


| Basic Information | |
|---|---|
| Family ID | F062976 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 93.08 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 0.00% Coil/Unstructured: 89.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF12543 | DUF3738 | 3.85 |
| PF13564 | DoxX_2 | 2.31 |
| PF08818 | DUF1801 | 2.31 |
| PF03551 | PadR | 1.54 |
| PF00282 | Pyridoxal_deC | 1.54 |
| PF00903 | Glyoxalase | 1.54 |
| PF00589 | Phage_integrase | 1.54 |
| PF01904 | DUF72 | 1.54 |
| PF13683 | rve_3 | 1.54 |
| PF00069 | Pkinase | 1.54 |
| PF02861 | Clp_N | 1.54 |
| PF06439 | 3keto-disac_hyd | 1.54 |
| PF13857 | Ank_5 | 0.77 |
| PF01979 | Amidohydro_1 | 0.77 |
| PF11954 | DUF3471 | 0.77 |
| PF02775 | TPP_enzyme_C | 0.77 |
| PF01019 | G_glu_transpept | 0.77 |
| PF00155 | Aminotran_1_2 | 0.77 |
| PF01817 | CM_2 | 0.77 |
| PF07992 | Pyr_redox_2 | 0.77 |
| PF07705 | CARDB | 0.77 |
| PF00665 | rve | 0.77 |
| PF01842 | ACT | 0.77 |
| PF00924 | MS_channel | 0.77 |
| PF01722 | BolA | 0.77 |
| PF02527 | GidB | 0.77 |
| PF08327 | AHSA1 | 0.77 |
| PF13333 | rve_2 | 0.77 |
| PF07969 | Amidohydro_3 | 0.77 |
| PF07995 | GSDH | 0.77 |
| PF01183 | Glyco_hydro_25 | 0.77 |
| PF00239 | Resolvase | 0.77 |
| PF13185 | GAF_2 | 0.77 |
| PF01381 | HTH_3 | 0.77 |
| PF00091 | Tubulin | 0.77 |
| PF04909 | Amidohydro_2 | 0.77 |
| PF05195 | AMP_N | 0.77 |
| PF12681 | Glyoxalase_2 | 0.77 |
| PF14329 | DUF4386 | 0.77 |
| PF13424 | TPR_12 | 0.77 |
| PF00753 | Lactamase_B | 0.77 |
| PF00690 | Cation_ATPase_N | 0.77 |
| PF00933 | Glyco_hydro_3 | 0.77 |
| PF03972 | MmgE_PrpD | 0.77 |
| PF02687 | FtsX | 0.77 |
| PF00881 | Nitroreductase | 0.77 |
| PF00368 | HMG-CoA_red | 0.77 |
| PF07690 | MFS_1 | 0.77 |
| PF00291 | PALP | 0.77 |
| PF08240 | ADH_N | 0.77 |
| PF01988 | VIT1 | 0.77 |
| PF00884 | Sulfatase | 0.77 |
| PF03928 | HbpS-like | 0.77 |
| PF02894 | GFO_IDH_MocA_C | 0.77 |
| PF07366 | SnoaL | 0.77 |
| PF02518 | HATPase_c | 0.77 |
| PF08897 | DUF1841 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.15 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.31 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.31 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.31 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.54 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.54 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.54 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.54 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.54 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.54 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.77 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.77 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.77 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.77 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.77 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.77 |
| COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 0.77 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.77 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.77 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.77 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.77 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.77 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.77 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.77 % |
| Unclassified | root | N/A | 9.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_110504250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300001593|JGI12635J15846_10210673 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100283906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300002914|JGI25617J43924_10025174 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300003432|JGI20214J51088_10655684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300005289|Ga0065704_10822709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300005295|Ga0065707_10893221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300005455|Ga0070663_101319212 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005541|Ga0070733_11071819 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005577|Ga0068857_100784340 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005591|Ga0070761_10509681 | Not Available | 743 | Open in IMG/M |
| 3300005617|Ga0068859_102875813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005764|Ga0066903_100480756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
| 3300005841|Ga0068863_100318432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300006031|Ga0066651_10617306 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006174|Ga0075014_101018621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300006844|Ga0075428_101527665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300006954|Ga0079219_11186427 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009098|Ga0105245_10225275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300009098|Ga0105245_11443790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300009100|Ga0075418_10207007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2089 | Open in IMG/M |
| 3300009137|Ga0066709_100309536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2150 | Open in IMG/M |
| 3300009137|Ga0066709_100743681 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300009137|Ga0066709_104312595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009156|Ga0111538_11883628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300009162|Ga0075423_10520121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300009174|Ga0105241_10195904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
| 3300009174|Ga0105241_10401053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1203 | Open in IMG/M |
| 3300009174|Ga0105241_11664818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300009551|Ga0105238_11897498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009792|Ga0126374_11335386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010048|Ga0126373_11099596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300010359|Ga0126376_10498826 | Not Available | 1126 | Open in IMG/M |
| 3300010362|Ga0126377_11221873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300010366|Ga0126379_11165987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300010371|Ga0134125_10140710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2687 | Open in IMG/M |
| 3300010373|Ga0134128_11492215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 744 | Open in IMG/M |
| 3300010376|Ga0126381_100204882 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300010397|Ga0134124_10518043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300010398|Ga0126383_12033876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300010401|Ga0134121_11335434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300010401|Ga0134121_13046013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300011269|Ga0137392_10428892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300011270|Ga0137391_11127651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012171|Ga0137342_1001316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3264 | Open in IMG/M |
| 3300012198|Ga0137364_10285156 | Not Available | 1224 | Open in IMG/M |
| 3300012202|Ga0137363_10251549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300012205|Ga0137362_11210487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012208|Ga0137376_11140475 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012209|Ga0137379_10899306 | Not Available | 790 | Open in IMG/M |
| 3300012211|Ga0137377_10622624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300012355|Ga0137369_10832419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012362|Ga0137361_11319570 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012582|Ga0137358_10214540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300012923|Ga0137359_11548633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012944|Ga0137410_10470572 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300013105|Ga0157369_11469249 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300014160|Ga0181517_10602037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300014169|Ga0181531_10238378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300014325|Ga0163163_11458874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300014655|Ga0181516_10483161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300014968|Ga0157379_10009171 | All Organisms → cellular organisms → Bacteria | 8619 | Open in IMG/M |
| 3300014969|Ga0157376_11507390 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014969|Ga0157376_11549441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300015245|Ga0137409_10766017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300015374|Ga0132255_105928141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300016270|Ga0182036_10914969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300016387|Ga0182040_10441846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300016702|Ga0181511_1435363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300017821|Ga0187812_1130423 | Not Available | 813 | Open in IMG/M |
| 3300017970|Ga0187783_10658632 | Not Available | 756 | Open in IMG/M |
| 3300018033|Ga0187867_10422484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 737 | Open in IMG/M |
| 3300018035|Ga0187875_10568311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300018038|Ga0187855_10917161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300018043|Ga0187887_10055358 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300018043|Ga0187887_10755940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300018044|Ga0187890_10193748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1154 | Open in IMG/M |
| 3300018047|Ga0187859_10718457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300018057|Ga0187858_10746907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300018062|Ga0187784_10848099 | Not Available | 728 | Open in IMG/M |
| 3300018476|Ga0190274_11625653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300019787|Ga0182031_1138223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
| 3300021081|Ga0210379_10067130 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300021168|Ga0210406_10073033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2947 | Open in IMG/M |
| 3300021406|Ga0210386_10598132 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300021475|Ga0210392_10096284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1937 | Open in IMG/M |
| 3300021479|Ga0210410_10054978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3472 | Open in IMG/M |
| 3300021479|Ga0210410_11208858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300021560|Ga0126371_12228769 | Not Available | 661 | Open in IMG/M |
| 3300024055|Ga0247794_10281612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300025414|Ga0208935_1005141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1871 | Open in IMG/M |
| 3300025612|Ga0208691_1003880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4568 | Open in IMG/M |
| 3300025901|Ga0207688_10815942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
| 3300025918|Ga0207662_11133440 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025919|Ga0207657_10533618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300025927|Ga0207687_11634175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300025928|Ga0207700_10177687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1780 | Open in IMG/M |
| 3300025936|Ga0207670_10693854 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026067|Ga0207678_11380683 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026088|Ga0207641_10878754 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300026551|Ga0209648_10057976 | Not Available | 3293 | Open in IMG/M |
| 3300027110|Ga0208488_1012570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300027692|Ga0209530_1062969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300027909|Ga0209382_11805084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300028381|Ga0268264_10186327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1888 | Open in IMG/M |
| 3300028801|Ga0302226_10084629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1432 | Open in IMG/M |
| 3300029907|Ga0311329_10138857 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300029943|Ga0311340_11385750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 556 | Open in IMG/M |
| 3300029951|Ga0311371_10695550 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300029999|Ga0311339_11907563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → Pyxidicoccus caerfyrddinensis | 512 | Open in IMG/M |
| 3300030007|Ga0311338_10387893 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300030399|Ga0311353_11385581 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031231|Ga0170824_110108199 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031233|Ga0302307_10361314 | Not Available | 740 | Open in IMG/M |
| 3300031474|Ga0170818_115634126 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300031547|Ga0310887_10071506 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300031680|Ga0318574_10661866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300031708|Ga0310686_101817369 | Not Available | 900 | Open in IMG/M |
| 3300031708|Ga0310686_104016260 | Not Available | 4072 | Open in IMG/M |
| 3300031908|Ga0310900_11373303 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 593 | Open in IMG/M |
| 3300032012|Ga0310902_10608230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 727 | Open in IMG/M |
| 3300032074|Ga0308173_11274453 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032122|Ga0310895_10210805 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032174|Ga0307470_10203541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300032892|Ga0335081_10723846 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1203 | Open in IMG/M |
| 3300032897|Ga0335071_11630719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300033402|Ga0326728_10703261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300033405|Ga0326727_10115081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3418 | Open in IMG/M |
| 3300033977|Ga0314861_0307719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300034091|Ga0326724_0506015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.15% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.08% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.31% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.77% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.77% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1105042501 | 3300000956 | Soil | TIFTVLRKLGLELRQQRATVPVYTVEHIERPATD* |
| JGI12635J15846_102106731 | 3300001593 | Forest Soil | NMNFASLPTIFTVLGKLGLELHRQEEILLVYTVERIERPSVN* |
| JGIcombinedJ26739_1002839064 | 3300002245 | Forest Soil | PNAIPAVNSFAGLPTIFTVLGKLGLELKRQEDILPGYTVERIERPAAN* |
| JGI25617J43924_100251741 | 3300002914 | Grasslands Soil | VNSFAGLPTIFTVQGKLGLELKRQEDILPVYTVERIERPAAN* |
| JGI20214J51088_106556841 | 3300003432 | Wetland | ATGFADLPTIFTVLRKLGLELKQQEATVPVYTVQRIERPAGALQ* |
| Ga0065704_108227091 | 3300005289 | Switchgrass Rhizosphere | RFDDLPTIFAVLRKLGLELKKQEARVPVYTVEHIERPRG* |
| Ga0065707_108932212 | 3300005295 | Switchgrass Rhizosphere | PNFDDLPTIFTVLGKLGLELKQQEAAVPVYTVEHIERPAAE* |
| Ga0070663_1013192121 | 3300005455 | Corn Rhizosphere | NAFATLPTIFSVLGKLGLELKQQEDILPVYTVEHIERPNEMG* |
| Ga0070733_110718191 | 3300005541 | Surface Soil | TIFTVLGKLGLELKRQEEVLPVYTVERIERPAAN* |
| Ga0068857_1007843403 | 3300005577 | Corn Rhizosphere | PNSTPDVNAFAGLPTIFSVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0070761_105096811 | 3300005591 | Soil | ALPPIFTVLGKLGLELKPQEATLPVYTVERIECPAAN* |
| Ga0068859_1028758131 | 3300005617 | Switchgrass Rhizosphere | PTIFSVLGKLGLELKRQEDILPVYVVERIERPTAN* |
| Ga0066903_1004807561 | 3300005764 | Tropical Forest Soil | VNHFAGLPTIFTVLSKLGLELNRQEDILPVYTVERIERPATN* |
| Ga0068863_1003184322 | 3300005841 | Switchgrass Rhizosphere | PTIFTVLRTLGLELKQQEATVPVYTVEHIERPAGE* |
| Ga0066651_106173062 | 3300006031 | Soil | DDLPTIFTVLGTLGLELKQQTATVPFYTVEHIERPPVPNP* |
| Ga0075014_1010186211 | 3300006174 | Watersheds | NPFAGLPTIFTVLGKLGLELKRQEDTLPVYTVERIERPAAN* |
| Ga0075428_1015276651 | 3300006844 | Populus Rhizosphere | PTIFTVLRKLGLELKQQEATVPVYTVEHLERPAGE* |
| Ga0079219_111864273 | 3300006954 | Agricultural Soil | LPTIFTVLRKLGLELKRQEDILAVYTVERIERPSVN* |
| Ga0105245_102252752 | 3300009098 | Miscanthus Rhizosphere | TRDMSGFAGLPTIFTVLGKLGLELKRQENSLPVYTVERIERPAAN* |
| Ga0105245_114437901 | 3300009098 | Miscanthus Rhizosphere | GNPFAGLPTIFAVLGKLGLELKQQEEILPVYTVERIERPTLN* |
| Ga0075418_102070071 | 3300009100 | Populus Rhizosphere | PPARFDDLPTIFTVLSKLGLELKQQEATVPVYTVEHIERPAGE* |
| Ga0066709_1003095361 | 3300009137 | Grasslands Soil | ATPAVNPFAGLPTIFAVLSKLGLELKRQEDILPVYNVERIERPAAN* |
| Ga0066709_1007436811 | 3300009137 | Grasslands Soil | PPNAAPAGNPFAGLPTIFTVLDKLGLELKRQEDILPVYTAERIERPAAN* |
| Ga0066709_1043125951 | 3300009137 | Grasslands Soil | PTIFTVLRKLGLELKQQEATVPVYTVKHIERPAGE* |
| Ga0111538_118836282 | 3300009156 | Populus Rhizosphere | FPQAPNFDDLPTIFTVLGKLGLELKQQEAAVPVYMVEHIERPAAE* |
| Ga0075423_105201212 | 3300009162 | Populus Rhizosphere | FPQAPNFDDLPTIFTVLGKLGLELKQQEAAVPVYTVEHIERPAAE* |
| Ga0105241_101959043 | 3300009174 | Corn Rhizosphere | MSGFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0105241_104010532 | 3300009174 | Corn Rhizosphere | SGFAGLPTIFTVLGKLGLELKRQENSLPVYTVERIERPAAN* |
| Ga0105241_116648181 | 3300009174 | Corn Rhizosphere | MSGFAGLPTIFTVLGKLGLELKRHEDILPVYTVERIERPAAN* |
| Ga0105238_118974981 | 3300009551 | Corn Rhizosphere | TRDMSGFAGLPTIFSVLGKLGLELKRQEDILPVYTVERIERPPAN* |
| Ga0126374_113353862 | 3300009792 | Tropical Forest Soil | NAFAGLPTIFSVLGKLGLELKPEEDVLPVYTVEHIERPTTN* |
| Ga0126373_110995962 | 3300010048 | Tropical Forest Soil | VAKPFAGLPTIFTVLGKLGLELKQHEDTLPVYTVEHIERPGN* |
| Ga0126376_104988261 | 3300010359 | Tropical Forest Soil | EVNPFANLPTVFEILGKFGPQLNQQQDILPVYAAERIERPALN* |
| Ga0126377_112218732 | 3300010362 | Tropical Forest Soil | VRFDDLPTIFTVLRKLGLELKQQEATVPLYTVQHIERPAAE* |
| Ga0126379_111659872 | 3300010366 | Tropical Forest Soil | DVNAFAGLPTIFSVLDKLGLELKRQEETLPIYTVERIERPVDN* |
| Ga0134125_101407101 | 3300010371 | Terrestrial Soil | TIFTVLSRLGLELRRQEQILPVYTVEHIERPTTN* |
| Ga0134128_114922151 | 3300010373 | Terrestrial Soil | FAGLPTIFTVLGKLGLGLTRQEATLPVYTVEHIERPAFNQQ* |
| Ga0126381_1002048821 | 3300010376 | Tropical Forest Soil | FSAYGGNPFGGLPTLFTVLGQLGLELRRQEDVLPVYTVERIERPKAN* |
| Ga0134124_105180431 | 3300010397 | Terrestrial Soil | PTIFTVLGKLGLELKQQEATVPVYTVEHIERPAVE* |
| Ga0126383_120338762 | 3300010398 | Tropical Forest Soil | AMRFDDLPTIFTVLRALGLELKQQTATVPVYTVEHIERPAAE* |
| Ga0134121_113354342 | 3300010401 | Terrestrial Soil | PFAGLPTVFTVLERLGLELKREEGVLPVYTVERIERPTAN* |
| Ga0134121_130460131 | 3300010401 | Terrestrial Soil | TIFSVLGKLGLELKRQEDILPVYTVERIERPPANWR* |
| Ga0137392_104288922 | 3300011269 | Vadose Zone Soil | GLPTIFTVLSKLGLALNRQQDILPVYTVEHIERPAAN* |
| Ga0137391_111276511 | 3300011270 | Vadose Zone Soil | PFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0137342_10013161 | 3300012171 | Soil | LPTIFTVLRKLGLELKQQEATVPVYTVEHIERPPGE* |
| Ga0137364_102851561 | 3300012198 | Vadose Zone Soil | TIFAVLGKLGLELKRQEDILPVYNVERIERPAAN* |
| Ga0137363_102515491 | 3300012202 | Vadose Zone Soil | NHFAGLPTIFTVLSKLGLELNRQQDILPIYAVKRIERPAAN* |
| Ga0137362_112104871 | 3300012205 | Vadose Zone Soil | NATPAANPFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0137376_111404752 | 3300012208 | Vadose Zone Soil | FAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0137379_108993062 | 3300012209 | Vadose Zone Soil | TIFTVLRKLGLEMKRQEDILPVYTVERIERPAAN* |
| Ga0137377_106226242 | 3300012211 | Vadose Zone Soil | VNSFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0137369_108324191 | 3300012355 | Vadose Zone Soil | DLPTIFTVLGKLGLELKQQEAAVPVYTVEHIERPAAE* |
| Ga0137361_113195702 | 3300012362 | Vadose Zone Soil | PTIFTVLSKLGLELNRQQDILPIYTVKRIERPATN* |
| Ga0137358_102145401 | 3300012582 | Vadose Zone Soil | ISLVPTIFTVLSKLGLELNRQQDILPIYTVKRIELPATN* |
| Ga0137359_115486332 | 3300012923 | Vadose Zone Soil | VNPFAGLPTIFTVLGKLGLELKRQEDTLPVYTVERIERPATN* |
| Ga0137410_104705722 | 3300012944 | Vadose Zone Soil | AGLPTIFAVLGNLGLELKRQEDILPVYTVERIERPAAN* |
| Ga0157369_114692491 | 3300013105 | Corn Rhizosphere | AANPFAGLPTIFTVLDKLGLELKRQEEILPVYTVEHIERPIPN* |
| Ga0181517_106020371 | 3300014160 | Bog | TIFTVLGKLGLELNRQEDILPVYTVERIERPAAN* |
| Ga0181531_102383781 | 3300014169 | Bog | LPTIFEVLDKFGLELKRQEDVLPVYTVERVERPPSN* |
| Ga0163163_114588741 | 3300014325 | Switchgrass Rhizosphere | STIFSVLGKLGLELKRQEDILPVYTVEPIERPTAN* |
| Ga0181516_104831612 | 3300014655 | Bog | FAGLPTIFTVLGKLGLELKRQEDTLPIYTAESIERPAAN* |
| Ga0157379_1000917114 | 3300014968 | Switchgrass Rhizosphere | FAGLPTIFSVLGKLGLELKRQEDILPVYTVERIERPPAN* |
| Ga0157376_115073902 | 3300014969 | Miscanthus Rhizosphere | MSTPDANAFATLPTIFSVLGKLGLELKQQEDILPVYTVEHIERPNEMG* |
| Ga0157376_115494411 | 3300014969 | Miscanthus Rhizosphere | PHSITPAANPFAGLPTIFTVLSKLGLELKRQEDILPVYTVERIERPTAN* |
| Ga0137409_107660171 | 3300015245 | Vadose Zone Soil | ANAFASLPTIFSVLGKLGLDLKRQEDILPVYTVERIERPNLP* |
| Ga0132255_1059281411 | 3300015374 | Arabidopsis Rhizosphere | AFAGLPTIFSVLGKLGLELKRQEDILPVYTVERLERPGAN* |
| Ga0182036_109149691 | 3300016270 | Soil | PNSVPDANTFDSLPTIFSVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0182040_104418462 | 3300016387 | Soil | AIPAENPFASLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAR |
| Ga0181511_14353632 | 3300016702 | Peatland | NHFAGLPTIFTVLGKLGLELNRQEDILPVYTVERIERPAAN |
| Ga0187812_11304231 | 3300017821 | Freshwater Sediment | LPTIFTVLGKLGLELRRQEDILPVYTVERIERPAAN |
| Ga0187783_106586321 | 3300017970 | Tropical Peatland | TPAENPFAGLPTIYTVLGKLGLELRRQEDILPVYTVERIERPAAN |
| Ga0187867_104224841 | 3300018033 | Peatland | GLPTIFAVLDKLGLELNRQQDNLPVYTVEHIERPAAN |
| Ga0187875_105683112 | 3300018035 | Peatland | HFAGLPTIFTVLGKLGLELNRQEDILPVYTVERIERPAAN |
| Ga0187855_109171612 | 3300018038 | Peatland | ASPFAGLPTTFTVLSRLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0187887_100553581 | 3300018043 | Peatland | PFAQLPTIFTVLGKLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0187887_107559401 | 3300018043 | Peatland | AGLPTIFTVLGKLGLELKRQEDTLPVYTVECIERPASN |
| Ga0187890_101937482 | 3300018044 | Peatland | AASPFAGLPTIFTVLSRLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0187859_107184572 | 3300018047 | Peatland | TPDVNHFAGLPTIFTVLGKLGLELNRQEDILPVYTVERIERPAAN |
| Ga0187858_107469071 | 3300018057 | Peatland | QLPTIFTVLGKLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0187784_108480992 | 3300018062 | Tropical Peatland | PAVNPFAGLPTISTVLGKLGLELRRQEDILPVYTVERSERPAAN |
| Ga0190274_116256532 | 3300018476 | Soil | EDLFAGLPTIFTVLSKLGLELRRQEEVLAVYTVERIEHPAIN |
| Ga0182031_11382232 | 3300019787 | Bog | PTLFTVLGKLGLELKQQEDILPVYTVERIERPAAN |
| Ga0210379_100671303 | 3300021081 | Groundwater Sediment | TIFTVLRKLGLELKQQEATVPVYTVEHIERPAGESG |
| Ga0210406_100730331 | 3300021168 | Soil | FAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0210386_105981322 | 3300021406 | Soil | PAVNSFAGLPTIFAVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0210392_100962841 | 3300021475 | Soil | PTIFTVLGKLGLELHQQEEILPVYTVERIERPSFN |
| Ga0210410_100549781 | 3300021479 | Soil | APGMNPFAGLPTIFTVLGKLGLELHRQEAVLPVYTVERVERPSVN |
| Ga0210410_112088581 | 3300021479 | Soil | PNAAPDVNHFAGLQTIFAVLGKLGLELNRQEDTLPVYTVERIERPAAN |
| Ga0126371_122287692 | 3300021560 | Tropical Forest Soil | LPTIFTVLGKLGLELKWQEGTLPVYTVEHIERPAAN |
| Ga0247794_102816122 | 3300024055 | Soil | RFDDLPSIFTVLRTLGLELTRQDAAVPVYTIEHIERPAGD |
| Ga0208935_10051411 | 3300025414 | Peatland | PPNATPAANPFAQLPTIFTVLGKLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0208691_10038801 | 3300025612 | Peatland | FAQLPTIFTVLGKLGLELKRQEDVLPVYTVERIERPAAN |
| Ga0207688_108159421 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | PTIFTVLRKLGLELKQEEATLPVYTVEHIERPPGD |
| Ga0207662_111334402 | 3300025918 | Switchgrass Rhizosphere | QAPNFDDLPTIFTVLGRLGLELKRQEAAVPVYTVEHIERPAAE |
| Ga0207657_105336183 | 3300025919 | Corn Rhizosphere | FAGLPTIFTVLNKLGLELKRQEDVLPVYTVERIERPAN |
| Ga0207687_116341751 | 3300025927 | Miscanthus Rhizosphere | TGNPFAGLPTIFAVLGKLGLELKQQEEILPVYTVERIERPTLN |
| Ga0207700_101776871 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHTIFTVLGKLGLELKRQEAIVPVYTVERIERPAAN |
| Ga0207670_106938542 | 3300025936 | Switchgrass Rhizosphere | AGLPTVFSVLGKLGLELKRQEENLPVYTVERIERPAVN |
| Ga0207678_113806832 | 3300026067 | Corn Rhizosphere | NAFATLPTIFSVLGKLGLELKQQEDILPVYTVEHIERPNEMG |
| Ga0207641_108787542 | 3300026088 | Switchgrass Rhizosphere | TPAENRFARLPTIFTVLGKLGLELRRQEETVPVYTVAHIERPTVK |
| Ga0209648_100579761 | 3300026551 | Grasslands Soil | GLPTIFTVLGKLGLELKRQADILPVYTVERIERPAAN |
| Ga0208488_10125704 | 3300027110 | Forest Soil | PDANQFARLPTIFAVLGNLGLELNRQEDTLPIYTVERIHRPTAN |
| Ga0209530_10629692 | 3300027692 | Forest Soil | VNPFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0209382_118050842 | 3300027909 | Populus Rhizosphere | DDLPTVFTVLRTLGLELKQQEATVPVYTVKHVERPAAD |
| Ga0268264_101863273 | 3300028381 | Switchgrass Rhizosphere | NTTRDMSGFAGLPTIFSVLGKLGLELKRQEDILPVYTVERIERPPAN |
| Ga0302226_100846292 | 3300028801 | Palsa | NPDIFASLPTIFTVLGSLGLELHRQEETLPVYTVEHIERPAD |
| Ga0311329_101388573 | 3300029907 | Bog | QTIDTVLSGLGLELHREVATLPVYTVEQIERPSPH |
| Ga0311340_113857501 | 3300029943 | Palsa | LPTIFTVMGKLGLELHRQEEVLPVYTVERIDRPAVN |
| Ga0311371_106955501 | 3300029951 | Palsa | ANLPTIFTVLGTLGLELRRQEETLPVYTVEHIERPAEN |
| Ga0311339_119075631 | 3300029999 | Palsa | TANPNMFASLPTIFTVLGTLGLELRRQEETLPVYTVEHIERPAEN |
| Ga0311338_103878931 | 3300030007 | Palsa | VNPFAGLPTIFTVLGKVGLELKRQEDTLPVYTVEHIERPAAN |
| Ga0311353_113855811 | 3300030399 | Palsa | FTPNSNMFANLPTIFTVLGTLGLELRRQEETLPVYTVEHIERPAEN |
| Ga0170824_1101081992 | 3300031231 | Forest Soil | NPFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0302307_103613141 | 3300031233 | Palsa | HVDFSSLPTIFTVLGKLGLELHRQDEVLPVYTIEHIERPIVN |
| Ga0170818_1156341261 | 3300031474 | Forest Soil | PTIFTVLGKLGLELKRQEDILPVYTVERIERPAAN |
| Ga0310887_100715061 | 3300031547 | Soil | DLPTIFTVLRKLGLELKQQEATVPAYTVEHIERPPGD |
| Ga0318574_106618661 | 3300031680 | Soil | GLPTIFAVLGKLGLELKPQEDTVSVYTVDHIERPTAN |
| Ga0310686_1018173691 | 3300031708 | Soil | VNPFAGIPTIFTVLGKLGLELKRQEDILPVYTVERIEPPTAN |
| Ga0310686_1040162601 | 3300031708 | Soil | PPNATPAVNPFSGLPTIFTVLGKLGLELKRQEDTLPAYNVERVERPAGN |
| Ga0310900_113733031 | 3300031908 | Soil | QAPNFDDLPTIFTVLGKLGLELKQQEAAVPVYTVEHIERPAAE |
| Ga0310902_106082301 | 3300032012 | Soil | PFAGLPTIFSVLGKLGLELKRQEDILPAYTVERIERPTAN |
| Ga0308173_112744532 | 3300032074 | Soil | GLPTIFTVLGKLGLELKRQDDVLPVYTVERIEHPTAN |
| Ga0310895_102108052 | 3300032122 | Soil | FAGLPTIFSVLGKLGLELKRQEDILPAYTVERIERPTAN |
| Ga0307470_102035412 | 3300032174 | Hardwood Forest Soil | VNPFAGLPTIFTVLGKLGLELKRQEDILPVYAVERIERPVTN |
| Ga0335081_107238462 | 3300032892 | Soil | STTPTANPFAGLPTIFTVLGKLGLELKRQEDIMPVYTVERIEHPAAN |
| Ga0335071_116307191 | 3300032897 | Soil | VNHFAGLPTIFTILGKLGLELRRQEGILPVYTVERIERPACN |
| Ga0326728_107032612 | 3300033402 | Peat Soil | VNPFAGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPATN |
| Ga0326727_101150815 | 3300033405 | Peat Soil | AGLPTIFTVLGKLGLELKRQEDILPVYTVERIERPATN |
| Ga0314861_0307719_567_713 | 3300033977 | Peatland | PNATTAVDPFAGLPTIFTVLGDLGLELKRQEDTLPVYTVEHIARPAAK |
| Ga0326724_0506015_481_609 | 3300034091 | Peat Soil | VNPFAGLPTIFTVLGKLGLELKRQEDILPVYSVERIERPATN |
| ⦗Top⦘ |