


| Basic Information | |
|---|---|
| Family ID | F062887 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPVRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.17 % |
| % of genes near scaffold ends (potentially truncated) | 16.15 % |
| % of genes from short scaffolds (< 2000 bps) | 58.46 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.077 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen (8.461 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.538 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (28.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 14.08% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01343 | Peptidase_S49 | 4.62 |
| PF03237 | Terminase_6N | 3.08 |
| PF06737 | Transglycosylas | 3.08 |
| PF02195 | ParBc | 2.31 |
| PF04466 | Terminase_3 | 2.31 |
| PF00196 | GerE | 1.54 |
| PF05069 | Phage_tail_S | 1.54 |
| PF07411 | DUF1508 | 1.54 |
| PF01551 | Peptidase_M23 | 1.54 |
| PF12236 | Head-tail_con | 1.54 |
| PF11651 | P22_CoatProtein | 1.54 |
| PF01555 | N6_N4_Mtase | 0.77 |
| PF07484 | Collar | 0.77 |
| PF10926 | DUF2800 | 0.77 |
| PF03864 | Phage_cap_E | 0.77 |
| PF05866 | RusA | 0.77 |
| PF13392 | HNH_3 | 0.77 |
| PF13578 | Methyltransf_24 | 0.77 |
| PF10145 | PhageMin_Tail | 0.77 |
| PF12705 | PDDEXK_1 | 0.77 |
| PF15919 | HicB_lk_antitox | 0.77 |
| PF06152 | Phage_min_cap2 | 0.77 |
| PF00145 | DNA_methylase | 0.77 |
| PF01471 | PG_binding_1 | 0.77 |
| PF01381 | HTH_3 | 0.77 |
| PF05709 | Sipho_tail | 0.77 |
| PF13560 | HTH_31 | 0.77 |
| PF04404 | ERF | 0.77 |
| PF08291 | Peptidase_M15_3 | 0.77 |
| PF12850 | Metallophos_2 | 0.77 |
| PF01391 | Collagen | 0.77 |
| PF05063 | MT-A70 | 0.77 |
| PF05133 | Phage_prot_Gp6 | 0.77 |
| PF13479 | AAA_24 | 0.77 |
| PF03592 | Terminase_2 | 0.77 |
| PF04586 | Peptidase_S78 | 0.77 |
| PF05065 | Phage_capsid | 0.77 |
| PF00476 | DNA_pol_A | 0.77 |
| PF02739 | 5_3_exonuc_N | 0.77 |
| PF13148 | DUF3987 | 0.77 |
| PF13473 | Cupredoxin_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 9.23 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 2.31 |
| COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 1.54 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.54 |
| COG5005 | Mu-like prophage protein gpG | Mobilome: prophages, transposons [X] | 1.54 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.77 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.77 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.77 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.77 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.77 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.77 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.77 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.77 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.77 |
| COG4722 | Phage-related protein YomH | Mobilome: prophages, transposons [X] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.08 % |
| All Organisms | root | All Organisms | 36.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16995106 | Not Available | 2204 | Open in IMG/M |
| 2088090015|GPICI_9171923 | All Organisms → Viruses → Predicted Viral | 3352 | Open in IMG/M |
| 2166559006|FI_contig05004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Pepyhexavirus | 1445 | Open in IMG/M |
| 2199352025|deepsgr__Contig_98595 | Not Available | 930 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0899153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWB1_49_7 | 9087 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c010259 | Not Available | 783 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101967712 | Not Available | 2186 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105869028 | Not Available | 1920 | Open in IMG/M |
| 3300000385|PR_CR_10_Liq_1_inCRDRAFT_1035485 | Not Available | 1036 | Open in IMG/M |
| 3300000858|JGI10213J12805_10089093 | Not Available | 894 | Open in IMG/M |
| 3300001687|WOR8_10000512 | All Organisms → cellular organisms → Bacteria | 60132 | Open in IMG/M |
| 3300001960|GOS2230_1041365 | Not Available | 1647 | Open in IMG/M |
| 3300002155|JGI24033J26618_1019643 | Not Available | 857 | Open in IMG/M |
| 3300002231|KVRMV2_101673743 | Not Available | 524 | Open in IMG/M |
| 3300002488|JGI25128J35275_1000383 | Not Available | 13781 | Open in IMG/M |
| 3300002568|C688J35102_120481465 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300002597|DRAFT_10045051 | All Organisms → cellular organisms → Bacteria | 36401 | Open in IMG/M |
| 3300003142|Ga0052242_1015685 | Not Available | 922 | Open in IMG/M |
| 3300003885|Ga0063294_10656612 | Not Available | 621 | Open in IMG/M |
| 3300003911|JGI25405J52794_10057637 | Not Available | 837 | Open in IMG/M |
| 3300004022|Ga0055432_10016457 | Not Available | 1481 | Open in IMG/M |
| 3300004074|Ga0055518_10008162 | Not Available | 1729 | Open in IMG/M |
| 3300004186|Ga0066647_10356868 | Not Available | 633 | Open in IMG/M |
| 3300004463|Ga0063356_100803541 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300004479|Ga0062595_100046688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Pepyhexavirus | 1945 | Open in IMG/M |
| 3300004799|Ga0058863_11766083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWB1_49_7 | 3833 | Open in IMG/M |
| 3300004803|Ga0058862_10330056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 920 | Open in IMG/M |
| 3300005086|Ga0072334_10015983 | Not Available | 503 | Open in IMG/M |
| 3300005162|Ga0066814_10105346 | Not Available | 532 | Open in IMG/M |
| 3300005329|Ga0070683_100108896 | All Organisms → Viruses → Predicted Viral | 2613 | Open in IMG/M |
| 3300005439|Ga0070711_100037874 | Not Available | 3238 | Open in IMG/M |
| 3300005458|Ga0070681_10119828 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300005526|Ga0073909_10001546 | Not Available | 6934 | Open in IMG/M |
| 3300005764|Ga0066903_104714158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
| 3300005841|Ga0068863_100009021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWB1_49_7 | 9739 | Open in IMG/M |
| 3300006038|Ga0075365_10943844 | Not Available | 608 | Open in IMG/M |
| 3300006196|Ga0075422_10558576 | Not Available | 526 | Open in IMG/M |
| 3300006577|Ga0074050_10521448 | Not Available | 753 | Open in IMG/M |
| 3300006752|Ga0098048_1035514 | Not Available | 1610 | Open in IMG/M |
| 3300006802|Ga0070749_10005618 | Not Available | 8264 | Open in IMG/M |
| 3300006871|Ga0075434_100505531 | Not Available | 1229 | Open in IMG/M |
| 3300006871|Ga0075434_101956331 | Not Available | 592 | Open in IMG/M |
| 3300006919|Ga0070746_10425039 | Not Available | 592 | Open in IMG/M |
| 3300006929|Ga0098036_1003841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5192 | Open in IMG/M |
| 3300007963|Ga0110931_1008332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3197 | Open in IMG/M |
| 3300009094|Ga0111539_11213544 | Not Available | 876 | Open in IMG/M |
| 3300009156|Ga0111538_11075195 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300009176|Ga0105242_10626013 | Not Available | 1043 | Open in IMG/M |
| 3300009176|Ga0105242_12252802 | Not Available | 591 | Open in IMG/M |
| 3300009176|Ga0105242_12353848 | Not Available | 579 | Open in IMG/M |
| 3300009488|Ga0114925_10317034 | Not Available | 1062 | Open in IMG/M |
| 3300009506|Ga0118657_10358360 | All Organisms → Viruses → Predicted Viral | 1935 | Open in IMG/M |
| 3300009790|Ga0115012_11445966 | Not Available | 588 | Open in IMG/M |
| 3300010043|Ga0126380_11706842 | Not Available | 566 | Open in IMG/M |
| 3300010319|Ga0136653_10483148 | Not Available | 541 | Open in IMG/M |
| 3300010412|Ga0136852_10000715 | Not Available | 35585 | Open in IMG/M |
| 3300010412|Ga0136852_10036799 | Not Available | 5184 | Open in IMG/M |
| 3300010413|Ga0136851_12284694 | Not Available | 511 | Open in IMG/M |
| 3300011412|Ga0137424_1000016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 32697 | Open in IMG/M |
| 3300012022|Ga0120191_10000330 | Not Available | 3074 | Open in IMG/M |
| 3300012200|Ga0137382_10936661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 623 | Open in IMG/M |
| 3300012212|Ga0150985_107192797 | Not Available | 736 | Open in IMG/M |
| 3300012212|Ga0150985_111433752 | Not Available | 855 | Open in IMG/M |
| 3300012212|Ga0150985_113800979 | Not Available | 536 | Open in IMG/M |
| 3300012212|Ga0150985_114157322 | Not Available | 3007 | Open in IMG/M |
| 3300012469|Ga0150984_115579547 | Not Available | 923 | Open in IMG/M |
| 3300012952|Ga0163180_10674931 | Not Available | 795 | Open in IMG/M |
| 3300013101|Ga0164313_10438028 | Not Available | 1089 | Open in IMG/M |
| 3300013101|Ga0164313_10640632 | Not Available | 878 | Open in IMG/M |
| 3300013101|Ga0164313_11627763 | Not Available | 519 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10348694 | Not Available | 873 | Open in IMG/M |
| 3300014203|Ga0172378_10549130 | Not Available | 856 | Open in IMG/M |
| 3300014913|Ga0164310_10183345 | Not Available | 1282 | Open in IMG/M |
| 3300014965|Ga0120193_10076905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300014968|Ga0157379_10607823 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300015371|Ga0132258_13612954 | Not Available | 1057 | Open in IMG/M |
| 3300015374|Ga0132255_100029158 | Not Available | 6943 | Open in IMG/M |
| 3300017951|Ga0181577_10006109 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Waddliaceae → Waddlia → Waddlia chondrophila | 9185 | Open in IMG/M |
| 3300018063|Ga0184637_10000742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 23481 | Open in IMG/M |
| 3300018084|Ga0184629_10007235 | All Organisms → Viruses → Predicted Viral | 4194 | Open in IMG/M |
| 3300018481|Ga0190271_10023698 | All Organisms → Viruses → Predicted Viral | 4799 | Open in IMG/M |
| 3300019458|Ga0187892_10001998 | All Organisms → cellular organisms → Bacteria | 43426 | Open in IMG/M |
| 3300019875|Ga0193701_1031900 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300019884|Ga0193741_1024711 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
| 3300020171|Ga0180732_1048302 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300020439|Ga0211558_10002711 | Not Available | 9505 | Open in IMG/M |
| 3300020473|Ga0211625_10021990 | Not Available | 4435 | Open in IMG/M |
| 3300021400|Ga0224422_11463336 | Not Available | 46619 | Open in IMG/M |
| 3300021431|Ga0224423_10001835 | Not Available | 32592 | Open in IMG/M |
| 3300021791|Ga0226832_10229788 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 735 | Open in IMG/M |
| 3300021960|Ga0222715_10424119 | All Organisms → Viruses | 722 | Open in IMG/M |
| 3300022167|Ga0212020_1081914 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 541 | Open in IMG/M |
| 3300022226|Ga0224512_10060238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2217 | Open in IMG/M |
| 3300025132|Ga0209232_1001274 | All Organisms → cellular organisms → Bacteria | 13816 | Open in IMG/M |
| 3300025132|Ga0209232_1120023 | Not Available | 868 | Open in IMG/M |
| 3300025825|Ga0210046_1296128 | Not Available | 527 | Open in IMG/M |
| 3300025912|Ga0207707_10000268 | All Organisms → cellular organisms → Bacteria | 55992 | Open in IMG/M |
| 3300025912|Ga0207707_10289832 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300025931|Ga0207644_11703314 | Not Available | 528 | Open in IMG/M |
| 3300025934|Ga0207686_10001109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15671 | Open in IMG/M |
| 3300025934|Ga0207686_10027889 | Not Available | 3312 | Open in IMG/M |
| 3300025944|Ga0207661_10138959 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300025970|Ga0210081_1006553 | Not Available | 1542 | Open in IMG/M |
| 3300026088|Ga0207641_10011302 | All Organisms → cellular organisms → Bacteria | 7325 | Open in IMG/M |
| 3300027814|Ga0209742_10196221 | Not Available | 663 | Open in IMG/M |
| 3300027821|Ga0209811_10000089 | Not Available | 40151 | Open in IMG/M |
| 3300027835|Ga0209515_10058188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2888 | Open in IMG/M |
| 3300027907|Ga0207428_10070924 | Not Available | 2737 | Open in IMG/M |
| 3300027917|Ga0209536_100989497 | Not Available | 1037 | Open in IMG/M |
| 3300027917|Ga0209536_102121394 | Not Available | 671 | Open in IMG/M |
| 3300028591|Ga0247611_10047201 | Not Available | 4389 | Open in IMG/M |
| 3300028591|Ga0247611_11325822 | Not Available | 714 | Open in IMG/M |
| 3300028597|Ga0247820_10075185 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300028603|Ga0265293_10460496 | Not Available | 745 | Open in IMG/M |
| 3300028797|Ga0265301_10006270 | Not Available | 11434 | Open in IMG/M |
| 3300028797|Ga0265301_10070938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2673 | Open in IMG/M |
| 3300028797|Ga0265301_10863436 | Not Available | 658 | Open in IMG/M |
| 3300028832|Ga0265298_10003495 | Not Available | 20721 | Open in IMG/M |
| 3300028832|Ga0265298_10055230 | All Organisms → Viruses → Predicted Viral | 4137 | Open in IMG/M |
| 3300029174|Ga0168029_115250 | Not Available | 590 | Open in IMG/M |
| 3300029319|Ga0183748_1003267 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 8528 | Open in IMG/M |
| 3300031226|Ga0307497_10389983 | Not Available | 663 | Open in IMG/M |
| 3300031565|Ga0307379_11167835 | Not Available | 641 | Open in IMG/M |
| 3300031576|Ga0247727_10002197 | All Organisms → cellular organisms → Bacteria | 44944 | Open in IMG/M |
| 3300032053|Ga0315284_10001513 | All Organisms → cellular organisms → Bacteria | 33135 | Open in IMG/M |
| 3300033233|Ga0334722_10024716 | Not Available | 5057 | Open in IMG/M |
| 3300033463|Ga0310690_12472441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Anaerotruncus → unclassified Anaerotruncus → Anaerotruncus sp. DFI.9.16 | 539 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 8.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 3.08% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.31% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.31% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.31% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.54% |
| Cattle And Sheep Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen | 1.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.77% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.77% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.77% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.77% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.77% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.77% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.77% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.77% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.77% |
| Aquarium Water | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water | 0.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.77% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.77% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.77% |
| Camel Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.77% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000385 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002597 | Camel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1 | Host-Associated | Open in IMG/M |
| 3300003142 | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf | Environmental | Open in IMG/M |
| 3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004074 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004186 | Groundwater microbial communities from aquifer - Crystal Geyser CG18_big_fil_WC_8/21/14_2.50 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020171 | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300021400 | Sheep rumen microbial communities from New Zealand - Tag 1265 SPADES assembly | Host-Associated | Open in IMG/M |
| 3300021431 | Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly | Host-Associated | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025825 | Groundwater microbial communities from aquifer - Crystal Geyser CG18_big_fil_WC_8/21/14_2.50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025970 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028591 | Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1770 DNA GHGhigh gp2 | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028797 | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04 | Host-Associated | Open in IMG/M |
| 3300028832 | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_01 | Host-Associated | Open in IMG/M |
| 3300028914 | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_03 | Host-Associated | Open in IMG/M |
| 3300029174 | Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ1 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031998 | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_03 (v2) | Host-Associated | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033463 | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04 (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03042710 | 2088090014 | Soil | MPVRKSKSGYKYGNSGKVYKGKGAKQKAAKQGRAIRASQAKRGK |
| GPICI_01798770 | 2088090015 | Soil | MPTRKTKGGGYKYGGSGKTYYGKGAKAKANKQGRAIRASQHKKK |
| FI_00914990 | 2166559006 | Grass Soil | MPVRKVGGGYRYGSKGKLYRGKGAKAKAAKQGRAIQVNKKH |
| deepsgr_01502540 | 2199352025 | Soil | MPVQKSKGGYKYGRSGKTYRGKGAKAKAAKQGRAIQASKAKR |
| ICChiseqgaiiDRAFT_089915312 | 3300000033 | Soil | MPTRKTKGGGYKYGGSGKTYYGKGAKAKANKQGRAIRASQHKKK* |
| ARSoilOldRDRAFT_0102591 | 3300000044 | Arabidopsis Rhizosphere | MSPVRKSGGGYKYGSGGKLYKGKGAKAKAAKQGRAIKASQ |
| INPhiseqgaiiFebDRAFT_1019677125 | 3300000364 | Soil | MPVRKSKSGYKYGNSGKVYKGKGAKQKAAKQGRAIRASQAKRGK* |
| INPhiseqgaiiFebDRAFT_1058690282 | 3300000364 | Soil | MPVRKTSGGYRYGKKGKLYKGKGAKAKATKQGRAIQASKAKRGKN* |
| PR_CR_10_Liq_1_inCRDRAFT_10354851 | 3300000385 | Enviromental | KSGYKWGKSGKCYTSNGKKKAARQGRAIKASMSRRK* |
| JGI10213J12805_100890931 | 3300000858 | Soil | MPVRKSGSGYKYGNEGKLYKGKGAKKKAAKQGRAI |
| WOR8_1000051271 | 3300001687 | Marine Sediment | MPVQKSGSGYRYGTKGKTYRGKGAKAKAKRQGRAIKASQARQGKSKK* |
| GOS2230_10413652 | 3300001960 | Marine | MPVMKSGRGYKYGTSGKTYKGQGAKKKAAKQGLAIQASKRRKRLKG* |
| JGI24033J26618_10196433 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRKHKGGYKYGNXGKLYKGKGAKAKATKQGRAIQASKRARDQKK* |
| KVRMV2_1016737431 | 3300002231 | Marine Sediment | MSYRLMPVRKVGSNKYQYGTHGKVYSGSGAKAKAAKQGRAIQTSKHKGKK* |
| JGI25128J35275_100038315 | 3300002488 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKATKQGLAIKSSQRRKRLKG* |
| C688J35102_1204814651 | 3300002568 | Soil | MPVKKTSGGGYKYGSSGKEYKGKGAKQKAAKQGRAIQASKKRKF* |
| DRAFT_1004505147 | 3300002597 | Camel Rumen | MPVKRTKGGGYRYGTKGKTYYGKGAKAKAEKQGRAIKANQARRKK* |
| Ga0052242_10156853 | 3300003142 | Marine Sediment | MPVQKAKGGYRYGRSGKVYRGKGAKKKAARQGRAIKVSQARRRKRKS* |
| Ga0063294_106566121 | 3300003885 | Hydrothermal Vents | MPVIKTKGGAKYGKGGKLYKGKGAVSRAKRQGRAIEASKHRKKKM* |
| JGI25405J52794_100576371 | 3300003911 | Tabebuia Heterophylla Rhizosphere | RKVKGGYQYGSSGKVYKGKGAKSRARKQGKAIRASQTRQKKKM* |
| Ga0055432_100164574 | 3300004022 | Natural And Restored Wetlands | MPVTKTRGGGYKYGRSGKTYYGKSAKAKATKQGRAINASKHGKK* |
| Ga0055518_100081623 | 3300004074 | Natural And Restored Wetlands | MPVKQCSGGHKFGNKGKCYKGKGSKAKAARQGRAIKASQAKRGK* |
| Ga0066647_103568681 | 3300004186 | Groundwater | VPVHKSGGGYKFGSHGKIYRGKGAKAKAARQGRAIQASKRLSKKR* |
| Ga0063356_1008035411 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPVHKVGTGYQYGKSGKLYKGKDAKAKAEKQGRAIQVSKARQRKAGKT* |
| Ga0062595_1000466883 | 3300004479 | Soil | MPVRKTGGGYRYGKKGKLYKGKGAKAKATKQGRAIQASKAKRAKS* |
| Ga0058863_117660831 | 3300004799 | Host-Associated | PVRKTGGGYKYGSKGKLYRGKGAKAKAARQGRAIQASKHRKGKK* |
| Ga0058862_103300563 | 3300004803 | Host-Associated | MPVRKTGGGYKYGSKGKLYRGKGAKAKAARQGRAIQASKHRKGKK* |
| Ga0072334_100159831 | 3300005086 | Water | MPVKCTKSGCRYGKKGKLYKGKTAKAKASRQGRAIKASQNKK* |
| Ga0066814_101053462 | 3300005162 | Soil | VKRKQGRSGCVMPVRKSGSGYKYGNKGKTYHGKGAKAKAAKQGRAIQASKHRKGNK* |
| Ga0070683_1001088962 | 3300005329 | Corn Rhizosphere | MMPVRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKRS* |
| Ga0070711_1000378747 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVKKTSGGGYKFGPTGKEYKGKGAKQKATKQGRAIQASKRARGK* |
| Ga0070681_101198283 | 3300005458 | Corn Rhizosphere | MPVRKTGGGYKYGTKGKLYRGKGAKAKAARQGRAIQASKHRKKK* |
| Ga0073909_1000154610 | 3300005526 | Surface Soil | MPVRKSKGGYKYGTTGKVYHGKGAKGRAAKQGRAIKANQNKK* |
| Ga0066903_1047141582 | 3300005764 | Tropical Forest Soil | MPVHKAKGGYQYGGKGKVYHGKGAKAKAARQGRAIKASQHKGKGK* |
| Ga0068863_1000090211 | 3300005841 | Switchgrass Rhizosphere | MPVRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKR* |
| Ga0075365_109438443 | 3300006038 | Populus Endosphere | MPVRKNKGGYQFGDTGKIYRGKGAKGKAAKQGRAIQASKRARGKK* |
| Ga0075422_105585762 | 3300006196 | Populus Rhizosphere | GWIGGGMPVRKVKGGYQYGSSGKVYHGKGAKSRAKKQGRAIKANQNKKRQ* |
| Ga0074050_105214482 | 3300006577 | Soil | MPVKKSGGGYKFGSKGKLYTGKGAKAKAARQGRAIKASQARRAKGGT* |
| Ga0098048_10355143 | 3300006752 | Marine | MPVRKVRGGFRFGSKGKVYHGKGARKKAVRQGRAIKARKHRK* |
| Ga0070749_1000561810 | 3300006802 | Aqueous | MPVKKVDGGYRWGEAGKLYTGAMAAQKAAKQGRAIKASQAKRKPKK* |
| Ga0075434_1005055313 | 3300006871 | Populus Rhizosphere | MPVRKVKGGYQYGSSGKVYHGKGAKSRAKRQSRAIKANQNKKK* |
| Ga0075434_1019563312 | 3300006871 | Populus Rhizosphere | MPIRKAKGGYQYGSGGKVYRGKGAKAKAAKQGRAIKANQKKRK* |
| Ga0070746_104250391 | 3300006919 | Aqueous | MPVTKAKGGYRYGTKGKTYRGKGAKAKATKQGRAIKASQKGRKY* |
| Ga0098036_10038415 | 3300006929 | Marine | MPVRKVRGGFRFGGKGKVYHGKGARKKAVRQGRAIKARQNRK* |
| Ga0110931_10083322 | 3300007963 | Marine | MPVRKVRGGFRFGSKGKVYHGKGARKKAVRQGRAIKARQNRK* |
| Ga0111539_112135442 | 3300009094 | Populus Rhizosphere | MPVRKVKGGYQYGSSGKVYHGKGAKSRAKKQGRAIKANQNKKRQ* |
| Ga0111538_110751953 | 3300009156 | Populus Rhizosphere | MPVKKTPGGGYKYGSKGKTYKGAGAKEKAAKQGRAIKASQAKRKK* |
| Ga0105242_106260132 | 3300009176 | Miscanthus Rhizosphere | MPVRKTKGGYQWGSSGKNYKGKGAKAKAAKQGRAIKASQNKK* |
| Ga0105242_122528022 | 3300009176 | Miscanthus Rhizosphere | MPVRKTKGGYQWGSSGKNYKGKGAKAKAAKQGRAIKANQGKK* |
| Ga0105242_123538482 | 3300009176 | Miscanthus Rhizosphere | MPVRKTKGGYQWGSSGKNYKGKDAKVKAAKQGRAIKANQGKK* |
| Ga0114925_103170343 | 3300009488 | Deep Subsurface | MPVRRSGKGYQYGESGKVYTGPGAKAKAEKQGRAIKHSQTRQAKKKK* |
| Ga0118657_103583603 | 3300009506 | Mangrove Sediment | MPVRKVPGGGYKYGSTGKTYHGKDAKAKAARQGRAIEASKHSKGKKK* |
| Ga0115012_114459661 | 3300009790 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKAAKQGLAIKSSQRRKRLKG* |
| Ga0126380_117068422 | 3300010043 | Tropical Forest Soil | MPVRRVRGGYRYGRRGKLYRGKGAKAKAARQGRAIE |
| Ga0136653_104831482 | 3300010319 | Anoxic Lake Water | LPVHKVRGGGYQYGTHGKVYRGAGAEAKAAKQGRAIK |
| Ga0136852_1000071527 | 3300010412 | Mangrove Sediment | VPIQKCNNGHKYGNTGKCYKGKGSRAKAARQGRAIEASKSKRGR* |
| Ga0136852_100367992 | 3300010412 | Mangrove Sediment | MPIRKCTGGYKYGKSGKCYKGKDGRQKAARQGRAIEASKASIKKR* |
| Ga0136851_122846942 | 3300010413 | Mangrove Sediment | MPVEKISGGYRWGKHGKIYRGKGAKAKAAAQGRAIEASKHSKK* |
| Ga0137424_100001623 | 3300011412 | Soil | MPVKRTKGGGYRYGKKGKTYYGSGAKAKAAKQGRAIKASQKGKGKK* |
| Ga0120191_100003304 | 3300012022 | Terrestrial | MPVRKTAGGGYQYGTKGKVYKGKGAKAKATRQGKAIKASQNKKK* |
| Ga0137382_109366612 | 3300012200 | Vadose Zone Soil | MPVKKSGGGYKYGNSGKTYKGKGAKAKAAKQGRAIRANQGKKK* |
| Ga0150985_1071927971 | 3300012212 | Avena Fatua Rhizosphere | RSQKTMPIRKNKGGYQYGTSGKVYRGKGAKAKAAKQGRAIEASRHSKKK* |
| Ga0150985_1114337522 | 3300012212 | Avena Fatua Rhizosphere | MPVKKTSGGGYKYGSSGKEYKGKGAKQKATKQGRAIQASKRAR* |
| Ga0150985_1138009791 | 3300012212 | Avena Fatua Rhizosphere | VPVKKTSGGGYKYGSSGKEYKGKGAKQKAAKQGRAIQASKKRKF* |
| Ga0150985_1141573229 | 3300012212 | Avena Fatua Rhizosphere | MPVRKNKGGFQYGSSGKVYKGKGAKAKAAKQGRAIQASKHAKK* |
| Ga0150984_1155795473 | 3300012469 | Avena Fatua Rhizosphere | MPVKKTSGGGYKYGSSGKEYKGKGAKQKAAKQGRAIQASKKKNFKE* |
| Ga0163180_106749313 | 3300012952 | Seawater | MPVMKSGRGYKYGTSGKTYKGKGAKKKATKQGLAIQASKRRKRLKG* |
| Ga0164313_104380281 | 3300013101 | Marine Sediment | MPVRCNKAGCKYGTKGKLYKGKGAKAKASRQGRAIKASQ |
| Ga0164313_106406322 | 3300013101 | Marine Sediment | MAMPVRCNKAGCKYGAKGKLYKGKGAKAKAFKQGRAIKASQARRKK* |
| Ga0164313_116277632 | 3300013101 | Marine Sediment | AMPVRCNKAGCKYGTKGKLYKGKGAKAKASRQGRAIKASQARRKK* |
| (restricted) Ga0172365_103486941 | 3300013127 | Sediment | MSPVHKSKGGWQWGRRGKVYRGKGAKARAARQGRAAY |
| Ga0172378_105491302 | 3300014203 | Groundwater | MPVKKCKGGYKYGSKGKCYKGSGAKSKAKRQGRAIKASKRK* |
| Ga0164310_101833451 | 3300014913 | Marine Sediment | NEIQQRGVAMPVRCNKAGCKYGTKGKLYKGKGAKAKASRQGRAIKASQARRKK* |
| Ga0120193_100769052 | 3300014965 | Terrestrial | MPVERVGGGARWGKRGKVYRGKGAAARAKRQGRAIKAAQARRGKRG |
| Ga0157379_106078232 | 3300014968 | Switchgrass Rhizosphere | MPIRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKRS* |
| Ga0132258_136129542 | 3300015371 | Arabidopsis Rhizosphere | MPVRKAKGGYQYGSSGKVYRGKGAKAKAAKQGRAIKANQKKRK* |
| Ga0132255_10002915813 | 3300015374 | Arabidopsis Rhizosphere | MPVRKTSGGYQYGKKGKLYKGKGAKAKATKQGRAIQASKAKRAKS* |
| Ga0181577_100061092 | 3300017951 | Salt Marsh | MPVKKVDGGYRWGESGKLYTGAMAAQKAAKQGRAIKASQAKRKPKK |
| Ga0184637_1000074210 | 3300018063 | Groundwater Sediment | MPVRRTKGGGYKFGTKGKTYKGKGAKAKAAKQGRAIKASRRGKK |
| Ga0184629_100072353 | 3300018084 | Groundwater Sediment | MPVRRTKGGGYKFGTKGKTYKGKGAKAKASRQGRAIKANRRGKK |
| Ga0190271_100236983 | 3300018481 | Soil | MPTKKTPGGGYQYGASGKVYRGKGAKAKADKQGRAIQASKHRRKPKS |
| Ga0187892_1000199850 | 3300019458 | Bio-Ooze | MPTEKVGTGYRYGKGGKVYRGKGAKAKADRQGRAIQASKARAVRKGSK |
| Ga0193701_10319003 | 3300019875 | Soil | MPVKKSGGGYKYGSSGKTYKGKGAKGKAAKQGRAIRASQGKKK |
| Ga0193741_10247112 | 3300019884 | Soil | MPVKRTKGGGYRYGTKGKTYYGKGAKGKASRQGRAIKASQKGKGKK |
| Ga0180732_10483022 | 3300020171 | Groundwater | MPVHKAKGGWRWGSHGKIYKGKNAKAKAAKQGQAVRASGWKGK |
| Ga0211558_1000271112 | 3300020439 | Marine | MPVMKSGRGYKYGTSGKTYKGQGAKKKAAKQGLAIQASKRRKRLKG |
| Ga0211625_100219909 | 3300020473 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKAAKQGLAIQASKRRKRLKG |
| Ga0224422_1146333632 | 3300021400 | Cattle And Sheep Rumen | MPVQRVDSGYRWGKSGKIYKGKGAKAKAEAQGRAIRASQKRKKR |
| Ga0224423_1000183547 | 3300021431 | Cattle And Sheep Rumen | MPVRRTKGGGYKYGSKGKTYYGKGAKARAARQGRAIQANKRRKSK |
| Ga0226832_102297882 | 3300021791 | Hydrothermal Vent Fluids | MPVKKSSGGYKYGSKGKTYRGKGAAAKAAKQGRAVKASQAKRRMR |
| Ga0222715_104241192 | 3300021960 | Estuarine Water | MPVKKVDGGYRWGEAGKLYTGAMAAQKAAKQGRAIKASQAKRKPKK |
| Ga0212020_10819144 | 3300022167 | Aqueous | GGYRWGEAGKLYTGAMAAQKAAKQGRAIKASQAKRKPKK |
| Ga0224512_100602383 | 3300022226 | Sediment | MPIKKVSGGYKYGSKGKTYHGKGAKAKAAKQGRAIKVSQARRGSQRGK |
| Ga0209232_100127415 | 3300025132 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKATKQGLAIKSSQRRKRLKG |
| Ga0209232_11200232 | 3300025132 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKAAKQGLAIKSSQRRKRLKG |
| Ga0210046_12961281 | 3300025825 | Groundwater | VPVHKSGGGYKFGSHGKIYRGKGAKAKAARQGRAIQASKR |
| Ga0207707_1000026824 | 3300025912 | Corn Rhizosphere | MPVRKTGGGYKYGSKGKLYRGKGAKAKAARQGRAIQASKHRKGKK |
| Ga0207707_102898322 | 3300025912 | Corn Rhizosphere | MPVRKTGGGYKYGTKGKLYRGKGAKAKAARQGRAIQASKHRKKK |
| Ga0207644_117033142 | 3300025931 | Switchgrass Rhizosphere | GYKYGNKGKLYKGKGAKKKAQKQGKAIQASKRARTLGHD |
| Ga0207686_1000110922 | 3300025934 | Miscanthus Rhizosphere | MPVRKTKGGYQWGSSGKNYKGKGAKAKAAKQGRAIKASQNKK |
| Ga0207686_100278894 | 3300025934 | Miscanthus Rhizosphere | MPVRKTKGGYQWGSSGKNYKGKGAKAKAAKQGRAIKANQGKK |
| Ga0207661_101389596 | 3300025944 | Corn Rhizosphere | MPVRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKRS |
| Ga0210081_10065533 | 3300025970 | Natural And Restored Wetlands | MPVKQCSGGHKFGNKGKCYKGKGSKAKAARQGRAIKASQAKRGK |
| Ga0207641_1001130213 | 3300026088 | Switchgrass Rhizosphere | MPVRKSGGGYKYGKSGKVYKGKGAKAKAAKQGRAIQASKHKKR |
| Ga0209742_101962212 | 3300027814 | Marine Sediment | MPVQKSGSGYRYGTKGKTYRGKGAKAKAKRQGRAIKASQARQGKSKK |
| Ga0209811_1000008912 | 3300027821 | Surface Soil | MPVRKSKGGYKYGTTGKVYHGKGAKGRAAKQGRAIKANQNKK |
| Ga0209515_100581881 | 3300027835 | Groundwater | ARAGRITKGGGYKRGGKGKLYKGKGAKAKAARQGRAIRSSEARAGKKRTKGT |
| Ga0207428_100709247 | 3300027907 | Populus Rhizosphere | MPIRKAKGGYQYGSGGKVYRGKGAKAKAAKQGRAIKANQKKRK |
| Ga0209536_1009894972 | 3300027917 | Marine Sediment | MPVRKTQGGYKYGTKGKLYKGKTAKAKAARQGRAIKSNQARGKRGC |
| Ga0209536_1021213942 | 3300027917 | Marine Sediment | MPVKPCSGGHKYGNKGKCYKGKGSKAKAERQGRAVRASQHKKRGKR |
| Ga0247611_100472014 | 3300028591 | Rumen | MPVRRTKGGGYKYGSKGKTYYGKGAKARAARQGRAIQANKRRRKK |
| Ga0247611_113258221 | 3300028591 | Rumen | KNQTERIIIMPVRRTKGGGYKYGSKGKTYYGKGAKAKAARQGRAIQANKSRRKKK |
| Ga0247820_100751851 | 3300028597 | Soil | MPVRKVGGGFRYGSRGKVYRGKGARAKAARQGRAPLPRYT |
| Ga0265293_104604962 | 3300028603 | Landfill Leachate | MPVKKCKGGYKYGSKGKCYKGSGAKSKAKRQGRAIKASKRK |
| Ga0265301_100062704 | 3300028797 | Rumen | MPVRRTKSGGYKYGSKGKTYYGKGAKSKAQRQGRAIKASQKRRGK |
| Ga0265301_100709383 | 3300028797 | Rumen | MPIRKTKSGGYKYGSKGKTYYGKGARKKALRQARAINVSKRKRSR |
| Ga0265301_108634362 | 3300028797 | Rumen | MPVRKTKSGGYKYGSKGKTYYGRGAKAKAAKQGRAIQASKRKRK |
| Ga0265298_1000349520 | 3300028832 | Rumen | MPVRRTKSSGYKYSKSGKTYYGKGAKRKAIKQGQAIAISKRKRK |
| Ga0265298_100552302 | 3300028832 | Rumen | MPVRRTKSGGYRYGTKGKTYYGKGAKAKAAKQGRAIQANKRRKK |
| Ga0265300_103114772 | 3300028914 | Rumen | MPVRRTKSGGYKYGKSGKTYYGKGAKRKAIKQGQAIAISKRKRK |
| Ga0168029_1152503 | 3300029174 | Aquarium Water | MPVRKTSGGYKYGNKGKLYKGKGAKAKATKQGRAIRASQAKKK |
| Ga0183748_100326714 | 3300029319 | Marine | MPVMKSGRGYKYGTSGKTYKGKGAKKKATKQGLAIQASKRRKRLKG |
| Ga0307497_103899832 | 3300031226 | Soil | MPVRKARGGYRYGSKGKLYKGKGAKAKAAKQGRAIQANKKH |
| Ga0307379_111678352 | 3300031565 | Soil | MPVKKANGGYKWGKSGKVYHGKNAKTKAAKQGRAIHARKKK |
| Ga0247727_1000219760 | 3300031576 | Biofilm | MPTEKAGSGYRYGKSGKTYTGKGAKAKADRQGRAIQASKARAAEGKTKR |
| Ga0310786_100538875 | 3300031998 | Rumen | MSVRRTKSGGYKYGKSGKTYYGKGAKRKAIKQGQAIAISKRKRK |
| Ga0315284_1000151318 | 3300032053 | Sediment | MPVRKAGGGYRYGTSGKVYRGKGASAKAARQGRAIKASQARRAKKR |
| Ga0334722_1002471611 | 3300033233 | Sediment | MPIYKITQKGKTGYRYGKHGKVYFGKTAKEKAEKQMRAIYASRARANK |
| Ga0310690_124724412 | 3300033463 | Rumen | MPVRKVKGGYRYGKTGKTYTGKGAKAKAARQGRAIKASQARRKG |
| Ga0310690_127431282 | 3300033463 | Rumen | MPIIKTKSGGYKFGKSGKTYFGKNAKNKAIKQMKAIKANQSKRRK |
| ⦗Top⦘ |