


| Basic Information | |
|---|---|
| Family ID | F063132 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ENGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.54 % |
| % of genes near scaffold ends (potentially truncated) | 97.69 % |
| % of genes from short scaffolds (< 2000 bps) | 86.15 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.69% β-sheet: 0.00% Coil/Unstructured: 95.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 26.92 |
| PF04909 | Amidohydro_2 | 12.31 |
| PF07969 | Amidohydro_3 | 9.23 |
| PF05726 | Pirin_C | 6.92 |
| PF13378 | MR_MLE_C | 2.31 |
| PF00144 | Beta-lactamase | 1.54 |
| PF01547 | SBP_bac_1 | 1.54 |
| PF13594 | Obsolete Pfam Family | 1.54 |
| PF13191 | AAA_16 | 0.77 |
| PF00501 | AMP-binding | 0.77 |
| PF00496 | SBP_bac_5 | 0.77 |
| PF00149 | Metallophos | 0.77 |
| PF13432 | TPR_16 | 0.77 |
| PF13523 | Acetyltransf_8 | 0.77 |
| PF13462 | Thioredoxin_4 | 0.77 |
| PF00491 | Arginase | 0.77 |
| PF07859 | Abhydrolase_3 | 0.77 |
| PF00903 | Glyoxalase | 0.77 |
| PF09130 | DUF1932 | 0.77 |
| PF16576 | HlyD_D23 | 0.77 |
| PF07978 | NIPSNAP | 0.77 |
| PF14384 | BrnA_antitoxin | 0.77 |
| PF13659 | Obsolete Pfam Family | 0.77 |
| PF10672 | Methyltrans_SAM | 0.77 |
| PF13416 | SBP_bac_8 | 0.77 |
| PF05221 | AdoHcyase | 0.77 |
| PF02452 | PemK_toxin | 0.77 |
| PF07719 | TPR_2 | 0.77 |
| PF13511 | DUF4124 | 0.77 |
| PF13531 | SBP_bac_11 | 0.77 |
| PF00487 | FA_desaturase | 0.77 |
| PF00881 | Nitroreductase | 0.77 |
| PF02416 | TatA_B_E | 0.77 |
| PF01244 | Peptidase_M19 | 0.77 |
| PF07366 | SnoaL | 0.77 |
| PF02515 | CoA_transf_3 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 26.92 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 6.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.54 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.54 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.77 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.77 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.77 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.77 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.77 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.77 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.77 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.77 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.31 % |
| Unclassified | root | N/A | 7.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100372887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300000443|F12B_10405294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 989 | Open in IMG/M |
| 3300000955|JGI1027J12803_100962780 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300002560|JGI25383J37093_10203266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300004062|Ga0055500_10103321 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005167|Ga0066672_10727509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300005171|Ga0066677_10065463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1854 | Open in IMG/M |
| 3300005175|Ga0066673_10818625 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005180|Ga0066685_10086024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2082 | Open in IMG/M |
| 3300005186|Ga0066676_10942181 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005332|Ga0066388_101724001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1110 | Open in IMG/M |
| 3300005336|Ga0070680_100437800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1116 | Open in IMG/M |
| 3300005445|Ga0070708_101111789 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005450|Ga0066682_10137970 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300005451|Ga0066681_10284032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300005459|Ga0068867_100736600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
| 3300005468|Ga0070707_100233662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1789 | Open in IMG/M |
| 3300005468|Ga0070707_101297021 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005518|Ga0070699_101730279 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005545|Ga0070695_101721335 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005546|Ga0070696_100777010 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
| 3300005549|Ga0070704_101078438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
| 3300005552|Ga0066701_10018955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3376 | Open in IMG/M |
| 3300005556|Ga0066707_10306792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300005564|Ga0070664_101703257 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005713|Ga0066905_101516786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300005843|Ga0068860_100337309 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300006163|Ga0070715_10105617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
| 3300006755|Ga0079222_11714330 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300006845|Ga0075421_101911151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300006845|Ga0075421_102133148 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006852|Ga0075433_10035309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4298 | Open in IMG/M |
| 3300006854|Ga0075425_101981304 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006854|Ga0075425_101992182 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006871|Ga0075434_100287930 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300006871|Ga0075434_101786211 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300006880|Ga0075429_100052516 | All Organisms → cellular organisms → Bacteria | 3547 | Open in IMG/M |
| 3300006880|Ga0075429_100060233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3307 | Open in IMG/M |
| 3300006880|Ga0075429_101834268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300006894|Ga0079215_10644169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 702 | Open in IMG/M |
| 3300006894|Ga0079215_11166091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300006914|Ga0075436_100075294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2337 | Open in IMG/M |
| 3300007004|Ga0079218_12924755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300007076|Ga0075435_100016431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5580 | Open in IMG/M |
| 3300007076|Ga0075435_101621422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 568 | Open in IMG/M |
| 3300007265|Ga0099794_10324751 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009038|Ga0099829_10418848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1108 | Open in IMG/M |
| 3300009078|Ga0105106_10847828 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009098|Ga0105245_10313150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1544 | Open in IMG/M |
| 3300009137|Ga0066709_102203490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300009143|Ga0099792_10865322 | Not Available | 596 | Open in IMG/M |
| 3300009162|Ga0075423_12903832 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009176|Ga0105242_11330692 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010043|Ga0126380_12198730 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010303|Ga0134082_10032526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1962 | Open in IMG/M |
| 3300010303|Ga0134082_10074448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1324 | Open in IMG/M |
| 3300010329|Ga0134111_10025148 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300010336|Ga0134071_10112490 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300010337|Ga0134062_10016460 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| 3300010361|Ga0126378_10615165 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300010361|Ga0126378_12575327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300010362|Ga0126377_11867137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
| 3300010362|Ga0126377_12592342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300010366|Ga0126379_10589829 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300010376|Ga0126381_101286084 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010391|Ga0136847_13490280 | Not Available | 506 | Open in IMG/M |
| 3300010397|Ga0134124_10145710 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
| 3300010399|Ga0134127_10231625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1738 | Open in IMG/M |
| 3300011271|Ga0137393_10510379 | Not Available | 1031 | Open in IMG/M |
| 3300012189|Ga0137388_11160720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
| 3300012210|Ga0137378_10546053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1067 | Open in IMG/M |
| 3300012349|Ga0137387_10490519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 892 | Open in IMG/M |
| 3300012350|Ga0137372_10030817 | All Organisms → cellular organisms → Bacteria | 4914 | Open in IMG/M |
| 3300012353|Ga0137367_11012210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300012355|Ga0137369_11064232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 531 | Open in IMG/M |
| 3300012361|Ga0137360_10586487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300012582|Ga0137358_10291823 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1108 | Open in IMG/M |
| 3300012917|Ga0137395_10201578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1385 | Open in IMG/M |
| 3300012929|Ga0137404_10475155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1112 | Open in IMG/M |
| 3300012929|Ga0137404_10811394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300012930|Ga0137407_10160951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1991 | Open in IMG/M |
| 3300012930|Ga0137407_10514693 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300012944|Ga0137410_10787499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 798 | Open in IMG/M |
| 3300012955|Ga0164298_10145474 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300012971|Ga0126369_10919576 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012972|Ga0134077_10082828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1224 | Open in IMG/M |
| 3300012975|Ga0134110_10268784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 730 | Open in IMG/M |
| 3300012976|Ga0134076_10099195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1153 | Open in IMG/M |
| 3300015374|Ga0132255_103617861 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300016371|Ga0182034_10847296 | Not Available | 784 | Open in IMG/M |
| 3300016387|Ga0182040_11366741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 599 | Open in IMG/M |
| 3300017657|Ga0134074_1251800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
| 3300018064|Ga0187773_10742347 | Not Available | 617 | Open in IMG/M |
| 3300018433|Ga0066667_10037956 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
| 3300018433|Ga0066667_10089937 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2008 | Open in IMG/M |
| 3300018433|Ga0066667_11961100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300019882|Ga0193713_1007946 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300019889|Ga0193743_1169911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300020004|Ga0193755_1030340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1789 | Open in IMG/M |
| 3300021090|Ga0210377_10437650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 768 | Open in IMG/M |
| 3300025551|Ga0210131_1055098 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025917|Ga0207660_11229332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300025922|Ga0207646_10293833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1468 | Open in IMG/M |
| 3300025922|Ga0207646_11439846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300025938|Ga0207704_10834260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
| 3300025986|Ga0207658_10809430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 851 | Open in IMG/M |
| 3300026089|Ga0207648_10775080 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300026142|Ga0207698_11041600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 830 | Open in IMG/M |
| 3300026482|Ga0257172_1045020 | Not Available | 806 | Open in IMG/M |
| 3300026494|Ga0257159_1001213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3325 | Open in IMG/M |
| 3300026540|Ga0209376_1146400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300027882|Ga0209590_10221404 | Not Available | 1201 | Open in IMG/M |
| 3300027882|Ga0209590_10673660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300028381|Ga0268264_10145305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2120 | Open in IMG/M |
| 3300028381|Ga0268264_10147049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2109 | Open in IMG/M |
| 3300028673|Ga0257175_1037862 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031547|Ga0310887_10094851 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300031679|Ga0318561_10082000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1671 | Open in IMG/M |
| 3300031852|Ga0307410_10546348 | Not Available | 960 | Open in IMG/M |
| 3300031949|Ga0214473_10438187 | Not Available | 1469 | Open in IMG/M |
| 3300031995|Ga0307409_100283389 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1533 | Open in IMG/M |
| 3300032010|Ga0318569_10309631 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032013|Ga0310906_10673901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300032180|Ga0307471_102713312 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032180|Ga0307471_103299216 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300032205|Ga0307472_100131370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1792 | Open in IMG/M |
| 3300032205|Ga0307472_102775679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300032770|Ga0335085_10057920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5193 | Open in IMG/M |
| 3300033502|Ga0326731_1042092 | Not Available | 1079 | Open in IMG/M |
| 3300034056|Ga0373893_045778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1003728872 | 3300000364 | Soil | PIWENGFIRAYGPRVEEAGLKLIPSFPYSGPPEDLRLKPSAR* |
| F12B_104052942 | 3300000443 | Soil | FAPIWENGFIRAVGPRMQEAALTLIPAYPYAAPYEDIRLKP* |
| JGI1027J12803_1009627802 | 3300000955 | Soil | FIRAYGPRVEEAGLTLIQSFPYSAPLEDVRLKKQ* |
| JGI25383J37093_102032662 | 3300002560 | Grasslands Soil | NGFIRAYGPRVEESGLTLIPAFPYSGPLEDVRLKKQAAAR* |
| Ga0055500_101033211 | 3300004062 | Natural And Restored Wetlands | ERVMFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEDLRLKAR* |
| Ga0066672_107275092 | 3300005167 | Soil | FAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR* |
| Ga0066677_100654634 | 3300005171 | Soil | IWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR* |
| Ga0066673_108186251 | 3300005175 | Soil | VFAPIWENGFIRGVSAKLEEPALTLIPAFPYVAPFEELRLKK* |
| Ga0066685_100860242 | 3300005180 | Soil | MFVPIWENGFIRAYGSRVEEPGRTLIPAFPDSGPLEDVRLKK* |
| Ga0066676_109421812 | 3300005186 | Soil | PIWENGFIRGVGSRAEEPALTLIPAFPYSAPFEDLRLKK* |
| Ga0066388_1017240012 | 3300005332 | Tropical Forest Soil | MYVAPIWENGFIRAFGPRMEEAGLQLIQSFPYAAPLEELRLKKQ* |
| Ga0070680_1004378002 | 3300005336 | Corn Rhizosphere | FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK* |
| Ga0070708_1011117892 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RVIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR* |
| Ga0066682_101379703 | 3300005450 | Soil | VVFAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKTSAR* |
| Ga0066681_102840321 | 3300005451 | Soil | FAPIWENGFIRAFGPRLEEAALNLIPSFPYVGPLEDLKLKKP* |
| Ga0068867_1007366002 | 3300005459 | Miscanthus Rhizosphere | FAPIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR* |
| Ga0070707_1002336623 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QERVVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR* |
| Ga0070707_1012970212 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RIVQERVVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR* |
| Ga0070699_1017302792 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR* |
| Ga0070695_1017213351 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEELRLKAR* |
| Ga0070696_1007770101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ENGFIRAYGPRVEEAGLKLIPSFPYSGPLEDLRLKPSAR* |
| Ga0070704_1010784382 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR* |
| Ga0066701_100189557 | 3300005552 | Soil | FIRGVGPKVDEPGLTLIPAYPYSAPYEDVRLKQQ* |
| Ga0066707_103067921 | 3300005556 | Soil | PIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR* |
| Ga0070664_1017032571 | 3300005564 | Corn Rhizosphere | ALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK* |
| Ga0066905_1015167861 | 3300005713 | Tropical Forest Soil | PIWENGFIRAFGPRMEEAGLQLIQSFPYAAPLEELRLKKQ* |
| Ga0068860_1003373091 | 3300005843 | Switchgrass Rhizosphere | PIWENGFIRAYGQRVEEPGLTLLPAFPYSGPLEDVRLKK* |
| Ga0070715_101056172 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NGFIRGVGPRVEEPALSLIPSFPYSAPYEDVRLKP* |
| Ga0079222_117143302 | 3300006755 | Agricultural Soil | GFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK* |
| Ga0075421_1019111512 | 3300006845 | Populus Rhizosphere | APVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK* |
| Ga0075421_1021331482 | 3300006845 | Populus Rhizosphere | ELAFLVGVGPRVEEPALGLIDHFPTPAPWEDVRLKRQ* |
| Ga0075433_100353091 | 3300006852 | Populus Rhizosphere | VWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK* |
| Ga0075425_1019813041 | 3300006854 | Populus Rhizosphere | IQRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK* |
| Ga0075425_1019921821 | 3300006854 | Populus Rhizosphere | IQRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK* |
| Ga0075434_1002879303 | 3300006871 | Populus Rhizosphere | RVVFAPIWENGFIRAFGPRVEEAGLTLIPAFPYSGPLEELRLKR* |
| Ga0075434_1017862111 | 3300006871 | Populus Rhizosphere | ENGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK* |
| Ga0075429_1000525161 | 3300006880 | Populus Rhizosphere | IADRMMFVPIWENGFIRAYGPRLEEPALTLIPAFPYSGPPEDVRLRK* |
| Ga0075429_1000602331 | 3300006880 | Populus Rhizosphere | VVFAPIWENGFIRAYGPRLDEAGLKLIPSFPYSGPLEDLRLKPSAR* |
| Ga0075429_1018342681 | 3300006880 | Populus Rhizosphere | IWENGFIRAYGPRVEEAGLSLIQAFPYSGPLEDVKLKKP* |
| Ga0079215_106441691 | 3300006894 | Agricultural Soil | IFAPIWENGFIRGVGSRLEEPALALVPAFPYVAPYEELRLKK* |
| Ga0079215_111660911 | 3300006894 | Agricultural Soil | PIWENGFIRASGPRAEEPGLTLIPAFPYAAPAEDLRVKRP* |
| Ga0075436_1000752941 | 3300006914 | Populus Rhizosphere | ENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKGR* |
| Ga0079218_129247552 | 3300007004 | Agricultural Soil | IWENALIRGVGPRVEEGGLSLIPSFPYSAPAEELRLKSR* |
| Ga0075435_1000164314 | 3300007076 | Populus Rhizosphere | QRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK* |
| Ga0075435_1016214222 | 3300007076 | Populus Rhizosphere | WENGFIRAFGPRMEEAGLNLIQSFPYAGPLEDLKLKKQ* |
| Ga0099794_103247512 | 3300007265 | Vadose Zone Soil | ENGFIRAYGPRVEESGLQLIPSFPYSGPLEDVRLKR* |
| Ga0099829_104188482 | 3300009038 | Vadose Zone Soil | VKHIFAPIWENGFIRAFGPRVEKAGLTLIPAFPYSGPLEDVRLKK* |
| Ga0105106_108478281 | 3300009078 | Freshwater Sediment | RGLIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP* |
| Ga0105245_103131503 | 3300009098 | Miscanthus Rhizosphere | APIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR* |
| Ga0066709_1022034902 | 3300009137 | Grasslands Soil | FAPIWENGFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKPSAR* |
| Ga0099792_108653221 | 3300009143 | Vadose Zone Soil | GFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ* |
| Ga0075423_129038321 | 3300009162 | Populus Rhizosphere | MLADQVVFAPIWENGFIRAYGPRVEEAGLKLIPSFPYSGPVEDLRLKPSAR* |
| Ga0105242_113306922 | 3300009176 | Miscanthus Rhizosphere | GFIRGVGPRVEEPALTLIPSFPYSAPYEDVRLKP* |
| Ga0126380_121987301 | 3300010043 | Tropical Forest Soil | ERVMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR* |
| Ga0134082_100325263 | 3300010303 | Grasslands Soil | FIRASGPRVEESGLTLIPAFPYSGPLEDVRLKKEAGPR* |
| Ga0134082_100744481 | 3300010303 | Grasslands Soil | GFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKPSAR* |
| Ga0134111_100251481 | 3300010329 | Grasslands Soil | FLRGVGPRVEEPGLTLIPSYPYSAPYEDIRLKRR* |
| Ga0134071_101124904 | 3300010336 | Grasslands Soil | GFIRGVGPKVEEPALTLIPSYPYSAPYEDVRLKPR* |
| Ga0134062_100164601 | 3300010337 | Grasslands Soil | LADHVVFAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR* |
| Ga0126378_106151652 | 3300010361 | Tropical Forest Soil | ENGFIRGVGPRVEEPALSMIPAFPYSAPFEDLRLKK* |
| Ga0126378_125753272 | 3300010361 | Tropical Forest Soil | WENGFIRAYGPRLEEPGLTLIPAFPYSGPLEDVRLKK* |
| Ga0126377_118671372 | 3300010362 | Tropical Forest Soil | QERVMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR* |
| Ga0126377_125923422 | 3300010362 | Tropical Forest Soil | ENGFIRAAGPRVEEPALSLIPAFPYAAPLEDLRLKK* |
| Ga0126379_105898291 | 3300010366 | Tropical Forest Soil | ENGFIRGVGPKVEEPALTLIPAYPYSAPYEDVRLKRQ* |
| Ga0126381_1012860841 | 3300010376 | Tropical Forest Soil | GFIRGVGPRVQEGSLELIPAFPYSAPMEDVRLKP* |
| Ga0136847_134902801 | 3300010391 | Freshwater Sediment | IWENGFIRGVGPRVEEAALTLIPAFPYAAPYEELRLRRQTP* |
| Ga0134124_101457103 | 3300010397 | Terrestrial Soil | ENGFIRAFGPRLEEAALNLIPSFPYAGPLEDLKLKKP* |
| Ga0134127_102316251 | 3300010399 | Terrestrial Soil | APIWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK* |
| Ga0137393_105103791 | 3300011271 | Vadose Zone Soil | NGFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ* |
| Ga0137388_111607201 | 3300012189 | Vadose Zone Soil | QERMVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAK* |
| Ga0137378_105460531 | 3300012210 | Vadose Zone Soil | IWENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK* |
| Ga0137387_104905192 | 3300012349 | Vadose Zone Soil | NGFIRGVHARAEEPALTLIPAFPYAAPYEELRVKK* |
| Ga0137372_100308171 | 3300012350 | Vadose Zone Soil | PIWENGFIRGVGSRAEEPALSLIPSFPYSAPFEDLRLKK* |
| Ga0137367_110122102 | 3300012353 | Vadose Zone Soil | AIQERVIFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEDLRLKAR* |
| Ga0137369_110642321 | 3300012355 | Vadose Zone Soil | FLWGVGPRVGEPGADLIQAYPYSAPYEDVRLKKP* |
| Ga0137360_105864872 | 3300012361 | Vadose Zone Soil | VIFAPIWENGFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKASAR* |
| Ga0137358_102918232 | 3300012582 | Vadose Zone Soil | VVFAPIWENGFIRAYGPRLEEAALNLIPSYPYAGPLEELRLKAR* |
| Ga0137395_102015782 | 3300012917 | Vadose Zone Soil | WENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK* |
| Ga0137404_104751552 | 3300012929 | Vadose Zone Soil | FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEDLRLKAR* |
| Ga0137404_108113942 | 3300012929 | Vadose Zone Soil | ENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK* |
| Ga0137407_101609511 | 3300012930 | Vadose Zone Soil | VFAPIWENGFIRAYGPRVEEAGLALIPAFPYSGPLEDLRLKAR* |
| Ga0137407_105146931 | 3300012930 | Vadose Zone Soil | FIRGVGPKVEEPALTLIPSFPYSAPYEDVRLKRP* |
| Ga0137410_107874991 | 3300012944 | Vadose Zone Soil | ERVMFAPIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR* |
| Ga0164298_101454742 | 3300012955 | Soil | ENGFIRGVGPRAEEPALALIPSYPYSAPYEDVRLKP* |
| Ga0126369_109195762 | 3300012971 | Tropical Forest Soil | VMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR* |
| Ga0134077_100828281 | 3300012972 | Grasslands Soil | FIRAYGPRVEESGLTLIPAFPYSGPLEDVRLKKQAAAR* |
| Ga0134110_102687842 | 3300012975 | Grasslands Soil | ENGFIRGVGPRAEEPALTLIPSYPYSAPYEDLRLK* |
| Ga0134076_100991952 | 3300012976 | Grasslands Soil | ENGFIRAYGPRMEEAGLKLIPAFPYSAPLEDLKLKPAAR* |
| Ga0132255_1036178612 | 3300015374 | Arabidopsis Rhizosphere | GFIRGVGPRVEEPALSLIPSFPYSAPYEDVKLKP* |
| Ga0182034_108472962 | 3300016371 | Soil | ENGFIRGVGPRVEEPGLALIPFYPYSAPYEELRLKP |
| Ga0182040_113667411 | 3300016387 | Soil | IWENGFIRGAGARVEEPALTLIPAYPYSAPYEEVRLKRQ |
| Ga0134074_12518001 | 3300017657 | Grasslands Soil | ENGFIRGVGPRMQEAALTLIPAFPYSAPYEDVRLKP |
| Ga0187773_107423472 | 3300018064 | Tropical Peatland | WENGFIRGVGPRVAEPALALIPAFPYSAPSEALRLKPADPPAR |
| Ga0066667_100379563 | 3300018433 | Grasslands Soil | VFAPIWENGFIRAFGARVEEPGLTLIPSYPYSAAYEDIRLKRR |
| Ga0066667_100899372 | 3300018433 | Grasslands Soil | IWENGFIRAYGSRVEEPGPTLIPASPYSGPLEDVRLKK |
| Ga0066667_119611001 | 3300018433 | Grasslands Soil | NGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK |
| Ga0193713_10079461 | 3300019882 | Soil | WENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR |
| Ga0193743_11699111 | 3300019889 | Soil | LIQERMVFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEDLKLRR |
| Ga0193755_10303401 | 3300020004 | Soil | WENGFIRGVGPRVDEPALALIPYFPYSASYEELRLKP |
| Ga0210377_104376501 | 3300021090 | Groundwater Sediment | NGFIRAFGPRVEEAGLKLIPAFPYSAPLEELRLKR |
| Ga0210131_10550981 | 3300025551 | Natural And Restored Wetlands | AEFIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP |
| Ga0207660_112293321 | 3300025917 | Corn Rhizosphere | IWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK |
| Ga0207646_102938333 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR |
| Ga0207646_114398461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IWENGFIRAFGPRVEEAGLKLIPSFPYSGPLEDLRLKPSAR |
| Ga0207704_108342601 | 3300025938 | Miscanthus Rhizosphere | IWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR |
| Ga0207658_108094302 | 3300025986 | Switchgrass Rhizosphere | NGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK |
| Ga0207648_107750802 | 3300026089 | Miscanthus Rhizosphere | WENGFIRGVGSRVEEPGLSLIPAFPYSAPLEDLRLKK |
| Ga0207698_110416001 | 3300026142 | Corn Rhizosphere | NGFIRAFGPRVEEAGLTLIPAFPYSGPLEELRLKR |
| Ga0257172_10450202 | 3300026482 | Soil | NGFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ |
| Ga0257159_10012133 | 3300026494 | Soil | RIVQERMVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAK |
| Ga0209376_11464002 | 3300026540 | Soil | FAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR |
| Ga0209590_102214041 | 3300027882 | Vadose Zone Soil | IWENEFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ |
| Ga0209590_106736602 | 3300027882 | Vadose Zone Soil | NGFIRGVGPRVEEPALTLIPAFGYSAPYEDLRLKRP |
| Ga0268264_101453053 | 3300028381 | Switchgrass Rhizosphere | FAGIWENGFIRAFGPRVEEAGLTLIPAFPYSGPLEDVRLKK |
| Ga0268264_101470492 | 3300028381 | Switchgrass Rhizosphere | RAMFVPIWENGFIRAYGQRVEEPGLTLLPAFPYSGPLEDVRLKK |
| Ga0257175_10378622 | 3300028673 | Soil | NGFIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP |
| Ga0310887_100948511 | 3300031547 | Soil | VPIWENGFIRAYGPRLEEPGLTLLPAFPYSGPLEDVRLKRGS |
| Ga0318561_100820003 | 3300031679 | Soil | IWENGFIRGVGPRIEEPGLALIPFYPYSAPYEELRLKP |
| Ga0307410_105463481 | 3300031852 | Rhizosphere | VWENGFIRAYGPRMEEPGLTLIQSFPYSAPLEDIRLKPR |
| Ga0214473_104381874 | 3300031949 | Soil | AIIRGVGPRVEEGGLTLIPSYPYSAPAEELKLKRP |
| Ga0307409_1002833891 | 3300031995 | Rhizosphere | ENGFIRAYGPRVEEAGLALIQAFPYSGPLEDVRLKKP |
| Ga0318569_103096312 | 3300032010 | Soil | ENGFIRAFGPRMEEAGMTLIPAFPYAGPLEELRLKR |
| Ga0310906_106739011 | 3300032013 | Soil | IWENGFIRAYGPRMEEAGLQLIQSFPYTAPLEDLRLKKQ |
| Ga0307471_1027133121 | 3300032180 | Hardwood Forest Soil | ENGFIRGVGPRVEEPALALIPYFPYSAPYEELRLKP |
| Ga0307471_1032992162 | 3300032180 | Hardwood Forest Soil | IVQERVIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR |
| Ga0307472_1001313703 | 3300032205 | Hardwood Forest Soil | RLVQERVVFAPIWENGFIRAFGPRMEQAGLNLIPSFPYAGPPEELRLKSL |
| Ga0307472_1027756791 | 3300032205 | Hardwood Forest Soil | IWENGFIRGVAARAEEPALTLIPAFPYAAPYEELRVKK |
| Ga0335085_100579207 | 3300032770 | Soil | APIWENGFIRAYGPRMVEAGLKLIPAFPYSAPLEELRLKP |
| Ga0326731_10420922 | 3300033502 | Peat Soil | IWENGFIRGVGPRAEEPALSLIPAFPYAAPFEDLRLKR |
| Ga0373893_045778_338_448 | 3300034056 | Sediment Slurry | MRAHPGVGARVEEAALTLIPSYPYSAPYEELRLKAR |
| ⦗Top⦘ |