKQEESAFIVFWSIIIAGILLAVSIILNYL |
| Ga0302114_104035723 | 3300031621 | Marine | MKKETNKLVKTDEQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0302126_100818953 | 3300031622 | Marine | MKIHKPNKLVKTDKQEENAFIVFWSIIVGGILLAVSIIMHYL |
| Ga0302126_101417622 | 3300031622 | Marine | MKIHKQNKLVKTDEQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0302121_100297933 | 3300031626 | Marine | MKIHKPNKLVKTDKQEESAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0302125_102508931 | 3300031638 | Marine | MKKETNKLVKTDKQEESAFIVFWSIIIAGILLAVS |
| Ga0314858_098096_343_471 | 3300033742 | Sea-Ice Brine | MKTNKPNKLVKTDEQEENAFIVFWSIIIAGILLAVSIIMHYL |
| Ga0348335_064298_489_617 | 3300034374 | Aqueous | MKINKPTRLVKTDKQAESAYVVFWSIIVGGILLAVSIIINYL |
| ⦗Top⦘ |