


| Basic Information | |
|---|---|
| Family ID | F062823 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MIELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.31 % |
| % of genes near scaffold ends (potentially truncated) | 25.38 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (38.462 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 4.62 |
| PF01541 | GIY-YIG | 2.31 |
| PF03237 | Terminase_6N | 2.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.54 % |
| Unclassified | root | N/A | 38.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10143647 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 890 | Open in IMG/M |
| 3300000199|SI39nov09_10mDRAFT_c1004127 | Not Available | 1481 | Open in IMG/M |
| 3300001460|JGI24003J15210_10065816 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300001973|GOS2217_10143547 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300002231|KVRMV2_100820408 | Not Available | 519 | Open in IMG/M |
| 3300002242|KVWGV2_10297833 | All Organisms → Viruses → environmental samples → uncultured virus | 624 | Open in IMG/M |
| 3300006026|Ga0075478_10215957 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 582 | Open in IMG/M |
| 3300006332|Ga0068500_1164833 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| 3300006735|Ga0098038_1076884 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300006735|Ga0098038_1100640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 997 | Open in IMG/M |
| 3300006735|Ga0098038_1158796 | Not Available | 749 | Open in IMG/M |
| 3300006735|Ga0098038_1190335 | Not Available | 668 | Open in IMG/M |
| 3300006735|Ga0098038_1207906 | Not Available | 631 | Open in IMG/M |
| 3300006735|Ga0098038_1221839 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006735|Ga0098038_1268086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 536 | Open in IMG/M |
| 3300006735|Ga0098038_1298094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 501 | Open in IMG/M |
| 3300006737|Ga0098037_1142550 | All Organisms → Viruses → environmental samples → uncultured virus | 808 | Open in IMG/M |
| 3300006737|Ga0098037_1149019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 786 | Open in IMG/M |
| 3300006737|Ga0098037_1152803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 774 | Open in IMG/M |
| 3300006737|Ga0098037_1201719 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 651 | Open in IMG/M |
| 3300006737|Ga0098037_1263234 | Not Available | 551 | Open in IMG/M |
| 3300006749|Ga0098042_1071113 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 912 | Open in IMG/M |
| 3300006749|Ga0098042_1176598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 516 | Open in IMG/M |
| 3300006752|Ga0098048_1107144 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006921|Ga0098060_1200901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 545 | Open in IMG/M |
| 3300006929|Ga0098036_1010332 | Not Available | 3030 | Open in IMG/M |
| 3300006929|Ga0098036_1017271 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300006929|Ga0098036_1230567 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 561 | Open in IMG/M |
| 3300006929|Ga0098036_1279473 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300007540|Ga0099847_1167588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 648 | Open in IMG/M |
| 3300007963|Ga0110931_1272522 | Not Available | 502 | Open in IMG/M |
| 3300008216|Ga0114898_1077580 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300008216|Ga0114898_1093767 | All Organisms → Viruses → environmental samples → uncultured virus | 904 | Open in IMG/M |
| 3300008217|Ga0114899_1071200 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300008217|Ga0114899_1073067 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300008219|Ga0114905_1133393 | Not Available | 839 | Open in IMG/M |
| 3300008219|Ga0114905_1169230 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 718 | Open in IMG/M |
| 3300008219|Ga0114905_1237811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 576 | Open in IMG/M |
| 3300009071|Ga0115566_10221212 | Not Available | 1146 | Open in IMG/M |
| 3300009077|Ga0115552_1421942 | All Organisms → Viruses → environmental samples → uncultured virus | 525 | Open in IMG/M |
| 3300009418|Ga0114908_1058147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1368 | Open in IMG/M |
| 3300009481|Ga0114932_10379871 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 840 | Open in IMG/M |
| 3300009496|Ga0115570_10199052 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 906 | Open in IMG/M |
| 3300009529|Ga0114919_10417819 | Not Available | 931 | Open in IMG/M |
| 3300009603|Ga0114911_1190538 | All Organisms → Viruses → environmental samples → uncultured virus | 561 | Open in IMG/M |
| 3300009604|Ga0114901_1094994 | Not Available | 948 | Open in IMG/M |
| 3300009703|Ga0114933_10258810 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300010148|Ga0098043_1042830 | Not Available | 1402 | Open in IMG/M |
| 3300010148|Ga0098043_1079996 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300010148|Ga0098043_1094357 | Not Available | 878 | Open in IMG/M |
| 3300010148|Ga0098043_1150401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 659 | Open in IMG/M |
| 3300010153|Ga0098059_1019227 | Not Available | 2801 | Open in IMG/M |
| 3300010153|Ga0098059_1263766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 662 | Open in IMG/M |
| 3300010316|Ga0136655_1160292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 671 | Open in IMG/M |
| 3300011013|Ga0114934_10317417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 700 | Open in IMG/M |
| 3300012920|Ga0160423_10057995 | Not Available | 2796 | Open in IMG/M |
| 3300012920|Ga0160423_10209728 | Not Available | 1355 | Open in IMG/M |
| 3300012920|Ga0160423_10285179 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300012920|Ga0160423_10945967 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 577 | Open in IMG/M |
| 3300012920|Ga0160423_11188711 | Not Available | 509 | Open in IMG/M |
| 3300012952|Ga0163180_10249680 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300012952|Ga0163180_10636004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 816 | Open in IMG/M |
| 3300012953|Ga0163179_10771936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 822 | Open in IMG/M |
| 3300012954|Ga0163111_11216356 | Not Available | 736 | Open in IMG/M |
| 3300017706|Ga0181377_1017740 | Not Available | 1589 | Open in IMG/M |
| 3300017706|Ga0181377_1026461 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300017720|Ga0181383_1063090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 995 | Open in IMG/M |
| 3300017721|Ga0181373_1004630 | Not Available | 2645 | Open in IMG/M |
| 3300017744|Ga0181397_1162648 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 567 | Open in IMG/M |
| 3300017749|Ga0181392_1211500 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 554 | Open in IMG/M |
| 3300017762|Ga0181422_1197710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 606 | Open in IMG/M |
| 3300017768|Ga0187220_1195288 | All Organisms → Viruses → environmental samples → uncultured virus | 610 | Open in IMG/M |
| 3300017779|Ga0181395_1133615 | All Organisms → Viruses → environmental samples → uncultured virus | 786 | Open in IMG/M |
| 3300020056|Ga0181574_10574330 | Not Available | 616 | Open in IMG/M |
| 3300020165|Ga0206125_10118939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1094 | Open in IMG/M |
| 3300020166|Ga0206128_1208308 | Not Available | 745 | Open in IMG/M |
| 3300020182|Ga0206129_10218329 | All Organisms → Viruses → environmental samples → uncultured virus | 828 | Open in IMG/M |
| 3300020246|Ga0211707_1012917 | Not Available | 1202 | Open in IMG/M |
| 3300020294|Ga0211520_1075972 | All Organisms → Viruses → environmental samples → uncultured virus | 528 | Open in IMG/M |
| 3300020417|Ga0211528_10263615 | Not Available | 650 | Open in IMG/M |
| 3300020428|Ga0211521_10082184 | All Organisms → Viruses → Predicted Viral | 1585 | Open in IMG/M |
| 3300020436|Ga0211708_10057139 | Not Available | 1505 | Open in IMG/M |
| 3300020436|Ga0211708_10154760 | Not Available | 913 | Open in IMG/M |
| 3300020469|Ga0211577_10223522 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300020474|Ga0211547_10495591 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 611 | Open in IMG/M |
| 3300021356|Ga0213858_10275028 | Not Available | 807 | Open in IMG/M |
| 3300021364|Ga0213859_10502240 | Not Available | 526 | Open in IMG/M |
| 3300022053|Ga0212030_1035572 | All Organisms → Viruses → environmental samples → uncultured virus | 698 | Open in IMG/M |
| 3300022055|Ga0224898_100097 | Not Available | 1091 | Open in IMG/M |
| 3300022900|Ga0255771_1091070 | Not Available | 1456 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10322454 | Not Available | 585 | Open in IMG/M |
| 3300024344|Ga0209992_10088005 | Not Available | 1409 | Open in IMG/M |
| 3300024344|Ga0209992_10124235 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300024344|Ga0209992_10177346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 915 | Open in IMG/M |
| 3300024344|Ga0209992_10268758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 704 | Open in IMG/M |
| 3300025070|Ga0208667_1035545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 866 | Open in IMG/M |
| 3300025099|Ga0208669_1056016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 890 | Open in IMG/M |
| 3300025102|Ga0208666_1000368 | All Organisms → Viruses | 22170 | Open in IMG/M |
| 3300025110|Ga0208158_1050832 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300025127|Ga0209348_1012721 | Not Available | 3307 | Open in IMG/M |
| 3300025127|Ga0209348_1029568 | All Organisms → Viruses | 1976 | Open in IMG/M |
| 3300025127|Ga0209348_1044802 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1519 | Open in IMG/M |
| 3300025127|Ga0209348_1056018 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300025127|Ga0209348_1058154 | Not Available | 1282 | Open in IMG/M |
| 3300025127|Ga0209348_1139701 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 719 | Open in IMG/M |
| 3300025127|Ga0209348_1212789 | All Organisms → Viruses → environmental samples → uncultured virus | 533 | Open in IMG/M |
| 3300025128|Ga0208919_1024655 | Not Available | 2222 | Open in IMG/M |
| 3300025132|Ga0209232_1063004 | Not Available | 1323 | Open in IMG/M |
| 3300025132|Ga0209232_1111419 | Not Available | 913 | Open in IMG/M |
| 3300025132|Ga0209232_1177600 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 663 | Open in IMG/M |
| 3300025151|Ga0209645_1012748 | Not Available | 3339 | Open in IMG/M |
| 3300025151|Ga0209645_1108959 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025151|Ga0209645_1158127 | Not Available | 694 | Open in IMG/M |
| 3300025151|Ga0209645_1170671 | Not Available | 659 | Open in IMG/M |
| 3300025168|Ga0209337_1251331 | All Organisms → Viruses → environmental samples → uncultured virus | 676 | Open in IMG/M |
| 3300025577|Ga0209304_1047099 | Not Available | 1153 | Open in IMG/M |
| 3300025685|Ga0209095_1137998 | Not Available | 723 | Open in IMG/M |
| 3300025822|Ga0209714_1105279 | Not Available | 776 | Open in IMG/M |
| 3300025869|Ga0209308_10446297 | All Organisms → Viruses → environmental samples → uncultured virus | 507 | Open in IMG/M |
| 3300025892|Ga0209630_10263100 | All Organisms → Viruses → environmental samples → uncultured virus | 803 | Open in IMG/M |
| 3300028022|Ga0256382_1069479 | Not Available | 833 | Open in IMG/M |
| 3300029309|Ga0183683_1011765 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300029309|Ga0183683_1052146 | Not Available | 576 | Open in IMG/M |
| 3300029318|Ga0185543_1066648 | Not Available | 738 | Open in IMG/M |
| 3300029318|Ga0185543_1090578 | Not Available | 601 | Open in IMG/M |
| 3300029319|Ga0183748_1032034 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300029319|Ga0183748_1058701 | Not Available | 1046 | Open in IMG/M |
| 3300029448|Ga0183755_1034364 | Not Available | 1447 | Open in IMG/M |
| 3300029787|Ga0183757_1021962 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300029787|Ga0183757_1042640 | All Organisms → Viruses → environmental samples → uncultured virus | 843 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.08% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.38% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.38% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.38% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.62% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.08% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.31% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.54% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.54% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.54% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.77% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000199 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10m | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022055 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 (v2) | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101436472 | 3300000101 | Marine | MIELLNLIFIESPVGLSIIFIVAIVIMGIEGYRSS* |
| SI39nov09_10mDRAFT_10041276 | 3300000199 | Marine | MIELLQIIFTESPKELSLILIAGITAIGIEGYRLLK* |
| JGI24003J15210_100658164 | 3300001460 | Marine | MIELLNLIFIESPIGLSIIFILAIVIMGIEGYRSS* |
| GOS2217_101435474 | 3300001973 | Marine | MIELFNILFIESPLGLSIILIVGIIALGIEGYRSS* |
| KVRMV2_1008204082 | 3300002231 | Marine Sediment | MIELLSIIFVESPIGLSVILVAGIVAIGIEGYRSS* |
| KVWGV2_102978332 | 3300002242 | Marine Sediment | MIELFNLIFVESPTGLSIILIIGLIAIGIEGYRSL* |
| Ga0075478_102159572 | 3300006026 | Aqueous | MIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0068500_11648333 | 3300006332 | Marine | MIELFNLIFVESPIGLSIILIVGLIAIGIEGYRSS* |
| Ga0098038_10768842 | 3300006735 | Marine | MIELFNLLFIESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0098038_11006403 | 3300006735 | Marine | MVELLSLIFMESPIGLSIILIVGIIAIGIEGYRSS* |
| Ga0098038_11587962 | 3300006735 | Marine | MIELLSIIFVESPIGLSVILLAGILALGYMGYKSS* |
| Ga0098038_11903352 | 3300006735 | Marine | MVELLSLIFVESPLGLSMILVGGILVLGYMGYKSS* |
| Ga0098038_12079063 | 3300006735 | Marine | ENGSWRGKGQNMIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS* |
| Ga0098038_12218391 | 3300006735 | Marine | IELLSIIFVESPIGLSVILLGGILALGYMGYKSS* |
| Ga0098038_12680862 | 3300006735 | Marine | MIELLNLIFIESPLGLSIIFIVAIVAMGIEGYRSS* |
| Ga0098038_12980942 | 3300006735 | Marine | MIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS* |
| Ga0098037_11425502 | 3300006737 | Marine | MIELFNIIFVESPIGLSIILIGGIVILGYMGYKSS* |
| Ga0098037_11490193 | 3300006737 | Marine | MIALLNLIFIESPIGLSIIFMVAIVALGIEGYRSS* |
| Ga0098037_11528031 | 3300006737 | Marine | KGQNMIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0098037_12017193 | 3300006737 | Marine | MIELLNLIFIESPIGLSIIFMVAIVALGIEGYRSS* |
| Ga0098037_12632341 | 3300006737 | Marine | SMIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0098042_10711133 | 3300006749 | Marine | NMIELLNLIFIESPIGLSIIFMVAIVALGIEGYRSS* |
| Ga0098042_11765982 | 3300006749 | Marine | MIELLSIIFVESPLGLSLIFIVALIALGIEGYRSS* |
| Ga0098048_11071444 | 3300006752 | Marine | TMVELLSLIFVESPLGLSMILVGGILVLGYMGYKSS* |
| Ga0098060_12009011 | 3300006921 | Marine | NMIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0098036_10103322 | 3300006929 | Marine | MIELLSIIFVESPIGLSIILLAGILVLGYMGYKSS* |
| Ga0098036_10172712 | 3300006929 | Marine | MVELLSLIFMESPIGLSIILVGGILVLGYMGYKSS* |
| Ga0098036_12305673 | 3300006929 | Marine | KNMIELLNLIFIESPIGLSIIFMVAIVALGIEGYRSS* |
| Ga0098036_12794731 | 3300006929 | Marine | MIELLSIIFVESPIGLSIILLAGILALGYMGYKSS* |
| Ga0099847_11675882 | 3300007540 | Aqueous | MIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0110931_12725222 | 3300007963 | Marine | DKNVIELLQLIFMESPIGLSIILIGGIIFIGIEGYRSS* |
| Ga0114898_10775803 | 3300008216 | Deep Ocean | MVELLSLIFMESPIGLSVILVAGIVAIGIEGYRSS* |
| Ga0114898_10937673 | 3300008216 | Deep Ocean | MIELLQLIFTESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0114899_10712003 | 3300008217 | Deep Ocean | MIELFNLIFVESPTGLSIILIVGIIAIGIEGYRSS* |
| Ga0114899_10730673 | 3300008217 | Deep Ocean | MIELFNLIFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0114905_11333933 | 3300008219 | Deep Ocean | ECGVYTMIELLSIIFVESPLGLSIILVAGILVLGYMGYKSS* |
| Ga0114905_11692303 | 3300008219 | Deep Ocean | MIELFNLIFVESPTGLSIIFIIALIAIGIEGYRSS* |
| Ga0114905_12378111 | 3300008219 | Deep Ocean | MIELLSIIFIESPMGLSIILLAGILALGYMGYKSS* |
| Ga0115566_102212123 | 3300009071 | Pelagic Marine | MIELLQIILTESPKELSLILIVGITAIGIEGYRLLK* |
| Ga0115552_14219422 | 3300009077 | Pelagic Marine | RKRKGQNMIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0114908_10581471 | 3300009418 | Deep Ocean | VYTMVELLSLIFMESPIGLSVILVAGIVAIGIEGYRSS* |
| Ga0114932_103798711 | 3300009481 | Deep Subsurface | CNWKGADKNMIELFNLIFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0115570_101990521 | 3300009496 | Pelagic Marine | RKGQNMIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0114919_104178192 | 3300009529 | Deep Subsurface | MIELLQIIFTESPKELSLILIVGITAIGIEGYRLLK* |
| Ga0114911_11905382 | 3300009603 | Deep Ocean | MIELFNLIFLESPTGLSIILIVGIIALGIEGYRSS* |
| Ga0114901_10949943 | 3300009604 | Deep Ocean | NMIELFNLIFVESPLGLSIILIVGIIAIGIEGYRSS* |
| Ga0114933_102588103 | 3300009703 | Deep Subsurface | MIELFNLIFVESPTGLSIILIVGLIAIGIEGYRSL* |
| Ga0098043_10428302 | 3300010148 | Marine | MIELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS* |
| Ga0098043_10799962 | 3300010148 | Marine | MIELLSIIFVESPLGLSLILIVGIIALGIEGYRSS* |
| Ga0098043_10943573 | 3300010148 | Marine | MIELLSIIFVESPIGLSIILVGGILVLGYMGYKSS* |
| Ga0098043_11504012 | 3300010148 | Marine | MIELLQLIFMESPIGLSIIMIVGIILIGIEGYKSS* |
| Ga0098059_10192274 | 3300010153 | Marine | MIELFSLIFVESPLGLSIIFIIALIAIGIEGYRSS* |
| Ga0098059_12637661 | 3300010153 | Marine | NMIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS* |
| Ga0136655_11602923 | 3300010316 | Freshwater To Marine Saline Gradient | MIELFNLLFVESPLGLSIILIVGIIALGIEGYKSS* |
| Ga0114934_103174171 | 3300011013 | Deep Subsurface | SIMIELFNLIFVESPTGLSIILIIGLIAIGIEGYRSS* |
| Ga0160423_100579952 | 3300012920 | Surface Seawater | MIELLNIIFVESPLGLSLIFIVALIALGIEGYRSS* |
| Ga0160423_102097283 | 3300012920 | Surface Seawater | MVELFNLIFVESPTGLSIILIVGIIAIGIEGYRSS* |
| Ga0160423_102851793 | 3300012920 | Surface Seawater | MVELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS* |
| Ga0160423_109459671 | 3300012920 | Surface Seawater | MVELFNLIFVESPLGLSIILIVGIIALGIEGYRSS* |
| Ga0160423_111887112 | 3300012920 | Surface Seawater | VMVELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS* |
| Ga0163180_102496805 | 3300012952 | Seawater | MIELFNLIFVESPIGLSLIFIVAIILIGIEGYRSS* |
| Ga0163180_106360043 | 3300012952 | Seawater | MIELLSIIFVESPLGLSIILIGGILVLGYMGYKSS* |
| Ga0163179_107719362 | 3300012953 | Seawater | MIELFNLLFIESPVGLSIIFIVGIIAIGIEGYRSS* |
| Ga0163111_112163563 | 3300012954 | Surface Seawater | MIELLNLIFVESPLGLSVILIAGIIAIGIEGYRSS* |
| Ga0181377_10177404 | 3300017706 | Marine | MIELLSIIFVESPLGLSLIFIVALIALGIEGYRSS |
| Ga0181377_10264612 | 3300017706 | Marine | MIELLNLIFIESPLGLSIIFIVAIVAMGIEGYRSS |
| Ga0181383_10630903 | 3300017720 | Seawater | MIELFNLLFIESPLGLSIIFIVGIIALGIEGYRSS |
| Ga0181373_10046306 | 3300017721 | Marine | MIELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS |
| Ga0181397_11626482 | 3300017744 | Seawater | MIELFNLLFIESPLGLSIIFIVGIIAIGIEGYRSS |
| Ga0181392_12115001 | 3300017749 | Seawater | NMIELFNLIFVESPTGLSIIFIIALIAIGIEGYRSS |
| Ga0181422_11977101 | 3300017762 | Seawater | GQNMIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS |
| Ga0187220_11952881 | 3300017768 | Seawater | NMIELFNLLFIESPLGLSIIFIVGIIAIGIEGYRSS |
| Ga0181395_11336152 | 3300017779 | Seawater | MIELFNLIFVESPTGLSIIFIIGIIAIGIEGYRSS |
| Ga0181574_105743301 | 3300020056 | Salt Marsh | MVELFNLIFVESPIGLSILLLGAIVCFGIMGYQADM |
| Ga0206125_101189394 | 3300020165 | Seawater | MIELLNLIFIESPVGLSIIFIVAIVIMGIEGYRSS |
| Ga0206128_12083082 | 3300020166 | Seawater | MIELLNLIFIESPIGLSIIFIVAIVIMGIEGYRSS |
| Ga0206129_102183292 | 3300020182 | Seawater | MIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0211707_10129173 | 3300020246 | Marine | MIELLSIIFVESPLGLSMILIAGILVLGYLGYKSS |
| Ga0211520_10759721 | 3300020294 | Marine | MIELFNLIFVESPTGLSIILIVGIIAIGIEGYRSS |
| Ga0211528_102636154 | 3300020417 | Marine | MIELFNIIFMESPIGLSIILVGGILVLGYMGYKSS |
| Ga0211521_100821842 | 3300020428 | Marine | MIELLSIIFVESPIGLSVILLAGILALGYMGYKSS |
| Ga0211708_100571392 | 3300020436 | Marine | MIELLSIIFVESPIGLSIILVGGILVLGYMGYKSS |
| Ga0211708_101547602 | 3300020436 | Marine | MIELLSIIFVESPLGLSIILVGGILVLGYMGYKSS |
| Ga0211577_102235223 | 3300020469 | Marine | MIELLNLIFIESPIGLSIIFILAIVIMGIEGYRSS |
| Ga0211547_104955911 | 3300020474 | Marine | DKNMIELFNLIFVESPTGLSIILIVGIIAIGIEGYRSS |
| Ga0213858_102750283 | 3300021356 | Seawater | MVELFNLIFVESPIGLSIILIVGIIAIGIEGYRSS |
| Ga0213859_105022403 | 3300021364 | Seawater | MVELFNLIFVESPIGLSIILIGAIICFGLMGYYADKADSFS |
| Ga0212030_10355722 | 3300022053 | Aqueous | MIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS |
| Ga0224898_1000972 | 3300022055 | Seawater | MIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS |
| Ga0255771_10910701 | 3300022900 | Salt Marsh | MVELFNLIFVESPLGLSILLIGAIICFGLMGYYADKAD |
| (restricted) Ga0233438_103224542 | 3300024255 | Seawater | MIELLQIIFTESPKELSLILIAGITAIGIEGYRLLK |
| Ga0209992_100880052 | 3300024344 | Deep Subsurface | MVELLSLIFMESPIGLSVILVAGIVAIGIEGYRSS |
| Ga0209992_101242353 | 3300024344 | Deep Subsurface | MIELFNLIFVESPTGLSIIFIIALIAIGIEGYRSS |
| Ga0209992_101773462 | 3300024344 | Deep Subsurface | MIELFNLIFVESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0209992_102687583 | 3300024344 | Deep Subsurface | MIELLQLIFTESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0208667_10355453 | 3300025070 | Marine | MIELLNLIFIESPIGLSIIFMVAIVALGIEGYRSS |
| Ga0208669_10560164 | 3300025099 | Marine | GQNMIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS |
| Ga0208666_100036820 | 3300025102 | Marine | MIELFNLLFIESPLGLSIIFIIALIAIGIEGYRSS |
| Ga0208158_10508323 | 3300025110 | Marine | VIELLNLIFIESPIGLSIIFIVAIVAMGIEGYRSS |
| Ga0209348_10127214 | 3300025127 | Marine | MVELLSLIFMESPIGLSVILIAGIIAIGIEGYRSS |
| Ga0209348_10295684 | 3300025127 | Marine | MIELFNLIFIESPIGLSIIFIVAIVAMGIEGYRSS |
| Ga0209348_10448023 | 3300025127 | Marine | MIELFNLLFIESPLGLSIILIVGIIALGIEGYRSS |
| Ga0209348_10560183 | 3300025127 | Marine | MIELLSLIFMESPIGLSVILIAGIIAFGIEGYRSS |
| Ga0209348_10581543 | 3300025127 | Marine | MVELLFIIFVESPIGLSIILIAGIIALGIEGYRSS |
| Ga0209348_11397012 | 3300025127 | Marine | MIELLNLIFIESPLGLSIIFMVAIVAMGIEGYRSS |
| Ga0209348_12127892 | 3300025127 | Marine | MIDLLSLIFVESPTGLSIIFIIALIAIGIEGYRSS |
| Ga0208919_10246553 | 3300025128 | Marine | MVELLSLIFMESPIGLSIILIVGIIAIGIEGYRSS |
| Ga0209232_10630042 | 3300025132 | Marine | MIELFNLIFVESPTGLSIILIIGLIAIGIEGYRSS |
| Ga0209232_11114193 | 3300025132 | Marine | MVELFNLIFVESPTGLSIILIVGIIAIGIEGYRSS |
| Ga0209232_11776002 | 3300025132 | Marine | MIELFNLIFVESPLGLSIILIVGIIALGIEGYRSS |
| Ga0209645_10127483 | 3300025151 | Marine | MIELLSIIFVESPLGLSIILIGGILVLGYMGYKSS |
| Ga0209645_11089592 | 3300025151 | Marine | MIELLSIIFVESPIGLSVILLGGILALGYMGYKSS |
| Ga0209645_11581272 | 3300025151 | Marine | MIELLSIIFVESPIGLSIILIGGILVLGYMGYKSS |
| Ga0209645_11706712 | 3300025151 | Marine | MVELLSIIFVESPIGLSIILVGGILVLGYMGYKSS |
| Ga0209337_12513313 | 3300025168 | Marine | NMIELFNLLFVESPLGLSIILIVGIIALGIEGYRSS |
| Ga0209304_10470993 | 3300025577 | Pelagic Marine | MIELLQIILTESPKELSLILIVGITAIGIEGYRLLK |
| Ga0209095_11379984 | 3300025685 | Pelagic Marine | DRKMIELLQIILTESPKELSLILIVGITAIGIEGYRLLK |
| Ga0209714_11052791 | 3300025822 | Pelagic Marine | MIELIHLIFVESPIGLSILLLGIVFIGIMGYRADMQDTF |
| Ga0209308_104462971 | 3300025869 | Pelagic Marine | ENGCRRGKGQNMIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0209630_102631003 | 3300025892 | Pelagic Marine | GSSMIELFNLLFVESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0256382_10694793 | 3300028022 | Seawater | GEGQNMIELLQLIFTESPLGLSIILIVGIIAIGIEGYRSS |
| Ga0183683_10117654 | 3300029309 | Marine | MIELLSIIFVESPLGLSLILIVGIIALGIEGYRSS |
| Ga0183683_10521462 | 3300029309 | Marine | MIELLQLIFMESPIGLSIIMIVGIIAIGIEGYRSS |
| Ga0185543_10666483 | 3300029318 | Marine | MVELFNLIFVESPTGLSIILIVGIIAIGIEGYKSS |
| Ga0185543_10905781 | 3300029318 | Marine | DKNMIELLSIIFVESPIGLSIILVGGILVLGYMGYKSS |
| Ga0183748_10320343 | 3300029319 | Marine | MIELLNLIFVESPIGLSIIFIVAIVVMGIEGYRSS |
| Ga0183748_10587012 | 3300029319 | Marine | MIELLSIIFVESPLGLSVILVGGIVVLGYMGYKSS |
| Ga0183755_10343643 | 3300029448 | Marine | MIELLSIIFVESPIGLSIILLAGILVLGYMGYKSS |
| Ga0183757_10219622 | 3300029787 | Marine | MIELLSIIFVESPLGLSVILIAGIIAIGIEGYRSS |
| Ga0183757_10426402 | 3300029787 | Marine | MIELFNLLFIESPVGLSIIFIVGIIAIGIEGYRSS |
| ⦗Top⦘ |