


| Basic Information | |
|---|---|
| Family ID | F063027 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MHNMKEDAKEAAKDSGMKKSDAEHGHLKVTDVKMVSDSCQK |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.56 % |
| % of genes near scaffold ends (potentially truncated) | 94.62 % |
| % of genes from short scaffolds (< 2000 bps) | 87.69 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 4.62 |
| PF04055 | Radical_SAM | 3.85 |
| PF14534 | DUF4440 | 3.08 |
| PF00882 | Zn_dep_PLPC | 2.31 |
| PF00174 | Oxidored_molyb | 1.54 |
| PF04191 | PEMT | 1.54 |
| PF11066 | DUF2867 | 0.77 |
| PF13561 | adh_short_C2 | 0.77 |
| PF00196 | GerE | 0.77 |
| PF11752 | DUF3309 | 0.77 |
| PF08445 | FR47 | 0.77 |
| PF00078 | RVT_1 | 0.77 |
| PF01569 | PAP2 | 0.77 |
| PF00578 | AhpC-TSA | 0.77 |
| PF03050 | DDE_Tnp_IS66 | 0.77 |
| PF13490 | zf-HC2 | 0.77 |
| PF13620 | CarboxypepD_reg | 0.77 |
| PF04226 | Transgly_assoc | 0.77 |
| PF04773 | FecR | 0.77 |
| PF07715 | Plug | 0.77 |
| PF14559 | TPR_19 | 0.77 |
| PF08308 | PEGA | 0.77 |
| PF12779 | WXXGXW | 0.77 |
| PF04932 | Wzy_C | 0.77 |
| PF16916 | ZT_dimer | 0.77 |
| PF04794 | YdjC | 0.77 |
| PF05974 | DUF892 | 0.77 |
| PF04616 | Glyco_hydro_43 | 0.77 |
| PF13414 | TPR_11 | 0.77 |
| PF09650 | PHA_gran_rgn | 0.77 |
| PF00480 | ROK | 0.77 |
| PF13424 | TPR_12 | 0.77 |
| PF05649 | Peptidase_M13_N | 0.77 |
| PF13502 | AsmA_2 | 0.77 |
| PF07730 | HisKA_3 | 0.77 |
| PF11218 | DUF3011 | 0.77 |
| PF00857 | Isochorismatase | 0.77 |
| PF01797 | Y1_Tnp | 0.77 |
| PF10417 | 1-cysPrx_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.54 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.54 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.54 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.77 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.77 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.77 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.77 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.77 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.77 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.77 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.77 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.54 % |
| Unclassified | root | N/A | 18.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT01AWGFP | Not Available | 517 | Open in IMG/M |
| 3300000789|JGI1027J11758_12814669 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300001593|JGI12635J15846_10605176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101429425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101828095 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005176|Ga0066679_10127820 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300005435|Ga0070714_102127013 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 547 | Open in IMG/M |
| 3300005436|Ga0070713_100172006 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300005439|Ga0070711_100024579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3932 | Open in IMG/M |
| 3300005445|Ga0070708_100376394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 1339 | Open in IMG/M |
| 3300005450|Ga0066682_10304177 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005451|Ga0066681_10374659 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005537|Ga0070730_11045192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005539|Ga0068853_100481971 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005568|Ga0066703_10353472 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005578|Ga0068854_100485974 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005598|Ga0066706_10620256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300005764|Ga0066903_107332913 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005843|Ga0068860_101327743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300006047|Ga0075024_100094269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300006102|Ga0075015_100670929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300006173|Ga0070716_100271616 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300006175|Ga0070712_101395411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300006176|Ga0070765_101513654 | Not Available | 631 | Open in IMG/M |
| 3300006794|Ga0066658_10357742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300006893|Ga0073928_10043771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4109 | Open in IMG/M |
| 3300006893|Ga0073928_10150680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1877 | Open in IMG/M |
| 3300007982|Ga0102924_1322733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300009038|Ga0099829_10095481 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300009038|Ga0099829_10491824 | Not Available | 1018 | Open in IMG/M |
| 3300009088|Ga0099830_11048364 | Not Available | 676 | Open in IMG/M |
| 3300009089|Ga0099828_10230102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1658 | Open in IMG/M |
| 3300009092|Ga0105250_10330368 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009148|Ga0105243_10728397 | Not Available | 970 | Open in IMG/M |
| 3300009174|Ga0105241_11995031 | Not Available | 571 | Open in IMG/M |
| 3300009553|Ga0105249_11914354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300010043|Ga0126380_11781819 | Not Available | 556 | Open in IMG/M |
| 3300010047|Ga0126382_10959664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300010322|Ga0134084_10184867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300010335|Ga0134063_10056456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1724 | Open in IMG/M |
| 3300010336|Ga0134071_10072465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1601 | Open in IMG/M |
| 3300010360|Ga0126372_13267040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010364|Ga0134066_10315570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300010375|Ga0105239_10360244 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300010375|Ga0105239_12960945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300011119|Ga0105246_10455857 | Not Available | 1076 | Open in IMG/M |
| 3300011120|Ga0150983_14535429 | Not Available | 598 | Open in IMG/M |
| 3300012096|Ga0137389_10089608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2422 | Open in IMG/M |
| 3300012198|Ga0137364_11280903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300012202|Ga0137363_10377697 | Not Available | 1177 | Open in IMG/M |
| 3300012205|Ga0137362_10891906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300012351|Ga0137386_10237035 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300012353|Ga0137367_10502359 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300012361|Ga0137360_10034111 | All Organisms → cellular organisms → Bacteria | 3548 | Open in IMG/M |
| 3300012362|Ga0137361_11145160 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012363|Ga0137390_10477992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300012922|Ga0137394_10980842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300012927|Ga0137416_11727591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300012927|Ga0137416_12071340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012927|Ga0137416_12108741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300012929|Ga0137404_10657052 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012930|Ga0137407_10311274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
| 3300012930|Ga0137407_11137237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 740 | Open in IMG/M |
| 3300012944|Ga0137410_11949810 | Not Available | 521 | Open in IMG/M |
| 3300013296|Ga0157374_11179967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300013306|Ga0163162_11905000 | All Organisms → cellular organisms → Archaea | 680 | Open in IMG/M |
| 3300013308|Ga0157375_10382882 | Not Available | 1573 | Open in IMG/M |
| 3300014154|Ga0134075_10015440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2988 | Open in IMG/M |
| 3300014325|Ga0163163_10438703 | Not Available | 1365 | Open in IMG/M |
| 3300014501|Ga0182024_11156392 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300015167|Ga0167661_1045640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 823 | Open in IMG/M |
| 3300015264|Ga0137403_10127116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2535 | Open in IMG/M |
| 3300017927|Ga0187824_10022986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1848 | Open in IMG/M |
| 3300017930|Ga0187825_10305276 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300020006|Ga0193735_1002104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6431 | Open in IMG/M |
| 3300020006|Ga0193735_1130245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300020170|Ga0179594_10372749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300020579|Ga0210407_11411831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300020581|Ga0210399_10168545 | Not Available | 1815 | Open in IMG/M |
| 3300020583|Ga0210401_10475001 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300021088|Ga0210404_10295691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300021170|Ga0210400_11181173 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021170|Ga0210400_11377673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300021344|Ga0193719_10071312 | Not Available | 1508 | Open in IMG/M |
| 3300021344|Ga0193719_10242755 | Not Available | 763 | Open in IMG/M |
| 3300021478|Ga0210402_10134622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2243 | Open in IMG/M |
| 3300021479|Ga0210410_10735593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300021560|Ga0126371_13737793 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025320|Ga0209171_10020068 | All Organisms → cellular organisms → Bacteria | 5341 | Open in IMG/M |
| 3300025321|Ga0207656_10386411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300025893|Ga0207682_10636224 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025900|Ga0207710_10547430 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025910|Ga0207684_10296569 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300025916|Ga0207663_11678957 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025960|Ga0207651_12085339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300026078|Ga0207702_10244781 | Not Available | 1681 | Open in IMG/M |
| 3300026281|Ga0209863_10012131 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
| 3300026308|Ga0209265_1136887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300026323|Ga0209472_1045574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1915 | Open in IMG/M |
| 3300026325|Ga0209152_10212571 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026326|Ga0209801_1208069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300026328|Ga0209802_1201689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300026377|Ga0257171_1053926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300026523|Ga0209808_1065747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300026529|Ga0209806_1279599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300026557|Ga0179587_10518059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 783 | Open in IMG/M |
| 3300027548|Ga0209523_1037537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300027565|Ga0209219_1004152 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
| 3300027587|Ga0209220_1199987 | Not Available | 507 | Open in IMG/M |
| 3300027842|Ga0209580_10455695 | Not Available | 637 | Open in IMG/M |
| 3300027846|Ga0209180_10132510 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300027846|Ga0209180_10475622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300027875|Ga0209283_10705218 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300027903|Ga0209488_10827299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027908|Ga0209006_11275695 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027915|Ga0209069_10108725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300028047|Ga0209526_10501067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300028047|Ga0209526_10729978 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300028536|Ga0137415_11119871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300028673|Ga0257175_1130488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300028828|Ga0307312_10551795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300028906|Ga0308309_11007145 | Not Available | 722 | Open in IMG/M |
| 3300030991|Ga0073994_11836677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300031090|Ga0265760_10365258 | Not Available | 518 | Open in IMG/M |
| 3300031232|Ga0302323_103463326 | Not Available | 502 | Open in IMG/M |
| 3300031716|Ga0310813_10014986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5135 | Open in IMG/M |
| 3300031823|Ga0307478_10983300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300032770|Ga0335085_10218949 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.77% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_02462930 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MKEDAKDAAKDSGMKKSNAEHGHLKPTDVQMIGDTCTK |
| JGI1027J11758_128146692 | 3300000789 | Soil | HNMKEDTKDMAQDTGMKKSNNEHGHLKATNVKMVSDSCSK* |
| JGI12635J15846_106051761 | 3300001593 | Forest Soil | AMHNMKEDTKDMAKDSGAKKDNSEHGHLTITDLKMVSETCGQ* |
| JGIcombinedJ26739_1014294251 | 3300002245 | Forest Soil | MKEDAKDAAKDSGMKKDDSEHGHLKITAVKMVSESCK* |
| JGIcombinedJ26739_1018280951 | 3300002245 | Forest Soil | MHNMKEDAKGAAKDSGMKKSDAEHGHTTITKVKMVSDSC* |
| Ga0066679_101278203 | 3300005176 | Soil | KMHNMKEDAKDVAKDTGAKKSNSEHGHLKVTNVKMVSDSCRE* |
| Ga0070714_1021270132 | 3300005435 | Agricultural Soil | AMAHNMKEDTKDMAHDTGATKENSEHGHLTVTHVKHVSDTCSK* |
| Ga0070713_1001720061 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NMKEDTKDMAHDTGAMKTNNEHGHLKVTHLKHVSDSCSK* |
| Ga0070711_1000245791 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | KMHNMKEDTKDMAHDSGVTKENNEHGHLKVTDVKMVSDSCSK* |
| Ga0070708_1003763943 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVVSNAKMHNMKEDAKEAAKDSGMKKSDAEHGHLTITEVKMVSDSCK* |
| Ga0066682_103041775 | 3300005450 | Soil | MHNMKEDAKDAAKDSGMKKSDAEHGHMKITDVKMVSESCK* |
| Ga0066681_103746591 | 3300005451 | Soil | NNKMHNLKEDAKDTAHDTGMKKDNREHGHLTVTDVQMVSSSCSQ* |
| Ga0070730_110451922 | 3300005537 | Surface Soil | VSHTKMHNMKEDAKDAAKDSGMAKNSTEHGHLTVTHVRMVGESCQQ* |
| Ga0068853_1004819711 | 3300005539 | Corn Rhizosphere | KMHNLKEDAKDAAHDTGVKKSNNEHGHLKATDVQMVSSSCSQ* |
| Ga0066703_103534721 | 3300005568 | Soil | MHNMKEDAKEAAKDSGMKKSDAEHGHLKVTDVKMVSDSCQK* |
| Ga0068854_1004859741 | 3300005578 | Corn Rhizosphere | AMHNMKEDTKDMAKDAGMKKSNTEHGHLKITDVKMVSDSCSK* |
| Ga0066706_106202561 | 3300005598 | Soil | AKEAAKDSGMKKSDAEHGHLKVTDVKMVSDSCQK* |
| Ga0066903_1073329131 | 3300005764 | Tropical Forest Soil | VSNETMHNMKEDVKGAVDKDSKEHGHLTVTAVKMVSESCK* |
| Ga0068860_1013277432 | 3300005843 | Switchgrass Rhizosphere | EHSTMHNMKEDTKDMAQDTGMKKSNNEHGHLKATNVKMVSDSCSK* |
| Ga0075024_1000942691 | 3300006047 | Watersheds | MMHNMKEDAKDAAKDSGMKKSGAEHGHMKITDVKMVSDSCQK* |
| Ga0075015_1006709291 | 3300006102 | Watersheds | ATMHNMKEDAKDAAKDSGATKTNHEHGHLTVTQVKMVSDSCK* |
| Ga0070716_1002716161 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NMKEDAKDAAKDSGMKKTNAEHGHMTVTDLKMVSESCQ* |
| Ga0070712_1013954112 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGVVSNATMHNMKEDAKDAAKDSGMTKSDNEHGHLKVTAVKMVSESCK* |
| Ga0070765_1015136541 | 3300006176 | Soil | HNMKEDAKDAAKDSGMKKDDSEHGHLKVTAVKMVSESCK* |
| Ga0066658_103577422 | 3300006794 | Soil | LHNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK* |
| Ga0073928_100437717 | 3300006893 | Iron-Sulfur Acid Spring | HNMKEDTKDLAKDSGAKKDNSEHGHLTITDLTMVSETCGH* |
| Ga0073928_101506801 | 3300006893 | Iron-Sulfur Acid Spring | EDTKDLAKDSGAKKDNSEHGHLTITDLKMVSETCGQ* |
| Ga0102924_13227333 | 3300007982 | Iron-Sulfur Acid Spring | STMHNMKEDTKDLAKDSGAKKDNSEHGHLTITDLTMVSETCGH* |
| Ga0099829_100954811 | 3300009038 | Vadose Zone Soil | HNMKEDAKETAKDSGMKKSDAEHGHMTITDVKMVSESCK* |
| Ga0099829_104918242 | 3300009038 | Vadose Zone Soil | VVSNAKMHNMKEDAKEAAKDSGMKKSDGEHGHLKVTEVKMVSDSCK* |
| Ga0099830_110483641 | 3300009088 | Vadose Zone Soil | GVVSNAKMHNMKEDAKETAKDSGMKKSDTEHGHMTITDVKMVSESCK* |
| Ga0099828_102301021 | 3300009089 | Vadose Zone Soil | VSHAKMHNMKEDVKEAAKDSGMKKSDTEHGHMKITDVKMVSDSCQK* |
| Ga0105250_103303681 | 3300009092 | Switchgrass Rhizosphere | NLKEDAKDAAKDSGMTKANNEHGHLTVTEVKMVSESCQ* |
| Ga0105243_107283972 | 3300009148 | Miscanthus Rhizosphere | TAAMHNMKEDAKDAAHDAGMKDKNTEHGHLQITDVKMVSDSCTK* |
| Ga0105241_119950311 | 3300009174 | Corn Rhizosphere | HNMKEDAKDAAKDSGMKKTNHEHGHITVTDVKMVSESCN* |
| Ga0105249_119143541 | 3300009553 | Switchgrass Rhizosphere | KMHNMKEDAKDAAKDSGMTKSDNEHGHLKVTDVKMVSESCQK* |
| Ga0126380_117818192 | 3300010043 | Tropical Forest Soil | AHNMKEDTKHAMADTHMKKDNREHGDLKVTDLSMVSSSCK* |
| Ga0126380_119092141 | 3300010043 | Tropical Forest Soil | MTGVVSNSTMHNMKEDAKTTVNKNSAEHGSLTVTAVQMVSESCK* |
| Ga0126382_109596642 | 3300010047 | Tropical Forest Soil | VKNSTAHNLKEDAKDAASDAHMKKDNSEHGHLTITDVKMVDESCKQ* |
| Ga0134084_101848672 | 3300010322 | Grasslands Soil | KLHNMKEDTKEMAKDTGMKKSDAEHGHMKITAVKMVSDSCQK* |
| Ga0134063_100564561 | 3300010335 | Grasslands Soil | NMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK* |
| Ga0134071_100724653 | 3300010336 | Grasslands Soil | KLHNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK* |
| Ga0126372_132670401 | 3300010360 | Tropical Forest Soil | AHNVKEDAKDVAHDTGMKKDNSEHGHLKVTDVQMVSTSCSQ* |
| Ga0134066_103155701 | 3300010364 | Grasslands Soil | EDAKEAAKDSGMKKSDAEHGHLTVTEVKMVSDSCK* |
| Ga0105239_103602441 | 3300010375 | Corn Rhizosphere | DAKDAAKDSGMKKTNEEHGHLTVTQVKMVSESCN* |
| Ga0105239_129609451 | 3300010375 | Corn Rhizosphere | NATAHNLKEDAKDAAKDSGMTKANNEHGHLTVTEVKMVSESCQ* |
| Ga0105246_104558572 | 3300011119 | Miscanthus Rhizosphere | EDAKDAAKDSGMTKSDNEHGHLKVTDVKMVSESCQK* |
| Ga0150983_145354291 | 3300011120 | Forest Soil | AKETAKDTGVTKDDKEHGHLTITAIKMVSESCKY* |
| Ga0137389_100896081 | 3300012096 | Vadose Zone Soil | EDAKDAAKDSGMTKSDNEHGHLKVTAVKMVSESCK* |
| Ga0137364_112809031 | 3300012198 | Vadose Zone Soil | MHNMKEDVKEAAKDSGMKKSDSEHGHMKITSVKMVSDSCQK* |
| Ga0137363_103776973 | 3300012202 | Vadose Zone Soil | VVSNAKMHNMKEDAKETAKDSGMKKSNTEHGHTKITDVKIVSESYK* |
| Ga0137362_108919062 | 3300012205 | Vadose Zone Soil | NATAHNMKEDAKDAAKDSGMKKSDAEHGHMKITDIKMVSESCQK* |
| Ga0137386_102370354 | 3300012351 | Vadose Zone Soil | ATGVVSHAKMHNMKEDAKEAAKDSGMKKSDTEHGHLTITDVKMVSESCK* |
| Ga0137367_105023591 | 3300012353 | Vadose Zone Soil | TKEMAKDSGMKKSNNEHGHLKVTDVKKLSDTCQQ* |
| Ga0137360_100341111 | 3300012361 | Vadose Zone Soil | TGVVSNATMHNMKEDAKEAAKDSGMKKTDNEHGHLKVTAVQMVSDSCK* |
| Ga0137361_111451602 | 3300012362 | Vadose Zone Soil | TGVVSNAKMHNMKEDAKETAKDSGMKKSDAEHGHMTITDVKMVSESCK* |
| Ga0137390_104779921 | 3300012363 | Vadose Zone Soil | ATGVVSHAKMHNMKEDAKEAAKDSGMKKSDTEHGHMKITDEKMVRDSCKK* |
| Ga0137394_109808422 | 3300012922 | Vadose Zone Soil | GHTVTATGVISNATMDNMKEDAKEAAKDSGMKKTDNEHGHLKVTAVQMVSDSCK* |
| Ga0137416_117275912 | 3300012927 | Vadose Zone Soil | VVSHAKLHNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK* |
| Ga0137416_120713401 | 3300012927 | Vadose Zone Soil | SNATAHNMKEDTKDMAHDTGMKKDNREHGHLKVTDVQMVSESCK* |
| Ga0137416_121087411 | 3300012927 | Vadose Zone Soil | NMKEDAKDAAKDSGMKKDSSEHGHLKVTDVTLVSDSCQK* |
| Ga0137404_106570521 | 3300012929 | Vadose Zone Soil | MHNMKEDAKDAAKESGMTKTNNEHGHLTVTQVKMVSDSCQ* |
| Ga0137407_103112741 | 3300012930 | Vadose Zone Soil | MHNMKEDAKETAKDSGMKKSNAEHGHVKITDVKMVSESYK* |
| Ga0137407_111372371 | 3300012930 | Vadose Zone Soil | AKMHNMKEDAKDAAKDSGMKKSDAEHGHLTVTEVKMISDSCK* |
| Ga0137410_119498101 | 3300012944 | Vadose Zone Soil | HNMKEDAKDAAKDSGMKKSDAEHGHMKITDIKMVSESCQK* |
| Ga0157374_111799671 | 3300013296 | Miscanthus Rhizosphere | HNLKEDAKDAAKDSGMKKSNTEHGHLKVTDVKMVSNSCK* |
| Ga0163162_119050001 | 3300013306 | Switchgrass Rhizosphere | HNMKEDAKDAAQDAGMKKDNKEHGHMEITDVKMVSDSCSK* |
| Ga0157375_103828821 | 3300013308 | Miscanthus Rhizosphere | DAKDAAKDSGMTKSDNEHGHLKVTDVKMVSESCQK* |
| Ga0134075_100154401 | 3300014154 | Grasslands Soil | KLHNMKEDTKDMAKDTGMKKSDAEHGHMKITAVKMVSDSCQK* |
| Ga0163163_104387031 | 3300014325 | Switchgrass Rhizosphere | KEDAKDAAKDSGMTKSDNEHGHLKVTDVKMVSESCQK* |
| Ga0182024_111563921 | 3300014501 | Permafrost | LHNLKEDTKEAATDSGMKKADSEHGHLTITEVKMVSDSCQK* |
| Ga0167661_10456401 | 3300015167 | Glacier Forefield Soil | GVVSNAKMHNMKEDAKEAAKDSGVKKSDAEHGHMKITSVKMVSDSCQK* |
| Ga0137403_101271161 | 3300015264 | Vadose Zone Soil | HAKMHNMKEDAQEAAKDSGMKKSNPEHGHLTITDVKMVSESCK* |
| Ga0187824_100229863 | 3300017927 | Freshwater Sediment | SNAKMHNMKEDAKDAAKDSGMKKSDNEHGHLKVTEVKMVSDSCK |
| Ga0187825_103052762 | 3300017930 | Freshwater Sediment | VVRNAMAHNMKEDAKDAAADADLKKDNSEHGHLTVTRLKMVSESCGK |
| Ga0193735_10021041 | 3300020006 | Soil | MHNMKEDAKEAAKDSGMKKSDAEHGHLTVTEIKMVSDSCKWSINV |
| Ga0193735_11302452 | 3300020006 | Soil | VSNATMHNMKEDAKDAAKDSGMKKSDAEHGHMKITDVKMVSESCK |
| Ga0179594_103727492 | 3300020170 | Vadose Zone Soil | KEDAKETAKDSGMKKSNAEHGHMKITDVKMVSKSCK |
| Ga0210407_114118312 | 3300020579 | Soil | NATAHNMKEDAKDAAKDSGMKKDNSEHGHLTVTQVKMVSESCN |
| Ga0210399_101685452 | 3300020581 | Soil | HNMKEDAKDAAKDSGMKKDDSEHGHLKVTAVKMVSESCK |
| Ga0210401_104750012 | 3300020583 | Soil | KEDAKDAAKDSGMKKDNSEHGHLTVTQIKMVSESCN |
| Ga0210404_102956911 | 3300021088 | Soil | HNLKEDAKDAAKDTGVKKTDTEHGHLTITSMKMVGESCK |
| Ga0210400_111811731 | 3300021170 | Soil | NMKEDAKDAAKDSGMKKNGAEHGHLKVTDVRMIGESCQQ |
| Ga0210400_113776731 | 3300021170 | Soil | SNATMHNMKEDTKDMAKDSGMKKSNTEHGHMKITDLKMVSESCK |
| Ga0193719_100713121 | 3300021344 | Soil | GVVSNAKMHNMKEDAKDAAKDSGMTKSNEEYGHLKVTDVKMVSDSCQQ |
| Ga0193719_102427551 | 3300021344 | Soil | HNMKEDAKDAAKDSGATKTNDEHGHLKITAVKMVSDSCK |
| Ga0210402_101346223 | 3300021478 | Soil | MHNLKEDTKDMAKDSGVKKDNSEHGHMKITDLKMVSDSCQK |
| Ga0210410_107355931 | 3300021479 | Soil | LKEDAKETAKDTGVTKDDKEHGHLTITAIKMVSESCKY |
| Ga0126371_137377931 | 3300021560 | Tropical Forest Soil | KEDAKDMSDDIGVKKNNAEHGHMKITDLQMVSHSCSQ |
| Ga0209171_100200687 | 3300025320 | Iron-Sulfur Acid Spring | GVVSNSTMHNMKEDTKDLAKDSGAKKDNSEHGHLTITDLTMVSETCGH |
| Ga0207656_103864112 | 3300025321 | Corn Rhizosphere | HNLKEDTKDVAKDAHMSKSNSEHGHMKITDVQMVSSSCSK |
| Ga0207682_106362241 | 3300025893 | Miscanthus Rhizosphere | LKEDAKDAAHDTGVKKSNNEHGHLKATDVQMVSSSCSQ |
| Ga0207710_105474303 | 3300025900 | Switchgrass Rhizosphere | DAKDAAKDSGMTKSNEEHGHLKVTDVKMVSDSCQQ |
| Ga0207684_102965691 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TKEDTKDMAHDTGMKKDNSEHGALTVTDVQMVSDSCQK |
| Ga0207663_116789572 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAKDAAKDSGMKKTNDEHGHLTVTQVKMVSESCN |
| Ga0207651_120853392 | 3300025960 | Switchgrass Rhizosphere | VSNAGMHNLKEDAKDAAHDTGVKKSNNEHGHLKATEVQMVSTSCSQ |
| Ga0207702_102447811 | 3300026078 | Corn Rhizosphere | MHNMKEDAKDAAKDSGMTKSDNEHGHLKVTDVKMVSESCQK |
| Ga0209863_100121311 | 3300026281 | Prmafrost Soil | HNIKEDAKDAAKDSGMKKSDTEHGHMKITDVKMVSDSCK |
| Ga0209265_11368872 | 3300026308 | Soil | HARLHNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK |
| Ga0209472_10455741 | 3300026323 | Soil | KEDTKEMAKDTGMKKSDAEHGHMKITAVKMVSDSCQK |
| Ga0209152_102125712 | 3300026325 | Soil | NLKEDAKDTAHDTGMKKDNREHGHLTVTDVQMVSSSCSQ |
| Ga0209801_12080692 | 3300026326 | Soil | HAKLHNMKEDTKEMAKDTGMKKSDAEHGHMKITAVKMVSDSCQK |
| Ga0209802_12016892 | 3300026328 | Soil | HNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK |
| Ga0257171_10539261 | 3300026377 | Soil | AKMHNMKEDAKEAAKDSGMKKSDTEHGHLTITDVKMVSESCK |
| Ga0209808_10657473 | 3300026523 | Soil | NMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK |
| Ga0209806_12795993 | 3300026529 | Soil | HAKMHNMKEDAKEAAKDSGMKKSDAEHGHLKVTDVKMVSDSCQK |
| Ga0179587_105180592 | 3300026557 | Vadose Zone Soil | KEDTKDMAKDSGLKKDNSEHGHLRVTDLKMVSDSCGK |
| Ga0209523_10375372 | 3300027548 | Forest Soil | KEDAKTAATDSGVKKNDNEHGHLKVTGLKMVSESCK |
| Ga0209219_10041521 | 3300027565 | Forest Soil | GVVSNAKMHNMKEDAKETAKDSGMKKSDTEHGHMKITDVKMVSDSCQK |
| Ga0209220_11999871 | 3300027587 | Forest Soil | HNMKEDAKDTAKDAGANNSTREHGHLTITSMKMVGESCRY |
| Ga0209580_104556952 | 3300027842 | Surface Soil | NAKMHNLKEDAKDAAKDTGMKKDNKEHGHLKITDVQTVSESCQR |
| Ga0209180_101325102 | 3300027846 | Vadose Zone Soil | TATGVVSHAKMHNMKEDAKEAAKDSGMKKSDTEHGHMTITDVKMVSESCK |
| Ga0209180_104756222 | 3300027846 | Vadose Zone Soil | HAKLHNMKEDTKEMAKDTGMKKSDTEHGHMKITAVKMVSDSCQK |
| Ga0209283_107052182 | 3300027875 | Vadose Zone Soil | MHNMKEDAKEAAKDSGMKKSDAEHGHMTITDVKMVSESCK |
| Ga0209488_108272991 | 3300027903 | Vadose Zone Soil | GVVSNATMHNMKEDAKGAAKDSGMTKSDNEHGHLKVTAVKMVSESCK |
| Ga0209006_112756952 | 3300027908 | Forest Soil | KMHNLKEDAKDAAKDSGMKKSNTEHGHLEVTDVRSVSASCQK |
| Ga0209069_101087251 | 3300027915 | Watersheds | MMHNMKEDAKDAAKDSGMKKSGAEHGHMKITDVKMVSDSCQK |
| Ga0209526_105010672 | 3300028047 | Forest Soil | MHNMKEDAKGAAKDSGMKKSDAEHGHTTITKVKMVSDSC |
| Ga0209526_107299782 | 3300028047 | Forest Soil | VVSNAKMHNMKEDAKEAAKDSGMKKSDDEHGHMKVTEVKMVSDSCQK |
| Ga0137415_111198712 | 3300028536 | Vadose Zone Soil | TGVVSNAKMHNMKEDTKEMAKDSGMKKSDAEHGHLKATDVKMVSDSCK |
| Ga0257175_11304881 | 3300028673 | Soil | KEDAKEAAKDSGMKKSDAEHGHLTVTEVKMVSDSCK |
| Ga0307312_105517951 | 3300028828 | Soil | KEDAKDAAKDSGMKKSDSERGHMKITDVKMVSESCQK |
| Ga0308309_110071451 | 3300028906 | Soil | SNATMHNMKEDAKDAAKDSGMKKDDSEHGHLKVTAVKMVSESCK |
| Ga0073994_118366771 | 3300030991 | Soil | HNLKEDAKDTATDAGVKKDNREHGHLTITSIKMVSESCKY |
| Ga0265760_103652581 | 3300031090 | Soil | NLKEDAKDAAKDSGMKKDNSEHGHLTITAVKMVSDSCQK |
| Ga0302323_1034633261 | 3300031232 | Fen | TVTATGVVANPAMHNMKEDAKNTVDKDSMEHGHLTVTAVKMVSESCK |
| Ga0310813_100149861 | 3300031716 | Soil | STAHNMKEDTKDMAHDTGMKKDNSEHGTLKVTDVQMVSDSCQK |
| Ga0307478_109833001 | 3300031823 | Hardwood Forest Soil | AKGVVSHAKMHNLKEDTKDAAKDSGMKKTSTEHGHLKVTDVHMVGDSCQK |
| Ga0335085_102189494 | 3300032770 | Soil | DAKDAAKDSGMKKSNNEHGHLEVTDVRSVSASCQK |
| Ga0335069_117635632 | 3300032893 | Soil | KMHNMKEDSKNVASDAGVKKNNAEHGHLTITDLHMISESCQR |
| ⦗Top⦘ |