


| Basic Information | |
|---|---|
| Family ID | F062962 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EEIAPAFLIMAAAAVTFVTLLRFRETYRTPFIGGSSGKAAAYA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.85 % |
| % of genes near scaffold ends (potentially truncated) | 93.85 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01262 | AlaDh_PNT_C | 25.38 |
| PF05222 | AlaDh_PNT_N | 9.23 |
| PF00989 | PAS | 3.85 |
| PF04392 | ABC_sub_bind | 3.85 |
| PF14023 | DUF4239 | 3.85 |
| PF06912 | DUF1275 | 3.08 |
| PF01556 | DnaJ_C | 2.31 |
| PF02738 | MoCoBD_1 | 1.54 |
| PF00226 | DnaJ | 1.54 |
| PF03401 | TctC | 1.54 |
| PF00033 | Cytochrome_B | 1.54 |
| PF08028 | Acyl-CoA_dh_2 | 1.54 |
| PF02195 | ParBc | 1.54 |
| PF12769 | PNTB_4TM | 0.77 |
| PF01614 | IclR | 0.77 |
| PF01292 | Ni_hydr_CYTB | 0.77 |
| PF04209 | HgmA_C | 0.77 |
| PF00583 | Acetyltransf_1 | 0.77 |
| PF01710 | HTH_Tnp_IS630 | 0.77 |
| PF00892 | EamA | 0.77 |
| PF09084 | NMT1 | 0.77 |
| PF13570 | PQQ_3 | 0.77 |
| PF02233 | PNTB | 0.77 |
| PF13436 | Gly-zipper_OmpA | 0.77 |
| PF13673 | Acetyltransf_10 | 0.77 |
| PF13358 | DDE_3 | 0.77 |
| PF09339 | HTH_IclR | 0.77 |
| PF07883 | Cupin_2 | 0.77 |
| PF13505 | OMP_b-brl | 0.77 |
| PF03928 | HbpS-like | 0.77 |
| PF00083 | Sugar_tr | 0.77 |
| PF14108 | ABA4-like | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.85 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 3.08 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 2.31 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.54 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.54 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.54 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.77 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.77 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.77 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.77 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.77 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.77 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.77 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.77 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.15 % |
| Unclassified | root | N/A | 43.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002906|JGI25614J43888_10017754 | Not Available | 2284 | Open in IMG/M |
| 3300002917|JGI25616J43925_10279014 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300002917|JGI25616J43925_10302110 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005175|Ga0066673_10856337 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005435|Ga0070714_101971396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300005436|Ga0070713_101407269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300005455|Ga0070663_100799150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 809 | Open in IMG/M |
| 3300005471|Ga0070698_101530497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300005713|Ga0066905_100909911 | Not Available | 770 | Open in IMG/M |
| 3300005764|Ga0066903_101198605 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300005764|Ga0066903_102342649 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300005764|Ga0066903_103095708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300005764|Ga0066903_103223273 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005764|Ga0066903_105475771 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006175|Ga0070712_100411983 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300006573|Ga0074055_11336270 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006904|Ga0075424_100129734 | Not Available | 2666 | Open in IMG/M |
| 3300009162|Ga0075423_11596925 | Not Available | 701 | Open in IMG/M |
| 3300010036|Ga0126305_11094516 | Not Available | 548 | Open in IMG/M |
| 3300010043|Ga0126380_11099886 | Not Available | 677 | Open in IMG/M |
| 3300010045|Ga0126311_11917860 | Not Available | 503 | Open in IMG/M |
| 3300010359|Ga0126376_11571916 | Not Available | 689 | Open in IMG/M |
| 3300010359|Ga0126376_12338715 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010360|Ga0126372_10924980 | Not Available | 877 | Open in IMG/M |
| 3300010360|Ga0126372_12435565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300010371|Ga0134125_12023039 | Not Available | 626 | Open in IMG/M |
| 3300010376|Ga0126381_101408210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. TCA1 | 1008 | Open in IMG/M |
| 3300010376|Ga0126381_103517002 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010398|Ga0126383_11801992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium neotropicale | 700 | Open in IMG/M |
| 3300010398|Ga0126383_11808172 | Not Available | 699 | Open in IMG/M |
| 3300010398|Ga0126383_12385212 | Not Available | 614 | Open in IMG/M |
| 3300010398|Ga0126383_12623049 | Not Available | 587 | Open in IMG/M |
| 3300010398|Ga0126383_12716074 | Not Available | 578 | Open in IMG/M |
| 3300011107|Ga0151490_1078100 | Not Available | 568 | Open in IMG/M |
| 3300011269|Ga0137392_10013698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5481 | Open in IMG/M |
| 3300012206|Ga0137380_10034095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4697 | Open in IMG/M |
| 3300012208|Ga0137376_10867001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris → Blastochloris sulfoviridis | 776 | Open in IMG/M |
| 3300012209|Ga0137379_10287337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1556 | Open in IMG/M |
| 3300012359|Ga0137385_10676389 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012363|Ga0137390_10057184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3797 | Open in IMG/M |
| 3300012363|Ga0137390_11818707 | Not Available | 540 | Open in IMG/M |
| 3300012930|Ga0137407_11780309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012948|Ga0126375_10395216 | Not Available | 997 | Open in IMG/M |
| 3300012951|Ga0164300_10016887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2445 | Open in IMG/M |
| 3300012960|Ga0164301_10081676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1791 | Open in IMG/M |
| 3300012989|Ga0164305_11712409 | Not Available | 565 | Open in IMG/M |
| 3300015200|Ga0173480_10750991 | Not Available | 617 | Open in IMG/M |
| 3300015242|Ga0137412_10306538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1244 | Open in IMG/M |
| 3300015371|Ga0132258_12508110 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300015374|Ga0132255_100928410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1302 | Open in IMG/M |
| 3300016270|Ga0182036_11267091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300016294|Ga0182041_10061537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2594 | Open in IMG/M |
| 3300016319|Ga0182033_10850405 | Not Available | 806 | Open in IMG/M |
| 3300016319|Ga0182033_11001971 | Not Available | 743 | Open in IMG/M |
| 3300016319|Ga0182033_11023536 | Not Available | 735 | Open in IMG/M |
| 3300016319|Ga0182033_11455791 | Not Available | 617 | Open in IMG/M |
| 3300016341|Ga0182035_10533416 | Not Available | 1006 | Open in IMG/M |
| 3300016341|Ga0182035_11196884 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300016404|Ga0182037_10595504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300016404|Ga0182037_11136504 | Not Available | 684 | Open in IMG/M |
| 3300016404|Ga0182037_11406305 | Not Available | 617 | Open in IMG/M |
| 3300016445|Ga0182038_10393309 | Not Available | 1160 | Open in IMG/M |
| 3300016445|Ga0182038_11085342 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300017961|Ga0187778_11073502 | Not Available | 560 | Open in IMG/M |
| 3300017970|Ga0187783_10174184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1583 | Open in IMG/M |
| 3300017970|Ga0187783_10204045 | Not Available | 1451 | Open in IMG/M |
| 3300017974|Ga0187777_10527792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300018058|Ga0187766_10555009 | Not Available | 779 | Open in IMG/M |
| 3300018075|Ga0184632_10055250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1718 | Open in IMG/M |
| 3300018090|Ga0187770_11774812 | Not Available | 505 | Open in IMG/M |
| 3300019887|Ga0193729_1118698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300020016|Ga0193696_1020472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1779 | Open in IMG/M |
| 3300020581|Ga0210399_11068057 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025901|Ga0207688_10001814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11369 | Open in IMG/M |
| 3300025915|Ga0207693_10800211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300025929|Ga0207664_10751160 | Not Available | 877 | Open in IMG/M |
| 3300025961|Ga0207712_11324868 | Not Available | 644 | Open in IMG/M |
| 3300026304|Ga0209240_1001844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8168 | Open in IMG/M |
| 3300026494|Ga0257159_1060977 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027502|Ga0209622_1016412 | Not Available | 1280 | Open in IMG/M |
| 3300027576|Ga0209003_1113738 | Not Available | 514 | Open in IMG/M |
| 3300028047|Ga0209526_10053892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2832 | Open in IMG/M |
| 3300028721|Ga0307315_10029307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1463 | Open in IMG/M |
| 3300028768|Ga0307280_10068589 | Not Available | 1137 | Open in IMG/M |
| 3300028771|Ga0307320_10095615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum rugosum | 1126 | Open in IMG/M |
| 3300028778|Ga0307288_10113737 | Not Available | 996 | Open in IMG/M |
| 3300028796|Ga0307287_10112240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1030 | Open in IMG/M |
| 3300028819|Ga0307296_10662748 | Not Available | 571 | Open in IMG/M |
| 3300028872|Ga0307314_10080224 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300028872|Ga0307314_10280625 | Not Available | 525 | Open in IMG/M |
| 3300028881|Ga0307277_10035686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1995 | Open in IMG/M |
| 3300031544|Ga0318534_10075280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1914 | Open in IMG/M |
| 3300031545|Ga0318541_10477225 | Not Available | 698 | Open in IMG/M |
| 3300031572|Ga0318515_10502323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 647 | Open in IMG/M |
| 3300031573|Ga0310915_10140285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1665 | Open in IMG/M |
| 3300031573|Ga0310915_10146898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1628 | Open in IMG/M |
| 3300031573|Ga0310915_10729181 | Not Available | 699 | Open in IMG/M |
| 3300031719|Ga0306917_11302796 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031720|Ga0307469_12181479 | Not Available | 539 | Open in IMG/M |
| 3300031744|Ga0306918_10826337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300031744|Ga0306918_11087955 | Not Available | 619 | Open in IMG/M |
| 3300031747|Ga0318502_10202034 | Not Available | 1149 | Open in IMG/M |
| 3300031769|Ga0318526_10353958 | Not Available | 600 | Open in IMG/M |
| 3300031793|Ga0318548_10083529 | Not Available | 1512 | Open in IMG/M |
| 3300031831|Ga0318564_10073965 | Not Available | 1502 | Open in IMG/M |
| 3300031835|Ga0318517_10583297 | Not Available | 502 | Open in IMG/M |
| 3300031858|Ga0310892_10306072 | Not Available | 1004 | Open in IMG/M |
| 3300031879|Ga0306919_10361253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1110 | Open in IMG/M |
| 3300031890|Ga0306925_11227968 | Not Available | 749 | Open in IMG/M |
| 3300031890|Ga0306925_12268813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 502 | Open in IMG/M |
| 3300031896|Ga0318551_10475157 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031910|Ga0306923_10169164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → Acidisoma cellulosilyticum | 2496 | Open in IMG/M |
| 3300031912|Ga0306921_11749041 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031942|Ga0310916_10844683 | Not Available | 769 | Open in IMG/M |
| 3300031954|Ga0306926_12322893 | Not Available | 593 | Open in IMG/M |
| 3300031959|Ga0318530_10195486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 829 | Open in IMG/M |
| 3300032001|Ga0306922_10087588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3277 | Open in IMG/M |
| 3300032001|Ga0306922_11657923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 634 | Open in IMG/M |
| 3300032025|Ga0318507_10269731 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300032035|Ga0310911_10232776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1052 | Open in IMG/M |
| 3300032039|Ga0318559_10266915 | Not Available | 792 | Open in IMG/M |
| 3300032052|Ga0318506_10075119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1410 | Open in IMG/M |
| 3300032054|Ga0318570_10078089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1419 | Open in IMG/M |
| 3300032059|Ga0318533_11019417 | Not Available | 607 | Open in IMG/M |
| 3300032066|Ga0318514_10235056 | Not Available | 963 | Open in IMG/M |
| 3300032076|Ga0306924_10839359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1021 | Open in IMG/M |
| 3300032180|Ga0307471_100024146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4537 | Open in IMG/M |
| 3300032205|Ga0307472_100607200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300032261|Ga0306920_103061252 | Not Available | 629 | Open in IMG/M |
| 3300033290|Ga0318519_10951165 | Not Available | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25614J43888_100177542 | 3300002906 | Grasslands Soil | MSFRHLKIGDKVISIAPLVDRTGEEIAPAFMIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA* |
| JGI25616J43925_102790141 | 3300002917 | Grasslands Soil | IGDKVISIAPLVDRTGEEIAPAFMIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA* |
| JGI25616J43925_103021101 | 3300002917 | Grasslands Soil | LVNRTGEEIAPAFMIMAAAAVTFMTLLWFRETYRTPFIGGSSGTAAAYA* |
| Ga0066673_108563371 | 3300005175 | Soil | WLVSRSGEEVAPALLTTAAAAVSFPMLLRFRETYRSPIRANSGTVAAYA* |
| Ga0070714_1019713961 | 3300005435 | Agricultural Soil | ERTGDEIAPAFLIMAAAAVTAVTVMCFRETYRAPFAGGEVTA* |
| Ga0070713_1014072692 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGDEIAPAFMIMAAAAITFTTLLRFRETYRLPFAARTAATAAAYG* |
| Ga0070663_1007991502 | 3300005455 | Corn Rhizosphere | NEIAPAFLIMAAAAVAFFTILRFRETYRAPFAGGISSAASV* |
| Ga0070698_1015304972 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGDEIAPAFLIMASAAVTAVTLMCFRETYRAPFAGGTSNAAPAYT* |
| Ga0066905_1009099111 | 3300005713 | Tropical Forest Soil | RLIPRRLYMQLFPIMAAAAVTFARKPFIGGSSGTAAAYA* |
| Ga0066903_1011986053 | 3300005764 | Tropical Forest Soil | PGFLMMAAAALSLVTILRFPETYRTPFAGMTSRAAAAYA* |
| Ga0066903_1023426492 | 3300005764 | Tropical Forest Soil | TAPAFLIMAAAAVSLATTLWFRETYRAPFAGARAVPAAA* |
| Ga0066903_1030957081 | 3300005764 | Tropical Forest Soil | LIMASAAVAAVTLTRFRETYRALFAGGSSNAAPAHP* |
| Ga0066903_1032232732 | 3300005764 | Tropical Forest Soil | LIMASAAVTAVTLTRFRETYRALFAGGSSNAATAHP* |
| Ga0066903_1054757711 | 3300005764 | Tropical Forest Soil | ERTGDEIAPAFLIMASAAVTAVTLTRFRETYRAPFAGGTSNVAPALA* |
| Ga0070712_1004119832 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAPAFMIMAAAAITFTTLLRFRETYRLPFAARTAATAAAYG* |
| Ga0074055_113362702 | 3300006573 | Soil | PAFLIMAAAAVTFMTILGFRETYRAPFVASSPAAATAYA* |
| Ga0075424_1001297342 | 3300006904 | Populus Rhizosphere | MIMAAAAVTFMTLWFRETYRTPFIGGSSGTAAAYA* |
| Ga0075423_115969252 | 3300009162 | Populus Rhizosphere | FLIMAAAAVTFLTLLRFRETYRSPFIGASSRAAAAYA* |
| Ga0126305_110945162 | 3300010036 | Serpentine Soil | PAFLIMAAAAVTFATILRFRETYRAPFVRSPAAATVYA* |
| Ga0126380_110998861 | 3300010043 | Tropical Forest Soil | IAPAFMVMAAAAVTFATLLWFRETYRTPFVGSSSGTAAAYA* |
| Ga0126311_119178602 | 3300010045 | Serpentine Soil | LIMAAAAVTFATILRFRETYRAPFVGNPAAASAYA* |
| Ga0126376_115719161 | 3300010359 | Tropical Forest Soil | AFMIMAAAAVNFLTVLQFRETYRSPFIGASSRAAAAYA* |
| Ga0126376_123387151 | 3300010359 | Tropical Forest Soil | LVERTGDEIAPAFLIMASAAVTAVTLTRFRETYRVLFAGGSSNAAPAHP* |
| Ga0126372_109249802 | 3300010360 | Tropical Forest Soil | MAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA* |
| Ga0126372_124355651 | 3300010360 | Tropical Forest Soil | RTADETAPAFLIMASAAISFATILWFRETYRAPFAGGRAAPAAAGT* |
| Ga0134125_120230392 | 3300010371 | Terrestrial Soil | FLIMAAAAVTFLTVLRFRETYRGPFIGASSRAAAAYA* |
| Ga0126381_1014082102 | 3300010376 | Tropical Forest Soil | RTGNEIAPGFLMMVAAAVTFLTILRFPETYRIPFVGTESRAAPAYT* |
| Ga0126381_1035170021 | 3300010376 | Tropical Forest Soil | TGDEIAPAFLIMASAAVTAVTLTRFRETYRAQFAGGSSNAAPAHP* |
| Ga0126383_118019921 | 3300010398 | Tropical Forest Soil | ERTGDEIAPAFLIMAAVAVTAVALTRFRETYRAPFVGGTSNIAPALA* |
| Ga0126383_118081722 | 3300010398 | Tropical Forest Soil | LIMAAAAIAFATVLRFRETYRLPFIGRGSGVAAAAYA* |
| Ga0126383_123852122 | 3300010398 | Tropical Forest Soil | MGAAAVTFATLLWFRETYRTPFIGGSPGAAAAYA* |
| Ga0126383_126230491 | 3300010398 | Tropical Forest Soil | ERTGDEIAPAFLIMAAVAVTAVALTRFRETYRAPFVGGTSNVAPALA* |
| Ga0126383_127160741 | 3300010398 | Tropical Forest Soil | EIAPAFLIMASAAVTAVTLMRFRETYRAPFAGVLLTLPRP* |
| Ga0151490_10781002 | 3300011107 | Soil | VNRTGDEIAPAFLIMAAAAVTFMTILGFRETYRAPFVASSPAAATAYA* |
| Ga0137392_100136987 | 3300011269 | Vadose Zone Soil | EIAPAFMIMAAAAVTFMTLLWFRETYRTPFIGGSSGTAAAYA* |
| Ga0137380_100340953 | 3300012206 | Vadose Zone Soil | MAAAAVSFAMLLRFRETYRSPVIQAKSSTVAAYA* |
| Ga0137376_108670011 | 3300012208 | Vadose Zone Soil | MRFLPDFLMMVAAANTFLTNLRFPETYRIQLSESASSAAAAYT* |
| Ga0137379_102873372 | 3300012209 | Vadose Zone Soil | LLTTAAAAVSFAMLLRFRETYRSPVIQAKSSTVAAYA* |
| Ga0137385_106763892 | 3300012359 | Vadose Zone Soil | LIMASAAVTAVTLMCFRETYRAPFAGGTSNAAPAYT* |
| Ga0137390_100571846 | 3300012363 | Vadose Zone Soil | RTGDEIAPAFLIMASACVTLMTIFRFRETYRAPFRGDASRAAAAYA* |
| Ga0137390_118187071 | 3300012363 | Vadose Zone Soil | EDEIAPAFLIMAAAAVTFLTLLQFRETYRAPFVGGSAGAAMARA* |
| Ga0137407_117803092 | 3300012930 | Vadose Zone Soil | IMAAAAVAFFTILRFRETYRAPFAGGTSSAARVYA* |
| Ga0126375_103952162 | 3300012948 | Tropical Forest Soil | VMAAAAVTFATLLWFRETYRTPFVGSSSGTAAAYA* |
| Ga0164300_100168871 | 3300012951 | Soil | APAFLIMAAAAVTFLTLLRFRETYRSPFIGASSRAAAAYA* |
| Ga0164301_100816764 | 3300012960 | Soil | PAFLIMAAAAVTFLTVLRFRETYRGPFIGASSRAAAAYA* |
| Ga0164305_117124092 | 3300012989 | Soil | GNEIAPAFLIMAAAAVTFITMFWFRETYRTSFDAEFSSTAA* |
| Ga0173480_107509912 | 3300015200 | Soil | DETVPAFLIMAAAAVTFTTILWFRETYRAAFVGSSAAATAYA* |
| Ga0137412_103065383 | 3300015242 | Vadose Zone Soil | MAAAAVTFGTVLRFRETYRAPFVGGRSGAAAAYA* |
| Ga0132258_125081103 | 3300015371 | Arabidopsis Rhizosphere | LIMAAAAVTFTTILWFRETYRAAFVGSSAAATAYA* |
| Ga0132255_1009284101 | 3300015374 | Arabidopsis Rhizosphere | FLIMAAAAVTFLTVLRFRETYRSPFITASSAAAAAYARI* |
| Ga0182036_112670912 | 3300016270 | Soil | RTGDEIAAGFLMMVAAAVTFLTLLRFPETYRTPFVGFTSRAAAAYA |
| Ga0182041_100615373 | 3300016294 | Soil | FLMMAAAAVSFVTILRFPETYRTPFAGITSKAAAAYA |
| Ga0182033_108504052 | 3300016319 | Soil | TGDEIAPAFMIMAAAAVTFATLLWFRETYRTPFVGGSSGAAAAYA |
| Ga0182033_110019712 | 3300016319 | Soil | ERTGDEIAPAFLIMASAAVTAVTLMRFRETYRAPFAGGTSNVAPALA |
| Ga0182033_110235362 | 3300016319 | Soil | VAAAVTFLTILRVPETYRTLFVGIKSRAAAAYALRGAGL |
| Ga0182033_114557911 | 3300016319 | Soil | AFLIMASAAVTAVTLMCFRETYRAPFAGGTSNVAPALA |
| Ga0182035_105334161 | 3300016341 | Soil | SWLVARTGDEIAPGFLMMAAAAVSFVTILRFPETYRIPFAGITSRAAAAYA |
| Ga0182035_111968842 | 3300016341 | Soil | WLVARTGDEIAPGFLMMVAAAVTFLTILRFPETYRAPFVGSRSRAAAAYA |
| Ga0182037_105955042 | 3300016404 | Soil | ASWLVARTGDEIAPGFLMMAAAAVSFVTILRFPETYRTPFAGITSKAAAAYA |
| Ga0182037_111365042 | 3300016404 | Soil | VLALGSSVEAAVSFVTILRFPETYRSPFAGIRSRIAAAY |
| Ga0182037_114063052 | 3300016404 | Soil | ARTGDEIAPGFLMMAAAAVSFVTILRFPETYRIPFAGITSRAAAAYA |
| Ga0182038_103933091 | 3300016445 | Soil | APAFMVMAAAAVTFATLLWFRETYRTPFIGGSSGTAAAYA |
| Ga0182038_110853421 | 3300016445 | Soil | SWLVARTGDEIAPGFLMMAAAAVSFVTILRFPETYRTPFAGITSRAAAYA |
| Ga0187778_110735021 | 3300017961 | Tropical Peatland | FLMMVAAAVTLLTILRFPETYRTPFVGITSRAAAAYA |
| Ga0187783_101741841 | 3300017970 | Tropical Peatland | TGDEIAPGFLMMVAAAVTLLTILRFPETYRTPFVGIISRAAAAYA |
| Ga0187783_102040452 | 3300017970 | Tropical Peatland | TGDEIAPGFLMMVAAAVTLLTILRFPETYRTPFVGIISRAATAYA |
| Ga0187777_105277924 | 3300017974 | Tropical Peatland | PGFLMMVAAAVTFLTILRFPETYRTPFVGIISRAAAAYA |
| Ga0187766_105550092 | 3300018058 | Tropical Peatland | LVARTGDEIAPGFLMMVAAAVTFLTILRFPETYRTPFVGIISRAAAAYA |
| Ga0184632_100552501 | 3300018075 | Groundwater Sediment | RTENELAPAFLIMAAAVVTFATVLQFRETYRAPFAGVRPAPAAARA |
| Ga0187770_117748121 | 3300018090 | Tropical Peatland | WLVARTGDEIAPGFLMMVAAGVTFLTLLRFPETYRTRFVGITSTAAAAYA |
| Ga0193729_11186981 | 3300019887 | Soil | RTGEEIAPAFLIMAASAVTFMTILRFRETYRAPFVAGSPAATAYA |
| Ga0193696_10204723 | 3300020016 | Soil | RQITSRTGDEISPAFLIMAAAAVTFMTILGFRETYRAPFVAGSPAAATAYA |
| Ga0210399_110680571 | 3300020581 | Soil | VDRTGDEIAPAFMIMGAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA |
| Ga0207688_1000181411 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AFLIMAAAAVTFATILRFRETYRAPFVGSPAAATAYA |
| Ga0207693_108002111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TGDEIAPAFMIMAAAAITFTTLLRFRETYRLPFAARTAATAAAYG |
| Ga0207664_107511602 | 3300025929 | Agricultural Soil | RTGDEIAPAFLIMAAAAVTFLTLLRFRETYRSPFIGASSRAAAAYA |
| Ga0207712_113248682 | 3300025961 | Switchgrass Rhizosphere | GDEISPAFLIMAAAAVTFATILRFRETYRAPFVGSPAAATAYA |
| Ga0209240_10018449 | 3300026304 | Grasslands Soil | MSFRHLKIGDKVISIAPLVDRTGEEIAPAFMIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA |
| Ga0257159_10609771 | 3300026494 | Soil | ISIAPLVDRTGEEIAPAFMIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA |
| Ga0209622_10164122 | 3300027502 | Forest Soil | IMGAAAVTFATLLWFRETYRKPFIGGSSGAAAAYA |
| Ga0209003_11137381 | 3300027576 | Forest Soil | GLSSAFFAGAVTFATLLWFRETYRKPFIGGSSGAAAAYA |
| Ga0209526_100538925 | 3300028047 | Forest Soil | DEEIAPAFMIMAAAAVTFATLLWFRETYRTPFIGGSSGTAAAYA |
| Ga0307315_100293073 | 3300028721 | Soil | FLIMAAAAVTFMTILGFRETYRAPFVAGSPAAATAYA |
| Ga0307280_100685892 | 3300028768 | Soil | DEISPAFLIMAAAAVSFATILRFRETYRAPFVGSLAAATAYA |
| Ga0307320_100956152 | 3300028771 | Soil | LIMAAAAVAFFTILRFRETYRAPFAGDTSSAARIYA |
| Ga0307288_101137371 | 3300028778 | Soil | GDEISPAFLIMAAAAVTFATILRFRETYRAPFVGSSAAATAHA |
| Ga0307287_101122401 | 3300028796 | Soil | FLIMAAAAVAFFTILRFRETYRAPFAGDTSSAARIYA |
| Ga0307296_106627483 | 3300028819 | Soil | FLIMAAGAVSFGAVLRFAETYRAPFVGGSSAAAAAYA |
| Ga0307314_100802241 | 3300028872 | Soil | ISPAFLIMAAAAVSFATILRFRETYRAPFVGSLAAATAYA |
| Ga0307314_102806253 | 3300028872 | Soil | LIMAAGAVSFGAVLRFAETYRAPFVGGSSAAAAAYA |
| Ga0307277_100356861 | 3300028881 | Soil | EEIAPAFLIMAAAAVTFVTLLRFRETYRTPFIGGSSGKAAAYA |
| Ga0318534_100752801 | 3300031544 | Soil | AFMVMAAAAVTFATLLWFRETYRTPFIGGRSGAVAAYA |
| Ga0318541_104772252 | 3300031545 | Soil | TLTAQSELAGPPLVARTGDEIAPGFLMMAAAAVSFVTILRFPETYRIPFAGITSRAAAAY |
| Ga0318515_105023233 | 3300031572 | Soil | VLMMAAAAVSVVTILRFPETYRTPFSAITSSAAAAYA |
| Ga0310915_101402851 | 3300031573 | Soil | EIAPGFLMMAAAAVSFVTILRFPETYRTPFAGITSKAAAAYA |
| Ga0310915_101468982 | 3300031573 | Soil | EIAPGLLMVVAAAVTFLTILRFPETYRAPFVGSRSRAAAAYA |
| Ga0310915_107291812 | 3300031573 | Soil | RTGDEIAPGFLMMAAAAVSFVTILRFPETYRIPFAGITSRAAAAYA |
| Ga0306917_113027961 | 3300031719 | Soil | TGDEIAPGFLMMAAAAISLMTILRFPETYRIPFAGIRSRAAAAYA |
| Ga0307469_121814791 | 3300031720 | Hardwood Forest Soil | MAAAAVTFATVLRFRETHHLPFVGGGSGAAAAAHA |
| Ga0306918_108263371 | 3300031744 | Soil | DEIAPGFLMMVAAGVTFLTLLRFPETYRTPFVGFTSRVAAAYA |
| Ga0306918_110879551 | 3300031744 | Soil | TGDEIAPAFLIMASAAVTAVTLMCFRETYRAPFAGGTSNVAAALA |
| Ga0318502_102020341 | 3300031747 | Soil | LVNRTDDEIAPEFMVMAAAAVTFATLLWFRETYRTPFIGGSSGTAAAYA |
| Ga0318526_103539582 | 3300031769 | Soil | IMAAAAVTFATLLWFRETYRTPFVGGSSGAAAAYA |
| Ga0318548_100835293 | 3300031793 | Soil | VMGAAAVTFATLLCFRETYRTPFIGGRSGAAAAYA |
| Ga0318564_100739651 | 3300031831 | Soil | VNRTGDEITPAFMVMGAAGVTFATLLWFRETYRTPFIGGRSGAAAAYA |
| Ga0318517_105832971 | 3300031835 | Soil | EEIASAFLIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA |
| Ga0310892_103060722 | 3300031858 | Soil | LVSRTGDEISPAFLIMAAAAVTFATILRFRETYRAPFVGSPAAATACA |
| Ga0306919_103612531 | 3300031879 | Soil | TGDEIAPGFLMMAAAAVSFVTILRFPETYRTPFSAITSSAAAAYA |
| Ga0306925_112279682 | 3300031890 | Soil | DEIAPAFMVMAAAAVTFATLLWFRETYRTPFIGGRSGAVAAYA |
| Ga0306925_122688132 | 3300031890 | Soil | EIAPAFLIMASAAVTAVTLMCFRETYRAPFAGGTSNVAPALA |
| Ga0318551_104751571 | 3300031896 | Soil | TWLVNRTGDEIAPAFMVMAAAAVTFATLLWFRETYRTPFIGGSSGTAAAYA |
| Ga0306923_101691645 | 3300031910 | Soil | VARTGNEIAPGFLMMVAAAVTFLTLLRFPETYRTSFVGITSRAAAAYA |
| Ga0306921_117490412 | 3300031912 | Soil | APGFLMMAAAAVSFVTILRFPETYRTPFAGITSKAAAAYA |
| Ga0310916_108446832 | 3300031942 | Soil | NEIAPGFLMMVAAAVTFLTLLRFPETYRTSFVGITSRAAAAYA |
| Ga0306926_123228932 | 3300031954 | Soil | RTGDEIAPAFLIMASAAVTAVTLMCFRETYRAPFAGGTSNVAAALA |
| Ga0318530_101954863 | 3300031959 | Soil | EIAPGFLMMAAAAVSFVTILRFPETYRTPFSAITSSAAAAYA |
| Ga0306922_100875883 | 3300032001 | Soil | RTGDEIAPGFLMMAAAAVSFVTILRFPETYRTPFAGITSKAAAAYA |
| Ga0306922_116579233 | 3300032001 | Soil | GDEIAPGFLMMAAAAVSFVTILRFPETYRNPFAGMSKATAAYA |
| Ga0318507_102697312 | 3300032025 | Soil | VNRTGDEIAPAFMVMAAAAVTFATLLWFRETYRTPFIGGRSGAVAAYA |
| Ga0310911_102327761 | 3300032035 | Soil | WLVARTGNEIAPGFLMMAAAGVTFLTLRRFPETYRTSFVGITSRAAAAYA |
| Ga0318559_102669152 | 3300032039 | Soil | GEEITPAFLIMAAAAVTFATLLWFRETYRSPFIGGSSGAAAAYA |
| Ga0318506_100751191 | 3300032052 | Soil | TGDEIAPGFLMMVAAAVTFLTLLRFSETYRTPFAGTRSRAAAAYA |
| Ga0318570_100780891 | 3300032054 | Soil | ARTGDEIAPGFLMMVAAAVTFLTLLRFSETYRTPFAGTRSRAAAAYA |
| Ga0318533_110194172 | 3300032059 | Soil | EIAPGFLMMAAAALSLMTILRFPETYRIPFAGITSRAAAAYA |
| Ga0318514_102350562 | 3300032066 | Soil | FLIMAAAAVTFATLLWFRETYRTPFIGGSSGAAAAYA |
| Ga0306924_108393591 | 3300032076 | Soil | TGNEIAPGFLMMVAAAVTFLTILRVPETYRTLFVGIKSRAAAAYA |
| Ga0307471_1000241461 | 3300032180 | Hardwood Forest Soil | FLIMAAAAVTFLTLLRFRETYRSPFIGASSRAAAAYA |
| Ga0307472_1006072001 | 3300032205 | Hardwood Forest Soil | APAFLIMAAAAVTFMTILGFRETYRAPFVAGSPAAATAYA |
| Ga0306920_1030612521 | 3300032261 | Soil | APGLLMVVAAAVTFLTILRFPETYRAPFVGSRSRAAAAYA |
| Ga0318519_109511651 | 3300033290 | Soil | IMASAAVTAVTLMRFRETYRAPFAGGTSNVAPALA |
| ⦗Top⦘ |