


| Basic Information | |
|---|---|
| Family ID | F063102 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 76.15 % |
| % of genes from short scaffolds (< 2000 bps) | 74.62 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.462 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (9.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.538 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.86% β-sheet: 0.00% Coil/Unstructured: 85.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00211 | Guanylate_cyc | 70.77 |
| PF00498 | FHA | 20.00 |
| PF00069 | Pkinase | 2.31 |
| PF04095 | NAPRTase | 0.77 |
| PF05860 | TPS | 0.77 |
| PF02826 | 2-Hacid_dh_C | 0.77 |
| PF01476 | LysM | 0.77 |
| PF01791 | DeoC | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 70.77 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 9.23 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.77 |
| COG3210 | Large exoprotein involved in heme utilization or adhesion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.46 % |
| Unclassified | root | N/A | 21.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11534462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 771 | Open in IMG/M |
| 3300004081|Ga0063454_100202596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1130 | Open in IMG/M |
| 3300004153|Ga0063455_100531442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 743 | Open in IMG/M |
| 3300004808|Ga0062381_10035758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1349 | Open in IMG/M |
| 3300005093|Ga0062594_101496880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
| 3300005166|Ga0066674_10207995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 931 | Open in IMG/M |
| 3300005178|Ga0066688_10141037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1504 | Open in IMG/M |
| 3300005295|Ga0065707_10372349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 888 | Open in IMG/M |
| 3300005439|Ga0070711_101098554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
| 3300005451|Ga0066681_10896571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300005529|Ga0070741_10112213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2847 | Open in IMG/M |
| 3300005540|Ga0066697_10835630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300005547|Ga0070693_100458469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 896 | Open in IMG/M |
| 3300005549|Ga0070704_101589750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300005559|Ga0066700_10214639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1334 | Open in IMG/M |
| 3300005559|Ga0066700_11023597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300005576|Ga0066708_10535599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
| 3300005888|Ga0075289_1085485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 525 | Open in IMG/M |
| 3300005904|Ga0075280_10015708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1277 | Open in IMG/M |
| 3300006163|Ga0070715_10861011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300006755|Ga0079222_10762733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 781 | Open in IMG/M |
| 3300006755|Ga0079222_11271184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
| 3300006806|Ga0079220_10867516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 695 | Open in IMG/M |
| 3300006852|Ga0075433_10672111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 908 | Open in IMG/M |
| 3300006853|Ga0075420_101417555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
| 3300006871|Ga0075434_101921944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
| 3300006894|Ga0079215_11459821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300006903|Ga0075426_10001162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18511 | Open in IMG/M |
| 3300006904|Ga0075424_102419093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 551 | Open in IMG/M |
| 3300006914|Ga0075436_100158744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1594 | Open in IMG/M |
| 3300006914|Ga0075436_100221513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1342 | Open in IMG/M |
| 3300006969|Ga0075419_10060320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2392 | Open in IMG/M |
| 3300009089|Ga0099828_10343753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1344 | Open in IMG/M |
| 3300009098|Ga0105245_11611085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 701 | Open in IMG/M |
| 3300009678|Ga0105252_10146321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 982 | Open in IMG/M |
| 3300010336|Ga0134071_10444364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300010397|Ga0134124_11228898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 770 | Open in IMG/M |
| 3300010399|Ga0134127_10658281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1083 | Open in IMG/M |
| 3300010400|Ga0134122_10527512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1075 | Open in IMG/M |
| 3300010401|Ga0134121_10272341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1489 | Open in IMG/M |
| 3300010403|Ga0134123_11724101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 678 | Open in IMG/M |
| 3300010403|Ga0134123_12360275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
| 3300011416|Ga0137422_1006275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2690 | Open in IMG/M |
| 3300011419|Ga0137446_1150948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300011420|Ga0137314_1142776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300011430|Ga0137423_1122498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 779 | Open in IMG/M |
| 3300012038|Ga0137431_1118248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 749 | Open in IMG/M |
| 3300012203|Ga0137399_10692887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 857 | Open in IMG/M |
| 3300012469|Ga0150984_117203425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 779 | Open in IMG/M |
| 3300012925|Ga0137419_10869845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 741 | Open in IMG/M |
| 3300012989|Ga0164305_11506292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 597 | Open in IMG/M |
| 3300013308|Ga0157375_11527620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 788 | Open in IMG/M |
| 3300014166|Ga0134079_10525722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300015200|Ga0173480_11159624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
| 3300015245|Ga0137409_10575931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 954 | Open in IMG/M |
| 3300015374|Ga0132255_104507790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 590 | Open in IMG/M |
| 3300018422|Ga0190265_10814641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1056 | Open in IMG/M |
| 3300018466|Ga0190268_11510588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300018466|Ga0190268_12062014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 527 | Open in IMG/M |
| 3300020202|Ga0196964_10123052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300021066|Ga0196980_1068947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 605 | Open in IMG/M |
| 3300021441|Ga0213871_10195210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300021953|Ga0213880_10046039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1053 | Open in IMG/M |
| 3300024330|Ga0137417_1297385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
| 3300025165|Ga0209108_10103654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1532 | Open in IMG/M |
| 3300025324|Ga0209640_10217631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1619 | Open in IMG/M |
| 3300025885|Ga0207653_10024553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1924 | Open in IMG/M |
| 3300025908|Ga0207643_10342547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 937 | Open in IMG/M |
| 3300025908|Ga0207643_11012596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300025910|Ga0207684_10501419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1040 | Open in IMG/M |
| 3300025912|Ga0207707_10290644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1414 | Open in IMG/M |
| 3300025961|Ga0207712_10752451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 854 | Open in IMG/M |
| 3300025979|Ga0210078_1022986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 814 | Open in IMG/M |
| 3300026067|Ga0207678_10559465 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300026116|Ga0207674_10975726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 816 | Open in IMG/M |
| 3300026326|Ga0209801_1109633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300027462|Ga0210000_1082797 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027513|Ga0208685_1001103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8840 | Open in IMG/M |
| 3300027513|Ga0208685_1055987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 852 | Open in IMG/M |
| 3300027573|Ga0208454_1049383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 978 | Open in IMG/M |
| 3300027846|Ga0209180_10677984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300027876|Ga0209974_10288736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
| 3300027886|Ga0209486_10326794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 910 | Open in IMG/M |
| 3300027903|Ga0209488_10722757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 712 | Open in IMG/M |
| 3300027907|Ga0207428_10150246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1773 | Open in IMG/M |
| 3300028145|Ga0247663_1105227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
| 3300028802|Ga0307503_10233411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 890 | Open in IMG/M |
| 3300030511|Ga0268241_10081779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 730 | Open in IMG/M |
| 3300030511|Ga0268241_10151002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 568 | Open in IMG/M |
| 3300031170|Ga0307498_10454451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
| 3300031576|Ga0247727_10585547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 843 | Open in IMG/M |
| 3300031913|Ga0310891_10183073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300031944|Ga0310884_10875390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300031965|Ga0326597_10790719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 985 | Open in IMG/M |
| 3300032002|Ga0307416_101269096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
| 3300032012|Ga0310902_10503153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 790 | Open in IMG/M |
| 3300032174|Ga0307470_11324983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300032180|Ga0307471_103448945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300032180|Ga0307471_103471960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
| 3300033417|Ga0214471_10282136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1353 | Open in IMG/M |
| 3300033417|Ga0214471_11021796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 635 | Open in IMG/M |
| 3300034164|Ga0364940_0258788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.54% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.54% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.77% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.77% |
| Hot Spring Water Column | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column | 0.77% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.77% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.77% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.77% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005794 | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009945 | Combined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021066 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_115344622 | 3300000890 | Soil | TDSVAEDVEYGFAGEVGTTPPMDHRIDESGISVPRCVQESREGLPCK* |
| Ga0055498_100464031 | 3300004058 | Natural And Restored Wetlands | VAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC* |
| Ga0063454_1002025962 | 3300004081 | Soil | IDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGQACKGS* |
| Ga0063455_1005314422 | 3300004153 | Soil | DYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCTN* |
| Ga0062589_1004743822 | 3300004156 | Soil | SVAEQVEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGDAC* |
| Ga0062592_1008674642 | 3300004480 | Soil | FGTDSVAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC* |
| Ga0062591_1027990231 | 3300004643 | Soil | AEQVEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGDAC* |
| Ga0062381_100357582 | 3300004808 | Wetland Sediment | NKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK* |
| Ga0062594_1014968801 | 3300005093 | Soil | ALLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDETGISVPICFNDSREGQTCR* |
| Ga0066674_102079952 | 3300005166 | Soil | AKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0066688_101410371 | 3300005178 | Soil | QALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESRESRPCKN* |
| Ga0065707_103723492 | 3300005295 | Switchgrass Rhizosphere | DVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK* |
| Ga0070711_1010985541 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DISRSALLEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISTPDCFEESREGTACK* |
| Ga0070694_1007106521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GTDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGEGC* |
| Ga0066681_108965712 | 3300005451 | Soil | DAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0070741_101122131 | 3300005529 | Surface Soil | VAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN* |
| Ga0066697_108356302 | 3300005540 | Soil | AKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK* |
| Ga0070693_1004584692 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVSESREGVPCK* |
| Ga0070704_1015897502 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPECFEESRENNACK* |
| Ga0066700_102146393 | 3300005559 | Soil | AKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESRESRPCKN* |
| Ga0066700_110235971 | 3300005559 | Soil | GDVGTTPPMDHRIDETGISTPDCFEESREGTACK* |
| Ga0066708_105355992 | 3300005576 | Soil | AKQIDYGFAGDIGATPPMDHRIDETGISTPDCFEESREGTACK* |
| Ga0079490_1119381 | 3300005794 | Sediment | VAEQIEFGFAGDVGVLPPMDHRLQGGGISVPKCFNESREGENC* |
| Ga0074479_110309341 | 3300005829 | Sediment (Intertidal) | GDVGTLPPIDHRLQGVGISVPDCFNESREGESCAK* |
| Ga0074470_113412651 | 3300005836 | Sediment (Intertidal) | DSVAQIIEFGFVGDIGTLPPIDHRLQGVGISVPDCFNESREGEACAR* |
| Ga0075289_10854852 | 3300005888 | Rice Paddy Soil | TDSVQKQIDYGFAGDVGTTPPMDHRIDETGISTPNCFEESRDGEPCRARN* |
| Ga0075280_100157082 | 3300005904 | Rice Paddy Soil | DTDSVQKQIDYGFAGDVGMTPPMDHRIDDTGISTPHCFEESRDSEACRGN* |
| Ga0070715_108610112 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSRDGQTCR* |
| Ga0075367_104821262 | 3300006178 | Populus Endosphere | IEYGFAGDVGTLPPMDHRLTGVGISVPACFNNSREGEGC* |
| Ga0079222_107627331 | 3300006755 | Agricultural Soil | ALQEALDTDSVQKQIDYGFAGDVGTTPPMDHRIDDTGISTPQCFEQSREGEACTN* |
| Ga0079222_112711841 | 3300006755 | Agricultural Soil | LKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGTPCK* |
| Ga0079220_108675161 | 3300006806 | Agricultural Soil | TDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGQACKAN* |
| Ga0075433_106721112 | 3300006852 | Populus Rhizosphere | DTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ* |
| Ga0075420_1014175552 | 3300006853 | Populus Rhizosphere | KDAQSTDSVAKQIDYGFAGDIGNTPPMDHRIDETGISTPNCFEESREGVACK* |
| Ga0075434_1019219442 | 3300006871 | Populus Rhizosphere | ATQDTDSVQKQISYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ* |
| Ga0079215_114598212 | 3300006894 | Agricultural Soil | YGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK* |
| Ga0075426_100011621 | 3300006903 | Populus Rhizosphere | YGFAGDVGTTPPMDHRIDETGISTPECMEESREARPCRN* |
| Ga0075424_1024190931 | 3300006904 | Populus Rhizosphere | GDVGTTPPMDHRIDDTGISTPNCFNESREGQDCK* |
| Ga0075436_1001587443 | 3300006914 | Populus Rhizosphere | QALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0075436_1002215133 | 3300006914 | Populus Rhizosphere | YGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ* |
| Ga0075419_100603201 | 3300006969 | Populus Rhizosphere | ADSFSTDSVADQINKGFAGDVGATPPMDHRLEESGISTPECFNEARESVPCK* |
| Ga0099828_103437531 | 3300009089 | Vadose Zone Soil | AGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0105245_116110851 | 3300009098 | Miscanthus Rhizosphere | TDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGTACK* |
| Ga0075418_118337702 | 3300009100 | Populus Rhizosphere | EYGFAGDVGNLPPIDHRLQGVGISVPKCFNESREGEGC* |
| Ga0105252_100056014 | 3300009678 | Soil | EANKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK* |
| Ga0105252_101463211 | 3300009678 | Soil | NKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK* |
| Ga0117932_11245351 | 3300009945 | Hot Spring Water Column | FGTDSVAEQIEFGFAGDVSTAPPMAHRLAGTGIGTPECFVESREGEACE* |
| Ga0099796_103082751 | 3300010159 | Vadose Zone Soil | AQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENTACK* |
| Ga0134071_104443641 | 3300010336 | Grasslands Soil | ALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0134124_112288981 | 3300010397 | Terrestrial Soil | QALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK* |
| Ga0134127_106582812 | 3300010399 | Terrestrial Soil | AALLDQQDTDSVQNQMSYGFVGDVGTTPPMDHRIDETGISVPICFNDSREGQICR* |
| Ga0134122_105275121 | 3300010400 | Terrestrial Soil | TDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPSCFNDSRDGQTCR* |
| Ga0134122_131880581 | 3300010400 | Terrestrial Soil | QIEYGFAGDVSTAPPMAHRLTGTGIGTPECFAESRDGEPCEP* |
| Ga0134121_102723413 | 3300010401 | Terrestrial Soil | AQDTDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPRCFNDSREGQICQ* |
| Ga0134123_117241012 | 3300010403 | Terrestrial Soil | LEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQACR* |
| Ga0134123_123602751 | 3300010403 | Terrestrial Soil | QIAAQALAEAQDTDSVQKQIDYGFEGEVGTTPPMDHRIDETGISTPSCFEESREGAACKN |
| Ga0137323_10472632 | 3300011409 | Soil | EANKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK* |
| Ga0137422_10062753 | 3300011416 | Soil | EYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK* |
| Ga0137446_11509481 | 3300011419 | Soil | KQIKDGFAGDVGTTPPMDHRIDDTGISVPSCFEESREGQGKC* |
| Ga0137314_11427762 | 3300011420 | Soil | AEDVEYGFAGEIGATPPMDHRIDESGISLPHCVEEAREGQPCK* |
| Ga0137439_10771051 | 3300011424 | Soil | VEQQIEYGFAGDVGTLPPIDHRLQGVGISVPNCFNESREGESCAGQPPR* |
| Ga0137423_11224982 | 3300011430 | Soil | FGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK* |
| Ga0137431_11182481 | 3300012038 | Soil | EYGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK* |
| Ga0137399_106928871 | 3300012203 | Vadose Zone Soil | DYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENQACK* |
| Ga0150984_1172034251 | 3300012469 | Avena Fatua Rhizosphere | QIDYGFAGDVGTTPPMDHRIDETGISTPECFEESREGTACK* |
| Ga0157216_102643942 | 3300012668 | Glacier Forefield Soil | TDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNNSREGEGC* |
| Ga0137419_108698451 | 3300012925 | Vadose Zone Soil | KQIDYGFAGDVGTTPPMDHRIDETGISTPECLEESRESRPCKN* |
| Ga0137410_115631092 | 3300012944 | Vadose Zone Soil | AAQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENTACK* |
| Ga0164305_115062921 | 3300012989 | Soil | TDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN* |
| Ga0157375_115276201 | 3300013308 | Miscanthus Rhizosphere | MSYGFVGDVGTTPPMDHRIDETGISVPKCFTDSREGTTCR* |
| Ga0134079_105257222 | 3300014166 | Grasslands Soil | LKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0173480_111596241 | 3300015200 | Soil | DSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK* |
| Ga0137409_105759312 | 3300015245 | Vadose Zone Soil | FAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK* |
| Ga0132255_1045077901 | 3300015374 | Arabidopsis Rhizosphere | ANKTFGTDSVAADVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK* |
| Ga0190265_108146411 | 3300018422 | Soil | EAGDVGVTPPMDHRLDETGISVPECLNESNEGVDCKRPQ |
| Ga0190268_115105881 | 3300018466 | Soil | SVAEDVEYGFAGEIGATPPMDHRIDESGISLPACVQESRDGVPCK |
| Ga0190268_120620141 | 3300018466 | Soil | GTDSVAEAVEYGFAGEVGTTPPMDHRIDENGISLPRCVEESREGVPCK |
| Ga0190274_102262221 | 3300018476 | Soil | GTDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGESC |
| Ga0173479_106819081 | 3300019362 | Soil | SVAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC |
| Ga0187892_104401742 | 3300019458 | Bio-Ooze | DSVAEQVEFGFAGDVGTLPPFAHRLSGVGLSTPECFVESREGEGC |
| Ga0196964_101230522 | 3300020202 | Soil | KQIKDGFAGDVGATPPMDHRIDESGISTPECLNEQREGAACP |
| Ga0196980_10689471 | 3300021066 | Soil | DVEYGFAGEIGATPPMDHRIGDSGISVPRCLEEARESLPCK |
| Ga0213871_101952101 | 3300021441 | Rhizosphere | DNNMVGDVGTTPPMDHRLEESGISTPDCMSESKEGAACK |
| Ga0213880_100460391 | 3300021953 | Exposed Rock | SVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK |
| Ga0137417_12973852 | 3300024330 | Vadose Zone Soil | FAGDVGTTPPMDHRIDETGISTPECLEESRESRPCKN |
| Ga0209320_102963112 | 3300025155 | Soil | VAEQIEYGFAGDVGTLPPMDHRLTGVGISVPKCFNESREGEAC |
| Ga0209108_101036543 | 3300025165 | Soil | VQEANETFGTDSVAEQVEYGFAGDVGTTPPMDHRLDETGISVPACLNESREGLPCK |
| Ga0209321_101626282 | 3300025312 | Soil | YGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGEAC |
| Ga0209640_102176311 | 3300025324 | Soil | KDGFAGDVGTTPPMDHRIDDTGISVPRCFEESREGQGKC |
| Ga0207653_100245531 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDESGISLPRCVQESREGVPCK |
| Ga0207643_103425471 | 3300025908 | Miscanthus Rhizosphere | AYGFVGDVGTTPPMDHGIDETGISVPRCFNDSREGQTCR |
| Ga0207643_110125962 | 3300025908 | Miscanthus Rhizosphere | DSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK |
| Ga0207684_105014192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN |
| Ga0207707_102906441 | 3300025912 | Corn Rhizosphere | DAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGAACK |
| Ga0207712_107524511 | 3300025961 | Switchgrass Rhizosphere | EANKTFGTDSVAEDVEYGFAGEVGATPPMDHRIDESGISLPRCVQESREGVPCK |
| Ga0210078_10229862 | 3300025979 | Natural And Restored Wetlands | ALLEAQDTDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPICFNDSREGQPCR |
| Ga0207678_105594653 | 3300026067 | Corn Rhizosphere | VEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK |
| Ga0207674_109757261 | 3300026116 | Corn Rhizosphere | QSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPSCFEESREGTACK |
| Ga0209801_11096332 | 3300026326 | Soil | DSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK |
| Ga0210000_10827972 | 3300027462 | Arabidopsis Thaliana Rhizosphere | ALDTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPECFDESRENEACK |
| Ga0208685_10011031 | 3300027513 | Soil | NKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK |
| Ga0208685_10559871 | 3300027513 | Soil | FGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK |
| Ga0208454_10493831 | 3300027573 | Soil | NKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK |
| Ga0209180_106779842 | 3300027846 | Vadose Zone Soil | QKQIEYGFAGDVGTTPPMDHRIDETGISVPGCFNESRDGQACK |
| Ga0209974_102887361 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VEYGFAGEIGATPPMDHRIDESGISLPRCVEESREGVPCK |
| Ga0209486_103267941 | 3300027886 | Agricultural Soil | EQVEYGFAGDVGTTPPMDHRLDETGISVPACLNESREGVPCK |
| Ga0209488_107227572 | 3300027903 | Vadose Zone Soil | ARTSLLASHDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQTCQ |
| Ga0207428_101502463 | 3300027907 | Populus Rhizosphere | NKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVQESREGVPCK |
| Ga0247663_11052272 | 3300028145 | Soil | EIARAALLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDETGISVPICFNDSREGQACR |
| Ga0307503_102334111 | 3300028802 | Soil | MAYGFSGDVGTTPPMDHRIDETGISVPVCFNDSREGQTCR |
| Ga0268241_100817791 | 3300030511 | Soil | DAQATDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPSCFEESREGTACK |
| Ga0268241_101510021 | 3300030511 | Soil | DTDSVQKQIDYGFAGDVGTTPPMDHRIDETGISTPECFDQSREGEPCR |
| Ga0307498_104544512 | 3300031170 | Soil | IARAALLESQDTDSVAKQLLYGFAGDVGTTPPMNHQIDDTGISVPGCFNESREGQTCK |
| Ga0247727_105855471 | 3300031576 | Biofilm | FGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVAESREGVPCK |
| Ga0310891_101830731 | 3300031913 | Soil | AEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK |
| Ga0310884_108753901 | 3300031944 | Soil | AKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGTACK |
| Ga0326597_107907191 | 3300031965 | Soil | ANETFGTDSVAEQVEYGFAGDVGTTPPMDHRLEETGISVPECLNESQEGEPCK |
| Ga0307416_1012690961 | 3300032002 | Rhizosphere | EYGFAGEVGATPPMDHRIDESGISLPRCVQESREGLPCK |
| Ga0310902_105031531 | 3300032012 | Soil | EDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK |
| Ga0315912_108404612 | 3300032157 | Soil | GTDSVAEQIEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGEGC |
| Ga0307470_113249831 | 3300032174 | Hardwood Forest Soil | LAAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCMTDSREGQACQ |
| Ga0307471_1034489452 | 3300032180 | Hardwood Forest Soil | DTDSVQKQIEYGFAGDVGTTPPMDHRIDETGISVPTCFNDSREGNACR |
| Ga0307471_1034719601 | 3300032180 | Hardwood Forest Soil | ALALMHAQTTDWVAKKIDSGFAGAVGTTPPMDHRIDETGISTPDCFEESREGAACK |
| Ga0315271_116080151 | 3300032256 | Sediment | IEYGFAGDVGTLPPMDHRLQGVGISVPACFNNSREGEAC |
| Ga0335084_121221551 | 3300033004 | Soil | TDSVAQQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEGC |
| Ga0335084_121644102 | 3300033004 | Soil | QIEFGFAGDVGVLPPMDHRLQGVGISVPKCFNESREGEAC |
| Ga0335077_103133131 | 3300033158 | Soil | AQQVEYGFAGDVGVLPPIDHRLLGVGISVPKCFNESREGENC |
| Ga0214471_102821361 | 3300033417 | Soil | FAGDVGTTPPMDHRLDETGISVPHCLNESREGVPCK |
| Ga0214471_110217961 | 3300033417 | Soil | SVAEQVEYGFAGDVGTTPPMDHRLDETGISVPECLNESREGVPCK |
| Ga0364940_0258788_8_142 | 3300034164 | Sediment | VAKQIKDGFAGDVGTTPPMDHRIDDTGISVPACFEESREGQGKC |
| ⦗Top⦘ |