


| Basic Information | |
|---|---|
| Family ID | F062617 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VTDLAACMVTVQVLPETISQPLQPVKMEPKAGVAVRVTTVP |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.33 % |
| % of genes near scaffold ends (potentially truncated) | 27.69 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.692 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (36.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.538 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.29% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF02698 | DUF218 | 3.08 |
| PF01923 | Cob_adeno_trans | 3.08 |
| PF00908 | dTDP_sugar_isom | 2.31 |
| PF13440 | Polysacc_synt_3 | 2.31 |
| PF13540 | RCC1_2 | 2.31 |
| PF13472 | Lipase_GDSL_2 | 1.54 |
| PF07786 | HGSNAT_cat | 1.54 |
| PF02954 | HTH_8 | 1.54 |
| PF13517 | FG-GAP_3 | 1.54 |
| PF00999 | Na_H_Exchanger | 1.54 |
| PF00072 | Response_reg | 0.77 |
| PF00106 | adh_short | 0.77 |
| PF08239 | SH3_3 | 0.77 |
| PF00282 | Pyridoxal_deC | 0.77 |
| PF01042 | Ribonuc_L-PSP | 0.77 |
| PF02492 | cobW | 0.77 |
| PF00535 | Glycos_transf_2 | 0.77 |
| PF13180 | PDZ_2 | 0.77 |
| PF13565 | HTH_32 | 0.77 |
| PF00005 | ABC_tran | 0.77 |
| PF01833 | TIG | 0.77 |
| PF03721 | UDPG_MGDP_dh_N | 0.77 |
| PF01839 | FG-GAP | 0.77 |
| PF06452 | CBM9_1 | 0.77 |
| PF08241 | Methyltransf_11 | 0.77 |
| PF08240 | ADH_N | 0.77 |
| PF12708 | Pectate_lyase_3 | 0.77 |
| PF08530 | PepX_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 3.08 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 3.08 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.54 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.54 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.54 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.54 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 1.54 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.54 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.77 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.77 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.77 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.77 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.77 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.46 % |
| Unclassified | root | N/A | 21.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10425262 | Not Available | 637 | Open in IMG/M |
| 3300002558|JGI25385J37094_10043699 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300002908|JGI25382J43887_10114859 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300002908|JGI25382J43887_10207215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300005167|Ga0066672_10081382 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1938 | Open in IMG/M |
| 3300005176|Ga0066679_10079595 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300005177|Ga0066690_10306304 | Not Available | 1073 | Open in IMG/M |
| 3300005178|Ga0066688_10137644 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1521 | Open in IMG/M |
| 3300005180|Ga0066685_10144816 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1613 | Open in IMG/M |
| 3300005180|Ga0066685_10620489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300005187|Ga0066675_10176441 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1485 | Open in IMG/M |
| 3300005447|Ga0066689_10346948 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005450|Ga0066682_10092112 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300005552|Ga0066701_10165444 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1340 | Open in IMG/M |
| 3300005552|Ga0066701_10818410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300005554|Ga0066661_10022022 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
| 3300005554|Ga0066661_10780485 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 559 | Open in IMG/M |
| 3300005555|Ga0066692_10464422 | Not Available | 807 | Open in IMG/M |
| 3300005555|Ga0066692_10564980 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005555|Ga0066692_10611001 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005556|Ga0066707_10648365 | Not Available | 668 | Open in IMG/M |
| 3300005558|Ga0066698_10853007 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005559|Ga0066700_10514656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 835 | Open in IMG/M |
| 3300005568|Ga0066703_10840849 | Not Available | 524 | Open in IMG/M |
| 3300005586|Ga0066691_10473178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300005598|Ga0066706_10878413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300006031|Ga0066651_10368554 | Not Available | 769 | Open in IMG/M |
| 3300006034|Ga0066656_10547752 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006794|Ga0066658_10104700 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300006797|Ga0066659_10978172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
| 3300006797|Ga0066659_11379739 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 588 | Open in IMG/M |
| 3300006800|Ga0066660_10015260 | All Organisms → cellular organisms → Bacteria | 4316 | Open in IMG/M |
| 3300007255|Ga0099791_10027681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2470 | Open in IMG/M |
| 3300007255|Ga0099791_10078001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1508 | Open in IMG/M |
| 3300007258|Ga0099793_10120608 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300007258|Ga0099793_10208789 | Not Available | 937 | Open in IMG/M |
| 3300007265|Ga0099794_10043713 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300007788|Ga0099795_10465134 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009012|Ga0066710_101087738 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300009012|Ga0066710_101419605 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300009012|Ga0066710_102698030 | Not Available | 709 | Open in IMG/M |
| 3300009012|Ga0066710_103358724 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009088|Ga0099830_10436312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1063 | Open in IMG/M |
| 3300009089|Ga0099828_10106938 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300009090|Ga0099827_11584481 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 570 | Open in IMG/M |
| 3300009090|Ga0099827_11656210 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009137|Ga0066709_100113531 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300009137|Ga0066709_100321922 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300009137|Ga0066709_101852759 | Not Available | 843 | Open in IMG/M |
| 3300009137|Ga0066709_104309529 | Not Available | 519 | Open in IMG/M |
| 3300009137|Ga0066709_104545115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300009143|Ga0099792_10188052 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300009162|Ga0075423_11346925 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 763 | Open in IMG/M |
| 3300010046|Ga0126384_11663774 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300010326|Ga0134065_10012914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2254 | Open in IMG/M |
| 3300010333|Ga0134080_10248378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300010359|Ga0126376_10356886 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300012198|Ga0137364_10604428 | Not Available | 826 | Open in IMG/M |
| 3300012202|Ga0137363_10808301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300012202|Ga0137363_11518797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300012203|Ga0137399_10028239 | All Organisms → cellular organisms → Bacteria | 3818 | Open in IMG/M |
| 3300012203|Ga0137399_10530180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300012203|Ga0137399_11061160 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012354|Ga0137366_10548226 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012385|Ga0134023_1010330 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012685|Ga0137397_10065934 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
| 3300012685|Ga0137397_10524303 | Not Available | 882 | Open in IMG/M |
| 3300012917|Ga0137395_10323234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300012918|Ga0137396_10022958 | All Organisms → cellular organisms → Bacteria | 4033 | Open in IMG/M |
| 3300012918|Ga0137396_10106024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2012 | Open in IMG/M |
| 3300012918|Ga0137396_10347006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1098 | Open in IMG/M |
| 3300012918|Ga0137396_10376313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300012918|Ga0137396_10563258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300012922|Ga0137394_10173248 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300012927|Ga0137416_11957107 | Not Available | 537 | Open in IMG/M |
| 3300012929|Ga0137404_10366837 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300012944|Ga0137410_10013966 | All Organisms → cellular organisms → Bacteria | 5459 | Open in IMG/M |
| 3300012944|Ga0137410_10193746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. 12-65-5 | 1571 | Open in IMG/M |
| 3300015053|Ga0137405_1164953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1259 | Open in IMG/M |
| 3300015264|Ga0137403_10320600 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300015359|Ga0134085_10060929 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300015359|Ga0134085_10225262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300017656|Ga0134112_10233671 | Not Available | 726 | Open in IMG/M |
| 3300017659|Ga0134083_10154888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 929 | Open in IMG/M |
| 3300017659|Ga0134083_10180938 | Not Available | 864 | Open in IMG/M |
| 3300018468|Ga0066662_10991708 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300018468|Ga0066662_12821956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300020170|Ga0179594_10101969 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300021078|Ga0210381_10395186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300021151|Ga0179584_1138465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1597 | Open in IMG/M |
| 3300024330|Ga0137417_1257538 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300026296|Ga0209235_1084186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1411 | Open in IMG/M |
| 3300026296|Ga0209235_1129585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300026297|Ga0209237_1053637 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300026297|Ga0209237_1240767 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 556 | Open in IMG/M |
| 3300026298|Ga0209236_1191007 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300026317|Ga0209154_1106963 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300026318|Ga0209471_1202937 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 752 | Open in IMG/M |
| 3300026322|Ga0209687_1203816 | Not Available | 610 | Open in IMG/M |
| 3300026324|Ga0209470_1353640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300026331|Ga0209267_1232709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300026334|Ga0209377_1112356 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300026334|Ga0209377_1223861 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026335|Ga0209804_1057252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. 12-65-5 | 1883 | Open in IMG/M |
| 3300026524|Ga0209690_1020472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3349 | Open in IMG/M |
| 3300026524|Ga0209690_1193574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300026536|Ga0209058_1136602 | Not Available | 1183 | Open in IMG/M |
| 3300026536|Ga0209058_1263301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300026548|Ga0209161_10075457 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300026548|Ga0209161_10266129 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 873 | Open in IMG/M |
| 3300026548|Ga0209161_10334002 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300026552|Ga0209577_10039558 | All Organisms → cellular organisms → Bacteria | 4049 | Open in IMG/M |
| 3300026552|Ga0209577_10380051 | Not Available | 1027 | Open in IMG/M |
| 3300026557|Ga0179587_10163171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1395 | Open in IMG/M |
| 3300027643|Ga0209076_1161466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300027875|Ga0209283_10074551 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300027903|Ga0209488_10007643 | All Organisms → cellular organisms → Bacteria | 8088 | Open in IMG/M |
| 3300027903|Ga0209488_10147083 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300028536|Ga0137415_10036087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4852 | Open in IMG/M |
| 3300028536|Ga0137415_10267124 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 36.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_104252621 | 3300001661 | Forest Soil | VTDFAAFMVTVQVVPETESQPLQPVSMEPAPGAAVKVTTVPRS* |
| JGI25385J37094_100436993 | 3300002558 | Grasslands Soil | VTDLAALMVTVQVVPETVSQPFQPVKMERRSGVTVRVTTVP* |
| JGI25382J43887_101148591 | 3300002908 | Grasslands Soil | VTALAALMVTVQVAPEAVSHPLQPVKMEKKSGVAVRVTTVPLV |
| JGI25382J43887_102072152 | 3300002908 | Grasslands Soil | VAVTDLAALMVTVQVVPETVSQPLQLVKIEPKDGVAVRVTTVPLL* |
| Ga0066672_100813821 | 3300005167 | Soil | MPRNLAVTDLAALMVTVQVLCETISQPRQWVKIEPKAGVAVRVTTVP |
| Ga0066679_100795952 | 3300005176 | Soil | VTALAALMVTVQVVPESVSQPSQPVKMERKLGVAVRVTVVPLL* |
| Ga0066690_103063042 | 3300005177 | Soil | LAVTDLAAVMVTVQVLPETASHPLQPLKMEGRVAATVRVTVVPLS* |
| Ga0066688_101376443 | 3300005178 | Soil | VTDLAELMVTLQVVPETVSQSSQPVKMERKPVGVAVRTTVLPLV* |
| Ga0066685_101448163 | 3300005180 | Soil | VTVLAAFMVTVQVLPEAVSQPLQPMNMDKGPGVAVRVTIVPLL* |
| Ga0066685_106204893 | 3300005180 | Soil | DLAAFIVTAQVLPETESHPLQLVKLEPVAGVAVRVTTVPLA* |
| Ga0066675_101764413 | 3300005187 | Soil | VTDLAELMVTLQVVPETVSQPSQPVKMERKPVGVAVRTTVLPLA* |
| Ga0066689_103469482 | 3300005447 | Soil | VTDLAELMVTLQVVPETVSQPSQPVKMERKPVGVAVRTTVLPLV* |
| Ga0066682_100921123 | 3300005450 | Soil | VTDLARLMVTVQVVPETASQPSQPVKMESKPVGVAVRTTVLPLA* |
| Ga0066701_101654443 | 3300005552 | Soil | VTDLAELMVTLHVVPGAASQPSQPVKMERKPVGVAVRTTVLPLA* |
| Ga0066701_108184102 | 3300005552 | Soil | VTDLALLMVTVQVVSETASHPSQPVKTLRRAGVAVRVTTVPL |
| Ga0066661_100220224 | 3300005554 | Soil | VTDRAELIVTVQVVPETVSQPLQPVNTLPKAGVAVRVTVVPLV* |
| Ga0066661_107804851 | 3300005554 | Soil | MPRNLAVTDLAALMVTVQVLCETISQPRQWVKIEPKAGVAVRVTTVPL |
| Ga0066692_104644223 | 3300005555 | Soil | VTVLVLFMITVQVVPETASQPVQPVKMERKPVGVAVRVTVVPLV* |
| Ga0066692_105649801 | 3300005555 | Soil | LAVTDFAAPMVTVQVVSEAESQPLQPLKMERKSGVTVSVTTVP* |
| Ga0066692_106110012 | 3300005555 | Soil | MVTVQVVPESASQPLQPMKTERKPGVAVRVTTVPLV* |
| Ga0066707_106483652 | 3300005556 | Soil | MVTVQVAPEAVSHPLQPVKMEKKSGVAVRVTTVPLV* |
| Ga0066698_108530072 | 3300005558 | Soil | VIDVADLMVTVQVVPETASHPLQLEKLDPVAGVAVSVTTVPYG* |
| Ga0066700_105146561 | 3300005559 | Soil | VTDLAPLMLTIQVEPETASQSLQPVKMERKAGVALRVTTVPLV |
| Ga0066703_108408493 | 3300005568 | Soil | TLQVVPETASQPLQPVKIDPLAGVAVRVTVVPLV* |
| Ga0066691_104731781 | 3300005586 | Soil | MVTVQVVPETASHPLQLVKLDPVAGVAVRVTTVPYG* |
| Ga0066706_108784133 | 3300005598 | Soil | VTDVADLMVTVQVVPETASHPLQLVKLDPVAGVAVRVTMAPLS* |
| Ga0066651_103685543 | 3300006031 | Soil | VTDLAELMVTLQVVPETASQPLLQKAKVEPGAGVAVRTTVLPLV* |
| Ga0066656_105477521 | 3300006034 | Soil | LTDFAEIMVTVQVAPDIVSHPLQPVKTESKWGVAVRVTTVPQ* |
| Ga0066656_110678852 | 3300006034 | Soil | KLAVTDRAALMVTLQLVPETVSQPLQPVKVEPLAGVAVRVTVVPLV* |
| Ga0066658_101047002 | 3300006794 | Soil | VTDLAELMVTLQVVPETASQPSQPVKMERKPVGVAVRTTVLPLA* |
| Ga0066659_109781722 | 3300006797 | Soil | VTDLALLMVTVQIVSETASHPSQPVKTLRRAGVAVRVTT |
| Ga0066659_113797393 | 3300006797 | Soil | LKLAVTARAVLMVTLQVVPETASQPLQKAKVEPGAGVAVRTTVLPLV* |
| Ga0066660_100152605 | 3300006800 | Soil | MPRNLAVTDLAALMVTVQVLCETISQPRQWVKIEPKAGVAVRVTTVPLV* |
| Ga0099791_100276813 | 3300007255 | Vadose Zone Soil | VTVVAVRMVKEQVVPEKESQPLQPLKVERRSGFAVRVTTVPYL* |
| Ga0099791_100780012 | 3300007255 | Vadose Zone Soil | LAVTDLAEFMFTVQVVPETESQPFQPVKVERKAGVARRVTTVPPL* |
| Ga0099793_101206085 | 3300007258 | Vadose Zone Soil | VVAVRMVTEQVVPETESQPLQPLKVERRSGFAVRVTTVPYL* |
| Ga0099793_102087892 | 3300007258 | Vadose Zone Soil | LAVTDLAVLMVTVQVVPETASHPLQPLKMERRSSLTVRVTVVPLS* |
| Ga0099794_100437134 | 3300007265 | Vadose Zone Soil | MVTEQVVPEKESQPLQPLKVERRSGFAVRVTTVPYL* |
| Ga0099795_104651343 | 3300007788 | Vadose Zone Soil | VTDVADLTVTVQVVPETASHPLQLVKLDPVAGVAVRVTTVPYG* |
| Ga0066710_1010877384 | 3300009012 | Grasslands Soil | VTSLAALMVTLQVVPETASQPSQPVKMERKPVGVAVRTTVLPLL |
| Ga0066710_1014196053 | 3300009012 | Grasslands Soil | LAVTDLAALTVTVQVVPDAESQPLQPLKMERRSGVTVRVTMVP |
| Ga0066710_1026980302 | 3300009012 | Grasslands Soil | LAVTDLAARMVTVQVVPETASHPLQPLKMERRFSATVRVTVVPLS |
| Ga0066710_1032783953 | 3300009012 | Grasslands Soil | VTDRAALMVTVQLVPETVSQPLQLVNVDPPAALAVRVTVVPLV |
| Ga0066710_1033587241 | 3300009012 | Grasslands Soil | VTDLAACMVTVQVLPETISQPLQPVKMEPKAGVAVRVTTVP |
| Ga0099830_104363122 | 3300009088 | Vadose Zone Soil | MPTVQVVPETESQPVQPLKMESRSGLAVRVTTVP* |
| Ga0099828_101069381 | 3300009089 | Vadose Zone Soil | VTDLEALIVTVQVAPETVSHPLQLVKVDPKAGVAVRVTTVLLS |
| Ga0099827_115844812 | 3300009090 | Vadose Zone Soil | MVTVQVVPETVSQPLQPVKREPRAGVAMRVTTVPLS* |
| Ga0099827_116562101 | 3300009090 | Vadose Zone Soil | MVTVQVVPESASQPLQPTKMERKPGVAVRVTTVPLV* |
| Ga0066709_1001135313 | 3300009137 | Grasslands Soil | VTDVADLMVTVQVVPETASHPLQLVKLDPVAGVAVRVTTVPYG* |
| Ga0066709_1003219223 | 3300009137 | Grasslands Soil | VNVAVTDLGAFMVTVQVAPETESHPLQLVKSDPVAGEAVRVTTVPTS* |
| Ga0066709_1018527591 | 3300009137 | Grasslands Soil | RLKLAVTARAVLMVTLQVVPETALQPLQKAKVEPEAGVAVRVTTVPLL* |
| Ga0066709_1043095291 | 3300009137 | Grasslands Soil | TVQVVPEAVSQSLQPMKMEKRFGVAVRVTTVPLL* |
| Ga0066709_1045451152 | 3300009137 | Grasslands Soil | MVTVQVVPEVASQPLQPVKMERRPVGVAVRTTVLPLE* |
| Ga0099792_101880523 | 3300009143 | Vadose Zone Soil | RVMPTVQVVPETESQPSQPLKMESRSGLAVRVTTVP* |
| Ga0075423_113469252 | 3300009162 | Populus Rhizosphere | MKFAVTRLVLFMITVQVDPDTESQPLQPVKIDNVAGVAVSVTVVPLL* |
| Ga0126384_116637741 | 3300010046 | Tropical Forest Soil | LTDLAAFMVTIQIVPETVSHPLQPKKIEIPVGVAVRVTTVLES* |
| Ga0134082_102159291 | 3300010303 | Grasslands Soil | LKLTVTDLAAFILTVQVAPETASQPVQSLKLDPVAGVAVSVTTVPTS* |
| Ga0134088_105312193 | 3300010304 | Grasslands Soil | TVMLKLCRLEAAVTYRAALMLTLQLVPETVSQPLQVVNVDPPAALAVRVTVVPLV* |
| Ga0134065_100129141 | 3300010326 | Grasslands Soil | LKAAVTDLAALIVTVQVVSATVSHPLQPPKLDPLAG |
| Ga0134080_102483782 | 3300010333 | Grasslands Soil | LAVTVLAAVMDTVQVLPETVSQPFQPVNMEKRLGVAVRVTIVPLL* |
| Ga0134062_101709912 | 3300010337 | Grasslands Soil | VTDRAALIVTVQDVPETVSQPLQPPKLEPEAGLAVRVVRVPLS* |
| Ga0126376_103568862 | 3300010359 | Tropical Forest Soil | LTDLAAFMVTIQIVPETVSHPLQPKKTEIPVGVAVRVTTVLES* |
| Ga0137364_106044282 | 3300012198 | Vadose Zone Soil | LAVTDLAALMVTVQVVPETASHPLQPLKMEGRFAATVRVTLVPLS* |
| Ga0137363_108083014 | 3300012202 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQLLQLLKRERVSGFAVRVTTVPYL* |
| Ga0137363_115187971 | 3300012202 | Vadose Zone Soil | MKLALTVFAALMVTVQVVPFAVSQPCQPVKMERRPDLAVSV |
| Ga0137399_100282394 | 3300012203 | Vadose Zone Soil | VTDLARFMFTVQVVPDAESQPVQPVKTERSPGVSWSVTTVPET* |
| Ga0137399_105301804 | 3300012203 | Vadose Zone Soil | MVTEQVVPETESQPLQPLKVERRSGFAVRVTTVPYL* |
| Ga0137399_110611602 | 3300012203 | Vadose Zone Soil | VTDVADLMVTVQVVPETASHPLQLLKLDPVAGVAVRVTTVPYG* |
| Ga0137387_102199172 | 3300012349 | Vadose Zone Soil | VTDRAALIVTVQLVPETVSQPLQPPKVDPLPALAVSITTVPLV* |
| Ga0137366_105482261 | 3300012354 | Vadose Zone Soil | MATVQVVPETVSHPLQPVKMDPVAGVAVRVTTVPLS* |
| Ga0134023_10103302 | 3300012385 | Grasslands Soil | VTDLALLMVTVQVVSETASHPSQPVKTLRRAGVAVRVT |
| Ga0137397_100659342 | 3300012685 | Vadose Zone Soil | LAVTDLARFMATVQVVPDTVSQPLQPLKLERNAGAALSVTTVPDT* |
| Ga0137397_105243032 | 3300012685 | Vadose Zone Soil | LAVTDLAALMVTVQVVPETASHPLQPLKLERRFSATVRVTVVPLS* |
| Ga0137395_103232342 | 3300012917 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQPLQLLKRERESGFAVRVTTVPYL* |
| Ga0137396_100229582 | 3300012918 | Vadose Zone Soil | VTDQAERMVTVQVVPENESQPLQPLKRERESGFAVRVTTVPYL* |
| Ga0137396_101060242 | 3300012918 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQPLQLLKRERVSGFAVRVTTVPYL* |
| Ga0137396_103470064 | 3300012918 | Vadose Zone Soil | LAVTDLARFMATVQVVPETESQPFQPLKMERNAGAARSVTTVPDT* |
| Ga0137396_103763133 | 3300012918 | Vadose Zone Soil | LAVTDLAEPMVTVQVVPETASQPLQPLKTESRSGVTVSLTTVP* |
| Ga0137396_105632583 | 3300012918 | Vadose Zone Soil | LAVTDLAEFMFTVQVVPETESQSFQPVKVERKAGVTRRVTTVPPL* |
| Ga0137394_101732482 | 3300012922 | Vadose Zone Soil | VTVVAERMVTEQVVPEKESQPLQPLKVERGSGFAVRVTTVPYL* |
| Ga0137416_119571072 | 3300012927 | Vadose Zone Soil | LAVTDLAALMVTVQVVPETASHPLQPLKVEKRSSVTVRVTVVPLS* |
| Ga0137404_103668373 | 3300012929 | Vadose Zone Soil | LAVTDLAAFTVTVQIVSETVSQPFQLSKMERKPGAAVRVTTVP* |
| Ga0137410_100139664 | 3300012944 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQPLQLLKRERGSGFAVRVTTVPYL* |
| Ga0137410_101937462 | 3300012944 | Vadose Zone Soil | LAVTDLAALMVTVQVVPETASHPLQPLKLERRFSATVRVTVVPIS* |
| Ga0137405_11649531 | 3300015053 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQPLQLLKRERVSGFAVRV |
| Ga0137403_103206004 | 3300015264 | Vadose Zone Soil | LAVTDLAACTVTVQILSETVSQPFQLSKMERKPGVAVRVTTVP* |
| Ga0134089_105661771 | 3300015358 | Grasslands Soil | LMVTLQLVPETVSQPLQLVNVDPPAGAAVRVTAVPLV* |
| Ga0134085_100609292 | 3300015359 | Grasslands Soil | LAVTVLAAFMVTVQVLPEAVSQPLQPMNMDKGPGVAVRVTIVP |
| Ga0134085_102252622 | 3300015359 | Grasslands Soil | LAVTVLAAVMDTVQVLPEAVSQPFQPVNMEKRPGVAVRVTIVPLL* |
| Ga0134112_102336711 | 3300017656 | Grasslands Soil | RVKVAVTDLAALMVAVQLVPETVSQPLQLPKVDPPAGAAVRVTTVPLL |
| Ga0134083_101548882 | 3300017659 | Grasslands Soil | VTDLAALMVRVQVVPEAVSQPSQPMKMERKLGVAVRVTVVPLL |
| Ga0134083_101809383 | 3300017659 | Grasslands Soil | VTDLAELMVTLQVVPETASQPLQKAKVEPGAGVAVRTTVLPLV |
| Ga0066667_123317761 | 3300018433 | Grasslands Soil | VRLNVRASKVAVTDRAALIVTAQDVPETVSQPLQPLKVEPEAAIAVSVIVVPLA |
| Ga0066662_109917081 | 3300018468 | Grasslands Soil | VTVLAAFMVTVQVLPEAVSQPLQPMNMDKGPGVAVRVTIVPLL |
| Ga0066662_128219563 | 3300018468 | Grasslands Soil | VTALAALMVTVQLVPETVSHPLQLVEVDPVLGVAVRVTTVPLA |
| Ga0179594_101019691 | 3300020170 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQLLQLLKRERVSGFAVRVTTVPYL |
| Ga0210381_103951863 | 3300021078 | Groundwater Sediment | VAVTDLAALMVTVQIAPETESHPLQAVNVDPVAGVAVRVATVPGS |
| Ga0179584_11384651 | 3300021151 | Vadose Zone Soil | VTDFAAVMVTVQVVPEAVSQPVQPVKTESRSGFMTRVTTVP |
| Ga0137417_12575383 | 3300024330 | Vadose Zone Soil | VTDLAEFMFTVQVVPETESQSFQPVKVERKAGVTRRVTTVPPL |
| Ga0209235_10841863 | 3300026296 | Grasslands Soil | VTDLAASMVTVQLVPEAVSHPLQPVKMERKAGVAVRVTTVPLS |
| Ga0209235_11295853 | 3300026296 | Grasslands Soil | VTDLAALMVTVQVVPETVSQPFQPVKMERRSGVTVRVTTVP |
| Ga0209237_10536373 | 3300026297 | Grasslands Soil | MVTVQVVPESVSQPLQPVKMERKPGVAVRVTTVPLV |
| Ga0209237_12407671 | 3300026297 | Grasslands Soil | VLAALMVTVQVVSETVSQPLQPVKMEKKPVGVAVRTTVLPLV |
| Ga0209236_11910072 | 3300026298 | Grasslands Soil | VADLAALMVTVQVVPEAASHPLQPVKIEPKVGAAVRVTT |
| Ga0209154_11069632 | 3300026317 | Soil | VTDRAELIVTVQVVPETVSQPLQPVNTLPKAGVAVRVTVVPLV |
| Ga0209471_12029371 | 3300026318 | Soil | MPRKLAVTDRAALMITVQVVPETASHPLHPVKREPKAGVAVRVTTVPLL |
| Ga0209687_12038162 | 3300026322 | Soil | MVTVHVVFETASHPVQPLNMEPMAGVAVRVTTVLMS |
| Ga0209470_13536403 | 3300026324 | Soil | ADLMVTVQVVPETASHPLQLEKLDPVAGVAVSVTTVPYG |
| Ga0209267_12327091 | 3300026331 | Soil | AVTARAVLMVTLQVVPETALQPLQKAKVEPEAGVAVRVTTVPLL |
| Ga0209377_11123562 | 3300026334 | Soil | VTDLAAFMVTVQVVPEAASQPLQPVKMERRPTGVAVRV |
| Ga0209377_12238612 | 3300026334 | Soil | MVTVQVVPESASQPLQPMKTERKPGVAVRVTTVPLV |
| Ga0209804_10572522 | 3300026335 | Soil | LAVTDLAAVMVTVQVLPETASHPLQPLKMEGRVAATVRVTVVPLS |
| Ga0209690_10204723 | 3300026524 | Soil | VTVLAALMVTVQVVSETVSQPLQPVKMEKKPVGVAVRTTVLPLV |
| Ga0209690_11935742 | 3300026524 | Soil | KLAVTARAPPIVTVQVVPETASQPLHAANIESKAGVAIRVTTVPLL |
| Ga0209058_11366024 | 3300026536 | Soil | VTDLAELMVTVQVVPETASQPSQPVKMERKPVSVAVRTTVLPLV |
| Ga0209058_12633013 | 3300026536 | Soil | VIDVADLMVTVQVVPETASHPLQLEKLDPVAGVAVSVTTVPYG |
| Ga0209058_13002872 | 3300026536 | Soil | KVAVTDRAALMVTLQVVPETVSQPLQLVNVDPPAALAVRVTAEPLV |
| Ga0209161_100754571 | 3300026548 | Soil | VTDLAELMVTLQVVPETVSQPSQPVKMERKPVGVAVRTTVLPLA |
| Ga0209161_102661292 | 3300026548 | Soil | VTDVADLMVTVQVVPETASHPLQLVKLDPVAGVAVR |
| Ga0209161_103340022 | 3300026548 | Soil | VTVQVVPETASQPSQPVKMERKPVGVAVRTTVLPLA |
| Ga0209577_100395584 | 3300026552 | Soil | MPRNLAVTDLAALMVTVQVLCETISQPRQWVKIEPKAGVAVRVTTVPLV |
| Ga0209577_103800512 | 3300026552 | Soil | VTDLAARMVTVQVVPETASHPLQPLKTERGFSVTARVTVAPLL |
| Ga0179587_101631712 | 3300026557 | Vadose Zone Soil | VTDVADLMVTVQVVPETASHPLQLVKLDPVAGVAVRVTTAPLS |
| Ga0209076_11614663 | 3300027643 | Vadose Zone Soil | VVAVRMVTEQVVPETESQPLQPLKVERRSGFAVRVTTVPYL |
| Ga0209283_100745511 | 3300027875 | Vadose Zone Soil | VTDLEALIVTVQVAPETVSHPLQLVKVDPKAGVAVRVTTV |
| Ga0209488_100076438 | 3300027903 | Vadose Zone Soil | VTDLAERMVTVQVVPETESQPLQLLKRERVSGFAVRVTTVPYL |
| Ga0209488_101470832 | 3300027903 | Vadose Zone Soil | VTDLARFMFTVQVVPDAESQPLQPVKTERNPGLTVTVTTVPET |
| Ga0137415_100360874 | 3300028536 | Vadose Zone Soil | VTDLAAFIVTVQVRPEAESQPLQPLKIERKSRLTVRVTTVPEP |
| Ga0137415_102671244 | 3300028536 | Vadose Zone Soil | VTDVADLMVTVQVVPETASHPLQLVKLDPVAGVAVRVTPVALS |
| Ga0307468_1015717611 | 3300031740 | Hardwood Forest Soil | MKPAVTDRAEFTVTVHVAPETESHPLQPLKSMFGLAVRVTT |
| ⦗Top⦘ |