


| Basic Information | |
|---|---|
| Family ID | F062771 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI |
| Number of Associated Samples | 46 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.08 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 70.00 % |
| Associated GOLD sequencing projects | 43 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.615 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (22.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (33.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.00% β-sheet: 0.00% Coil/Unstructured: 65.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF02574 | S-methyl_trans | 2.31 |
| PF13286 | HD_assoc | 2.31 |
| PF11898 | DUF3418 | 2.31 |
| PF00795 | CN_hydrolase | 2.31 |
| PF00873 | ACR_tran | 1.54 |
| PF16921 | Tex_YqgF | 1.54 |
| PF01075 | Glyco_transf_9 | 1.54 |
| PF02518 | HATPase_c | 1.54 |
| PF13549 | ATP-grasp_5 | 1.54 |
| PF13517 | FG-GAP_3 | 1.54 |
| PF02653 | BPD_transp_2 | 1.54 |
| PF00814 | TsaD | 1.54 |
| PF00072 | Response_reg | 1.54 |
| PF00753 | Lactamase_B | 1.54 |
| PF00905 | Transpeptidase | 1.54 |
| PF05140 | ResB | 1.54 |
| PF00501 | AMP-binding | 0.77 |
| PF13561 | adh_short_C2 | 0.77 |
| PF01979 | Amidohydro_1 | 0.77 |
| PF00155 | Aminotran_1_2 | 0.77 |
| PF00578 | AhpC-TSA | 0.77 |
| PF02540 | NAD_synthase | 0.77 |
| PF13624 | SurA_N_3 | 0.77 |
| PF00005 | ABC_tran | 0.77 |
| PF00939 | Na_sulph_symp | 0.77 |
| PF00691 | OmpA | 0.77 |
| PF01012 | ETF | 0.77 |
| PF13366 | PDDEXK_3 | 0.77 |
| PF01266 | DAO | 0.77 |
| PF00857 | Isochorismatase | 0.77 |
| PF10502 | Peptidase_S26 | 0.77 |
| PF02464 | CinA | 0.77 |
| PF11734 | TilS_C | 0.77 |
| PF08282 | Hydrolase_3 | 0.77 |
| PF06325 | PrmA | 0.77 |
| PF13847 | Methyltransf_31 | 0.77 |
| PF06245 | DUF1015 | 0.77 |
| PF13426 | PAS_9 | 0.77 |
| PF01668 | SmpB | 0.77 |
| PF04055 | Radical_SAM | 0.77 |
| PF00571 | CBS | 0.77 |
| PF08669 | GCV_T_C | 0.77 |
| PF02586 | SRAP | 0.77 |
| PF00012 | HSP70 | 0.77 |
| PF03372 | Exo_endo_phos | 0.77 |
| PF13671 | AAA_33 | 0.77 |
| PF04945 | YHS | 0.77 |
| PF12838 | Fer4_7 | 0.77 |
| PF08734 | GYD | 0.77 |
| PF02769 | AIRS_C | 0.77 |
| PF00300 | His_Phos_1 | 0.77 |
| PF00459 | Inositol_P | 0.77 |
| PF07729 | FCD | 0.77 |
| PF13458 | Peripla_BP_6 | 0.77 |
| PF00365 | PFK | 0.77 |
| PF01761 | DHQ_synthase | 0.77 |
| PF16576 | HlyD_D23 | 0.77 |
| PF13186 | SPASM | 0.77 |
| PF03454 | MoeA_C | 0.77 |
| PF16363 | GDP_Man_Dehyd | 0.77 |
| PF06414 | Zeta_toxin | 0.77 |
| PF12146 | Hydrolase_4 | 0.77 |
| PF12092 | DUF3568 | 0.77 |
| PF07478 | Dala_Dala_lig_C | 0.77 |
| PF13424 | TPR_12 | 0.77 |
| PF01476 | LysM | 0.77 |
| PF03599 | CdhD | 0.77 |
| PF03641 | Lysine_decarbox | 0.77 |
| PF13185 | GAF_2 | 0.77 |
| PF07685 | GATase_3 | 0.77 |
| PF13857 | Ank_5 | 0.77 |
| PF01734 | Patatin | 0.77 |
| PF02801 | Ketoacyl-synt_C | 0.77 |
| PF00908 | dTDP_sugar_isom | 0.77 |
| PF03692 | CxxCxxCC | 0.77 |
| PF14748 | P5CR_dimer | 0.77 |
| PF01171 | ATP_bind_3 | 0.77 |
| PF13229 | Beta_helix | 0.77 |
| PF00482 | T2SSF | 0.77 |
| PF00933 | Glyco_hydro_3 | 0.77 |
| PF13404 | HTH_AsnC-type | 0.77 |
| PF13440 | Polysacc_synt_3 | 0.77 |
| PF01039 | Carboxyl_trans | 0.77 |
| PF12806 | Acyl-CoA_dh_C | 0.77 |
| PF08328 | ASL_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 2.31 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 2.31 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 1.54 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 1.54 |
| COG1333 | Cytochrome c biogenesis protein ResB | Posttranslational modification, protein turnover, chaperones [O] | 1.54 |
| COG0015 | Adenylosuccinate lyase | Nucleotide transport and metabolism [F] | 0.77 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.77 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.77 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.77 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.77 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.77 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.77 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.77 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.77 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.77 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.77 |
| COG1456 | CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.77 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.77 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.77 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.77 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.77 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.77 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.77 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.77 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.77 |
| COG2069 | CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.77 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.77 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.77 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.77 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.77 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.77 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.77 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.77 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.77 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.77 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.62 % |
| Unclassified | root | N/A | 25.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000118|TDF_OR_ARG05_123mDRAFT_c1017239 | Not Available | 594 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1058696 | Not Available | 762 | Open in IMG/M |
| 3300003458|DC05A_1276760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 577 | Open in IMG/M |
| 3300003769|Ga0049118_10000006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 67161 | Open in IMG/M |
| 3300003769|Ga0049118_10000090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 28433 | Open in IMG/M |
| 3300003769|Ga0049118_10010582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2361 | Open in IMG/M |
| 3300003843|Ga0049117_10007643 | Not Available | 1905 | Open in IMG/M |
| 3300003944|Ga0049119_1022576 | Not Available | 2781 | Open in IMG/M |
| 3300005588|Ga0070728_10247067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 982 | Open in IMG/M |
| 3300005588|Ga0070728_10336655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 809 | Open in IMG/M |
| 3300005589|Ga0070729_10293461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 918 | Open in IMG/M |
| 3300005589|Ga0070729_10516723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 653 | Open in IMG/M |
| 3300005589|Ga0070729_10610349 | Not Available | 591 | Open in IMG/M |
| 3300005589|Ga0070729_10682406 | Not Available | 552 | Open in IMG/M |
| 3300005589|Ga0070729_10746235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
| 3300005871|Ga0056124_1000138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 27133 | Open in IMG/M |
| 3300006467|Ga0099972_10653324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 676 | Open in IMG/M |
| 3300006467|Ga0099972_10665693 | Not Available | 527 | Open in IMG/M |
| 3300006467|Ga0099972_10903878 | Not Available | 620 | Open in IMG/M |
| 3300006467|Ga0099972_12495056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1131 | Open in IMG/M |
| 3300006467|Ga0099972_12827045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 1007 | Open in IMG/M |
| 3300006467|Ga0099972_13242366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4860 | Open in IMG/M |
| 3300009035|Ga0102958_1192352 | Not Available | 677 | Open in IMG/M |
| 3300010392|Ga0118731_100624002 | Not Available | 1685 | Open in IMG/M |
| 3300010392|Ga0118731_102097766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1018 | Open in IMG/M |
| 3300010392|Ga0118731_102927618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5164 | Open in IMG/M |
| 3300010392|Ga0118731_103307068 | Not Available | 1455 | Open in IMG/M |
| 3300010392|Ga0118731_105630482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2218 | Open in IMG/M |
| 3300010392|Ga0118731_106327257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 5225 | Open in IMG/M |
| 3300010392|Ga0118731_106334406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 936 | Open in IMG/M |
| 3300010392|Ga0118731_106350666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 5383 | Open in IMG/M |
| 3300010392|Ga0118731_106357592 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 3077 | Open in IMG/M |
| 3300010392|Ga0118731_106361795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2087 | Open in IMG/M |
| 3300010392|Ga0118731_106381122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3774 | Open in IMG/M |
| 3300010392|Ga0118731_107214357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3 | 637 | Open in IMG/M |
| 3300010392|Ga0118731_107706406 | Not Available | 813 | Open in IMG/M |
| 3300010392|Ga0118731_108531878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 6100 | Open in IMG/M |
| 3300010392|Ga0118731_108603719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1443 | Open in IMG/M |
| 3300010392|Ga0118731_109084447 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300010392|Ga0118731_112616625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3481 | Open in IMG/M |
| 3300010392|Ga0118731_114908649 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 2364 | Open in IMG/M |
| 3300010430|Ga0118733_100032880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11399 | Open in IMG/M |
| 3300010430|Ga0118733_100112992 | All Organisms → cellular organisms → Bacteria | 5460 | Open in IMG/M |
| 3300010430|Ga0118733_100136077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4913 | Open in IMG/M |
| 3300010430|Ga0118733_100162846 | Not Available | 4444 | Open in IMG/M |
| 3300010430|Ga0118733_100178133 | All Organisms → cellular organisms → Bacteria | 4226 | Open in IMG/M |
| 3300010430|Ga0118733_100455083 | Not Available | 2539 | Open in IMG/M |
| 3300010430|Ga0118733_101344513 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010430|Ga0118733_101940148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1171 | Open in IMG/M |
| 3300010430|Ga0118733_103219483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 891 | Open in IMG/M |
| 3300010430|Ga0118733_104503228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 743 | Open in IMG/M |
| 3300011262|Ga0151668_1139904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1332 | Open in IMG/M |
| 3300017990|Ga0180436_10848597 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300022202|Ga0224498_10167818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 646 | Open in IMG/M |
| 3300022206|Ga0224499_10034904 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1623 | Open in IMG/M |
| 3300022206|Ga0224499_10331783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13 | 513 | Open in IMG/M |
| 3300022220|Ga0224513_10224149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 740 | Open in IMG/M |
| 3300022308|Ga0224504_10209186 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10033658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1428 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10418258 | Not Available | 569 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10038027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1783 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10195166 | Not Available | 844 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10457678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 555 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10007210 | Not Available | 2674 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10117058 | Not Available | 764 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10133566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 727 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10254234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 566 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10345431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 501 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10026561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2110 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10031967 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10115053 | Not Available | 1160 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10147854 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10157684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1009 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10231255 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10297198 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10501792 | Not Available | 581 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10613080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 524 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10651037 | Not Available | 508 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10049739 | Not Available | 1397 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10052072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1372 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10073046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1198 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10153620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 876 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10159144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 862 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10263333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 686 | Open in IMG/M |
| 3300025883|Ga0209456_10398046 | Not Available | 556 | Open in IMG/M |
| 3300027098|Ga0209367_1019478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7784 | Open in IMG/M |
| 3300027175|Ga0209146_1000206 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 19215 | Open in IMG/M |
| 3300027175|Ga0209146_1000841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 9477 | Open in IMG/M |
| 3300027175|Ga0209146_1026438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3073 | Open in IMG/M |
| 3300027175|Ga0209146_1038043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2586 | Open in IMG/M |
| 3300027828|Ga0209692_10351657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10096375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231 | 977 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10122900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 877 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10147006 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10377642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13 | 520 | Open in IMG/M |
| 3300027845|Ga0209271_10294430 | Not Available | 650 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10086235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum | 1561 | Open in IMG/M |
| 3300027917|Ga0209536_100027947 | All Organisms → cellular organisms → Bacteria | 7724 | Open in IMG/M |
| 3300027917|Ga0209536_100059830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4950 | Open in IMG/M |
| 3300027917|Ga0209536_100065983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5 | 4679 | Open in IMG/M |
| 3300027917|Ga0209536_100092960 | All Organisms → cellular organisms → Bacteria | 3850 | Open in IMG/M |
| 3300027917|Ga0209536_100096008 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 3779 | Open in IMG/M |
| 3300027917|Ga0209536_100214289 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300027917|Ga0209536_100352010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1841 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10067057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1407 | Open in IMG/M |
| 3300028598|Ga0265306_10003714 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 7351 | Open in IMG/M |
| 3300028598|Ga0265306_10833264 | Not Available | 511 | Open in IMG/M |
| 3300028599|Ga0265309_10052801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2270 | Open in IMG/M |
| 3300028599|Ga0265309_10161131 | Not Available | 1381 | Open in IMG/M |
| 3300028599|Ga0265309_10644495 | Not Available | 715 | Open in IMG/M |
| 3300028600|Ga0265303_10243158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1390 | Open in IMG/M |
| 3300032251|Ga0316198_10077485 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300032252|Ga0316196_10277586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 731 | Open in IMG/M |
| 3300032252|Ga0316196_10319262 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032258|Ga0316191_10068315 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
| 3300032258|Ga0316191_10166424 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1611 | Open in IMG/M |
| 3300032258|Ga0316191_10169593 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300032258|Ga0316191_10442780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 945 | Open in IMG/M |
| 3300032258|Ga0316191_10592543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300032258|Ga0316191_11004070 | Not Available | 604 | Open in IMG/M |
| 3300032259|Ga0316190_10342270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1020 | Open in IMG/M |
| 3300032260|Ga0316192_10634290 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300032262|Ga0316194_10078578 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
| 3300032262|Ga0316194_10102289 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1850 | Open in IMG/M |
| 3300032262|Ga0316194_10258900 | Not Available | 1108 | Open in IMG/M |
| 3300032262|Ga0316194_10295799 | Not Available | 1028 | Open in IMG/M |
| 3300032262|Ga0316194_10575551 | Not Available | 709 | Open in IMG/M |
| 3300032272|Ga0316189_10875553 | Not Available | 682 | Open in IMG/M |
| 3300033429|Ga0316193_10238907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1439 | Open in IMG/M |
| 3300033429|Ga0316193_11461020 | Not Available | 542 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 22.31% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 18.46% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 14.62% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 7.69% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 7.69% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 6.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 5.38% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 4.62% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.31% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.77% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300003458 | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A | Environmental | Open in IMG/M |
| 3300003769 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2 | Host-Associated | Open in IMG/M |
| 3300003843 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1 | Host-Associated | Open in IMG/M |
| 3300003944 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND | Host-Associated | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005871 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND | Host-Associated | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027098 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027175 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG05_123mDRAFT_10172392 | 3300000118 | Marine | KGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI* |
| TDF_OR_ARG05_123mDRAFT_10586961 | 3300000242 | Marine | KGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| DC05A_12767602 | 3300003458 | Marine Sediment | FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI* |
| Ga0049118_100000069 | 3300003769 | Marine Gutless Worms Symbiont | MGFDVGGVNPPEADKLFEELATSSWNLAAGSETPEKGHPNEPI* |
| Ga0049118_1000009024 | 3300003769 | Marine Gutless Worms Symbiont | LGSDIAHFRGKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKGHRSE |
| Ga0049118_100105821 | 3300003769 | Marine Gutless Worms Symbiont | LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRSE |
| Ga0049117_100076433 | 3300003843 | Marine Gutless Worms Symbiont | LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRR |
| Ga0049119_10225761 | 3300003944 | Marine Gutless Worms Symbiont | LGSDIAHFRGKGFDTGGVKNFKLFEEHATSSWNLAAGVETPEKGHR |
| Ga0070728_102470671 | 3300005588 | Marine Sediment | KKGFDTGGVKNSKLFEELATSSWNLDAGVQTPERGLRSEPI* |
| Ga0070728_103366551 | 3300005588 | Marine Sediment | DTGGVNPPEADKLFEELATSSWNLAAGVQTSEKRHRSEPI* |
| Ga0070729_102934611 | 3300005589 | Marine Sediment | RKKGFDTGGVKNSKLFEELATSSWNLVAGVQTPEKGHRSEPI* |
| Ga0070729_105167232 | 3300005589 | Marine Sediment | DTGDVKNSKLFEELATSSWNLAAGVQTPETGHRSEPI* |
| Ga0070729_106103491 | 3300005589 | Marine Sediment | TGGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI* |
| Ga0070729_106824061 | 3300005589 | Marine Sediment | LFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI* |
| Ga0070729_107462352 | 3300005589 | Marine Sediment | VSDIAPFGIRVFYTGGVKNSKLFEELATSSWNLAAGIETPEKGHRSEPI* |
| Ga0056124_100013819 | 3300005871 | Marine Gutless Worms Symbiont | LGSDIAHFRGKGFDTGGVNPPEADKLFEELATSSWNLAAGIETPEKGHRSEPI* |
| Ga0099972_106533242 | 3300006467 | Marine | CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGLRSEPI* |
| Ga0099972_106656932 | 3300006467 | Marine | DTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI* |
| Ga0099972_109038782 | 3300006467 | Marine | FIDSLVKVGLGSDIASFKKGFDTGGVKNSKLFEELATSSWNLATGVRTPERGHRSEPI* |
| Ga0099972_124950561 | 3300006467 | Marine | PNWLAPVPPFGGLDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI* |
| Ga0099972_128270452 | 3300006467 | Marine | IGERHCPFRKKGFGTGGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI* |
| Ga0099972_132423668 | 3300006467 | Marine | RHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI* |
| Ga0102958_11923521 | 3300009035 | Soil | HCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI* |
| Ga0118731_1006240021 | 3300010392 | Marine | GVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI* |
| Ga0118731_1020977663 | 3300010392 | Marine | CLFRKKGFDTGGVKNSKLFEELATSSWNLAPGVEIPERGHRSEPV* |
| Ga0118731_1029276181 | 3300010392 | Marine | ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGLRSEPI* |
| Ga0118731_1033070681 | 3300010392 | Marine | ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118731_1056304824 | 3300010392 | Marine | TGGVNPPEADKLFEELATSSWNLAAGVQTPERGHRSEPI* |
| Ga0118731_1063272575 | 3300010392 | Marine | GGVNPPEADKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118731_1063344062 | 3300010392 | Marine | GGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI* |
| Ga0118731_1063506661 | 3300010392 | Marine | GGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118731_1063575921 | 3300010392 | Marine | GGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI* |
| Ga0118731_1063617955 | 3300010392 | Marine | GGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI* |
| Ga0118731_1063811223 | 3300010392 | Marine | GGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI* |
| Ga0118731_1072143571 | 3300010392 | Marine | VNPPEADKLFEELATSSWNLAAGVQTPERGHRSEPI* |
| Ga0118731_1077064061 | 3300010392 | Marine | FDTGGVNPPEADKLFEELATSSWNLAAGVQTSEKRHRSEPI* |
| Ga0118731_1085318788 | 3300010392 | Marine | GERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI* |
| Ga0118731_1086037193 | 3300010392 | Marine | GVKNSKLFEELATSSWNLADGVETPERGHRSEPI* |
| Ga0118731_1090844471 | 3300010392 | Marine | GVKNSKLFEELATSSWNLAAGVETPERGHRNEPI* |
| Ga0118731_1126166251 | 3300010392 | Marine | KKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI* |
| Ga0118731_1149086491 | 3300010392 | Marine | HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI* |
| Ga0118733_10003288014 | 3300010430 | Marine Sediment | GVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118733_1001129921 | 3300010430 | Marine Sediment | TGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118733_1001360775 | 3300010430 | Marine Sediment | FDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI* |
| Ga0118733_1001628461 | 3300010430 | Marine Sediment | FRKKGFDTGDVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI* |
| Ga0118733_1001781331 | 3300010430 | Marine Sediment | ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLDAGVQTPERGHRSEPI* |
| Ga0118733_1004550834 | 3300010430 | Marine Sediment | PFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI* |
| Ga0118733_1013445132 | 3300010430 | Marine Sediment | ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI* |
| Ga0118733_1019401482 | 3300010430 | Marine Sediment | GDVKNSKLFEELATSSWNLAAGVETPERRHRSEPI* |
| Ga0118733_1032194831 | 3300010430 | Marine Sediment | ERHCRFRKKGFDTGGVNPPEADKLFEELATSSWNLVAGVQTPERGQQSEPI* |
| Ga0118733_1045032281 | 3300010430 | Marine Sediment | KKGLDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSETI* |
| Ga0151668_11399041 | 3300011262 | Marine | FRKKGFGTGGVKNSKLFEELATSSWNLAAGVETPEKGHRSESI* |
| Ga0180436_108485971 | 3300017990 | Hypersaline Lake Sediment | SDIGRFRKQSFASGGVKKPKLFEELATSSWDLAPGWETPETGRRSEPI |
| Ga0224498_101678181 | 3300022202 | Sediment | GGVKNSKLFEELATSSWNLAAGVQTPERGHRSKPI |
| Ga0224499_100349041 | 3300022206 | Sediment | FDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| Ga0224499_103317832 | 3300022206 | Sediment | CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| Ga0224513_102241492 | 3300022220 | Sediment | LRKKGFDTGGVKNSKLFEELATSSWNLAAGVATPERGHRS |
| Ga0224504_102091861 | 3300022308 | Sediment | RHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0233409_100336581 | 3300022938 | Seawater | TGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI |
| (restricted) Ga0255040_104182581 | 3300024059 | Seawater | RIGERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0255039_100380271 | 3300024062 | Seawater | LPLSEKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEP |
| (restricted) Ga0255039_101951661 | 3300024062 | Seawater | GGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI |
| (restricted) Ga0255039_104576782 | 3300024062 | Seawater | IGERHCLFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0255043_100072101 | 3300024338 | Seawater | GGVKNSKLFEELATSSWNLAAGVQTPERGHRSESI |
| (restricted) Ga0255042_101170582 | 3300024340 | Seawater | GGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0255042_101335661 | 3300024340 | Seawater | GGVKNSKLFEELATSSWNLVAGVETPERGHRSESI |
| (restricted) Ga0255042_102542342 | 3300024340 | Seawater | KKGFDTGGVKNSKLFEELATSSWNLAAGVQTPEWGHRSEPI |
| (restricted) Ga0255042_103454311 | 3300024340 | Seawater | PFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSKPI |
| (restricted) Ga0255046_100265612 | 3300024519 | Seawater | DTGGVKNSKLFEELATSSWNLAAGVETPEWGHRSEPI |
| (restricted) Ga0255046_100319671 | 3300024519 | Seawater | HCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0255046_101150533 | 3300024519 | Seawater | GFDTGGVKNSKLFEELATSSWNLAAGVETPERGYRSEPI |
| (restricted) Ga0255046_101478541 | 3300024519 | Seawater | HCLFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVQTPERRHRSEPI |
| (restricted) Ga0255046_101576842 | 3300024519 | Seawater | CPFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPKRGHRSEPIGLFMNPS |
| (restricted) Ga0255046_102312551 | 3300024519 | Seawater | KGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSELI |
| (restricted) Ga0255046_102971982 | 3300024519 | Seawater | ERHCRFRKKDFDTGGVKNSKLFEELATSSWNLAAGVEIPERGHRSEPI |
| (restricted) Ga0255046_105017921 | 3300024519 | Seawater | VNPPEADKLFEELATSSWNLAAGVQTPERRHRSEPI |
| (restricted) Ga0255046_106130801 | 3300024519 | Seawater | GFDTGGVNPPEADKLFEELATSSWNLAAGVQTPERGLRNEPI |
| (restricted) Ga0255046_106510371 | 3300024519 | Seawater | HGLFRKKGFDIGGVNPPKADKLFEELATSSWNLAAGVQTPERGHRNEPI |
| (restricted) Ga0255045_100497391 | 3300024528 | Seawater | TGAVMNSKLFEELATSSWNLAAGVQTPERGHRSKPI |
| (restricted) Ga0255045_100520722 | 3300024528 | Seawater | NPPEADKLFEELATSSWNLAAGVETPEWGHRSEPI |
| (restricted) Ga0255045_100730461 | 3300024528 | Seawater | RKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPERGHKSEPI |
| (restricted) Ga0255045_101536202 | 3300024528 | Seawater | IGERHCLFRKKGFDTGGVNPPEADKLFEELATSSWNLVAGVETPERGHRSESI |
| (restricted) Ga0255045_101591442 | 3300024528 | Seawater | DTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI |
| (restricted) Ga0255045_102633331 | 3300024528 | Seawater | RIRERHCLFRKKGFDTGGVKNSKLFEELATSSWNLVAEVETPERGHRSEPI |
| Ga0209456_103980461 | 3300025883 | Pelagic Marine | LPLSEKGIDTGGVKNSKLFEELATSSWNLAAGIETPESRHRSEPI |
| Ga0209367_10194785 | 3300027098 | Marine Gutless Worms Symbiont | MGFDVGGVNPPEADKLFEELATSSWNLAAGSETPEKGHPNEPI |
| Ga0209146_10002061 | 3300027175 | Marine Gutless Worms Symbiont | GGVKNSKLFEELATSSWNLAAGVETPEKGHRSEPI |
| Ga0209146_10008413 | 3300027175 | Marine Gutless Worms Symbiont | LGSDIAHFRGKGFDTGGVNPPEADKLFEELATSSWNLAAGIETPEKGHRSEPI |
| Ga0209146_10264381 | 3300027175 | Marine Gutless Worms Symbiont | LGSDIAHFRGKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKGHRS |
| Ga0209146_10380431 | 3300027175 | Marine Gutless Worms Symbiont | LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRS |
| Ga0209692_103516571 | 3300027828 | Marine Sediment | DTGDVKNSKLFEELATSSWNLAAGVQTPETGHRSEPI |
| (restricted) Ga0255041_100963751 | 3300027837 | Seawater | EKGFDAGGVKNSKLFEELATSSWNLVAGVQTPERGHRSEPI |
| (restricted) Ga0255041_101229001 | 3300027837 | Seawater | DTGGVKNSKLFEELATSSWNLAAGVKTPERRHRSEPI |
| (restricted) Ga0255041_101470062 | 3300027837 | Seawater | DTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| (restricted) Ga0255041_103776422 | 3300027837 | Seawater | GGVKNSKLFEKLATSSWNLAAGIQTPERRHRSEPI |
| Ga0209271_102944302 | 3300027845 | Marine Sediment | GFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI |
| (restricted) Ga0255054_100862351 | 3300027856 | Seawater | CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI |
| Ga0209536_1000279471 | 3300027917 | Marine Sediment | TGGVKNSKLFEELATRSWNLAAGVETPERGHRSEPI |
| Ga0209536_1000598301 | 3300027917 | Marine Sediment | DTGGVKNSKLFEGLATSSWNLVAGVETPERGHRSEPI |
| Ga0209536_1000659838 | 3300027917 | Marine Sediment | KGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI |
| Ga0209536_1000929601 | 3300027917 | Marine Sediment | KGFDTGGVKNSKLFEELATSSWNLVAGVETPERRHRSEPI |
| Ga0209536_1000960086 | 3300027917 | Marine Sediment | KGFDTGGVNPPEADKLFEELATSSWNLVAGVETPERGHRSEPN |
| Ga0209536_1002142891 | 3300027917 | Marine Sediment | KGFDTGGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI |
| Ga0209536_1003520101 | 3300027917 | Marine Sediment | KKGFDTGGVKNSKLFEELATRSWNLAAGVETPEGGHRSEPI |
| (restricted) Ga0233413_100670573 | 3300027996 | Seawater | KKGFDTGGVNPPEADKLFEELATRSWNLAVGVETPEREHRSEPI |
| Ga0265306_100037148 | 3300028598 | Sediment | TGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI |
| Ga0265306_108332642 | 3300028598 | Sediment | TGGVKNSKLFEELAMSSWNLAAGVETPERGHRSEPI |
| Ga0265309_100528011 | 3300028599 | Sediment | HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI |
| Ga0265309_101611312 | 3300028599 | Sediment | DTGGVKNSKLFEELATSSWNLVAGVETPERGHRSEPI |
| Ga0265309_106444952 | 3300028599 | Sediment | HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI |
| Ga0265303_102431581 | 3300028600 | Sediment | GGVKNSKLFEELATSSWNLVAGVETPERGHRSEPI |
| Ga0316198_100774855 | 3300032251 | Sediment | HCPLRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI |
| Ga0316196_102775863 | 3300032252 | Sediment | ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI |
| Ga0316196_103192622 | 3300032252 | Sediment | GFDTGGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI |
| Ga0316191_100683151 | 3300032258 | Worm Burrow | VNPPEADKLFEELATSSWNLAAGVATPERGHRSEPI |
| Ga0316191_101664243 | 3300032258 | Worm Burrow | GGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI |
| Ga0316191_101695933 | 3300032258 | Worm Burrow | FRKKGFDTGGVKNSKLFEELATSSWNSAAGVETPERGHPSEPI |
| Ga0316191_104427802 | 3300032258 | Worm Burrow | IGERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKRHRSEPI |
| Ga0316191_105925432 | 3300032258 | Worm Burrow | FRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI |
| Ga0316191_110040702 | 3300032258 | Worm Burrow | GFDTGGVKNSKLFEELATSSWNLAVGVETPERGHRSELI |
| Ga0316190_103422701 | 3300032259 | Worm Burrow | CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKRHRSEPI |
| Ga0316192_106342902 | 3300032260 | Worm Burrow | DTGGVKNSKLFEELATSSWNLAAGVETPERRHRREPI |
| Ga0316194_100785784 | 3300032262 | Sediment | HCLFRKKGFDTGGVKNSKLFEELATSSWNSAAGVETPERGHPSEPI |
| Ga0316194_101022891 | 3300032262 | Sediment | FRKKGFDTGGVKNSKLFEELATSSWNLVAGVETPERRHRSEPI |
| Ga0316194_102589001 | 3300032262 | Sediment | LFRKKGLDTGGVKNSKLFEELATSSWDLVAGGQTPERGHRSEPI |
| Ga0316194_102957991 | 3300032262 | Sediment | LFRKKGFDTGGVKNSKLFEELATSSWNLAAGVKTPERGHRSEPI |
| Ga0316194_105755512 | 3300032262 | Sediment | GGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI |
| Ga0316189_108755531 | 3300032272 | Worm Burrow | LFRKKGFDTGGVKNSKLFEELATSSWNLAAGIEIPERGHRSEPI |
| Ga0316193_102389071 | 3300033429 | Sediment | FDTGGVNPPEADKLFEELATSSWNLAAGVETPERRHRSEPI |
| Ga0316193_114610201 | 3300033429 | Sediment | CLFRKKGFDTGGVKNSKLFEALATSSWNLAAGVETPERGHRSEPI |
| ⦗Top⦘ |