


| Basic Information | |
|---|---|
| Family ID | F062457 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 73.08 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (35.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.692 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 18.18% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF16363 | GDP_Man_Dehyd | 4.62 |
| PF03401 | TctC | 2.31 |
| PF04055 | Radical_SAM | 2.31 |
| PF05050 | Methyltransf_21 | 2.31 |
| PF08241 | Methyltransf_11 | 2.31 |
| PF00881 | Nitroreductase | 2.31 |
| PF02719 | Polysacc_synt_2 | 2.31 |
| PF13489 | Methyltransf_23 | 1.54 |
| PF13439 | Glyco_transf_4 | 1.54 |
| PF02397 | Bac_transf | 1.54 |
| PF00535 | Glycos_transf_2 | 1.54 |
| PF00656 | Peptidase_C14 | 1.54 |
| PF13517 | FG-GAP_3 | 1.54 |
| PF13414 | TPR_11 | 1.54 |
| PF13936 | HTH_38 | 1.54 |
| PF01255 | Prenyltransf | 1.54 |
| PF16861 | Carbam_trans_C | 1.54 |
| PF01370 | Epimerase | 1.54 |
| PF13924 | Lipocalin_5 | 1.54 |
| PF13356 | Arm-DNA-bind_3 | 0.77 |
| PF08238 | Sel1 | 0.77 |
| PF13432 | TPR_16 | 0.77 |
| PF05509 | TraY | 0.77 |
| PF03364 | Polyketide_cyc | 0.77 |
| PF01050 | MannoseP_isomer | 0.77 |
| PF00232 | Glyco_hydro_1 | 0.77 |
| PF00816 | Histone_HNS | 0.77 |
| PF00353 | HemolysinCabind | 0.77 |
| PF13483 | Lactamase_B_3 | 0.77 |
| PF02709 | Glyco_transf_7C | 0.77 |
| PF05721 | PhyH | 0.77 |
| PF13580 | SIS_2 | 0.77 |
| PF02771 | Acyl-CoA_dh_N | 0.77 |
| PF04940 | BLUF | 0.77 |
| PF00852 | Glyco_transf_10 | 0.77 |
| PF01243 | Putative_PNPOx | 0.77 |
| PF01609 | DDE_Tnp_1 | 0.77 |
| PF05199 | GMC_oxred_C | 0.77 |
| PF00271 | Helicase_C | 0.77 |
| PF00266 | Aminotran_5 | 0.77 |
| PF10135 | Rod-binding | 0.77 |
| PF12728 | HTH_17 | 0.77 |
| PF06808 | DctM | 0.77 |
| PF00890 | FAD_binding_2 | 0.77 |
| PF14279 | HNH_5 | 0.77 |
| PF13449 | Phytase-like | 0.77 |
| PF00589 | Phage_integrase | 0.77 |
| PF01061 | ABC2_membrane | 0.77 |
| PF01551 | Peptidase_M23 | 0.77 |
| PF11784 | DUF3320 | 0.77 |
| PF02543 | Carbam_trans_N | 0.77 |
| PF13844 | Glyco_transf_41 | 0.77 |
| PF00551 | Formyl_trans_N | 0.77 |
| PF10431 | ClpB_D2-small | 0.77 |
| PF00483 | NTP_transferase | 0.77 |
| PF09360 | zf-CDGSH | 0.77 |
| PF01507 | PAPS_reduct | 0.77 |
| PF02913 | FAD-oxidase_C | 0.77 |
| PF04143 | Sulf_transp | 0.77 |
| PF02653 | BPD_transp_2 | 0.77 |
| PF00561 | Abhydrolase_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 4.62 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 4.62 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 4.62 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.31 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 1.54 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 1.54 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.77 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.77 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.77 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.77 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.77 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.77 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.77 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.77 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.77 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.77 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.77 % |
| Unclassified | root | N/A | 39.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002140|M2t2FKB2_1008357 | Not Available | 500 | Open in IMG/M |
| 3300003388|JGI25910J50241_10040011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
| 3300003411|JGI25911J50253_10042353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300003412|JGI25912J50252_10002095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6771 | Open in IMG/M |
| 3300003986|Ga0063233_10187376 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300004123|Ga0066181_10151974 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300004126|Ga0066179_10173042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 594 | Open in IMG/M |
| 3300004126|Ga0066179_10243300 | Not Available | 513 | Open in IMG/M |
| 3300004794|Ga0007751_11407774 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005517|Ga0070374_10053399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2101 | Open in IMG/M |
| 3300005517|Ga0070374_10480835 | Not Available | 621 | Open in IMG/M |
| 3300005517|Ga0070374_10580991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300005580|Ga0049083_10037379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata | 1727 | Open in IMG/M |
| 3300005580|Ga0049083_10147154 | Not Available | 808 | Open in IMG/M |
| 3300005582|Ga0049080_10025077 | Not Available | 2081 | Open in IMG/M |
| 3300005582|Ga0049080_10025169 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300005582|Ga0049080_10077693 | Not Available | 1136 | Open in IMG/M |
| 3300005582|Ga0049080_10108160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 943 | Open in IMG/M |
| 3300007545|Ga0102873_1056294 | Not Available | 1200 | Open in IMG/M |
| 3300007708|Ga0102859_1165386 | Not Available | 652 | Open in IMG/M |
| 3300007974|Ga0105747_1304480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 540 | Open in IMG/M |
| 3300008117|Ga0114351_1269811 | Not Available | 828 | Open in IMG/M |
| 3300009051|Ga0102864_1055973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814 | 1068 | Open in IMG/M |
| 3300009151|Ga0114962_10031350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 3644 | Open in IMG/M |
| 3300009151|Ga0114962_10049475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2775 | Open in IMG/M |
| 3300009151|Ga0114962_10050669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2735 | Open in IMG/M |
| 3300009151|Ga0114962_10053836 | Not Available | 2639 | Open in IMG/M |
| 3300009151|Ga0114962_10097595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 66-9 | 1834 | Open in IMG/M |
| 3300009151|Ga0114962_10232174 | Not Available | 1061 | Open in IMG/M |
| 3300009151|Ga0114962_10355636 | Not Available | 802 | Open in IMG/M |
| 3300009151|Ga0114962_10469190 | Not Available | 670 | Open in IMG/M |
| 3300009151|Ga0114962_10646647 | Not Available | 545 | Open in IMG/M |
| 3300009159|Ga0114978_10700568 | Not Available | 577 | Open in IMG/M |
| 3300009180|Ga0114979_10589320 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009182|Ga0114959_10011443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6059 | Open in IMG/M |
| 3300009182|Ga0114959_10287826 | Not Available | 823 | Open in IMG/M |
| 3300009183|Ga0114974_10191874 | Not Available | 1253 | Open in IMG/M |
| 3300009684|Ga0114958_10137649 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300009684|Ga0114958_10262166 | Not Available | 852 | Open in IMG/M |
| 3300010157|Ga0114964_10088305 | Not Available | 1552 | Open in IMG/M |
| 3300010158|Ga0114960_10240812 | Not Available | 928 | Open in IMG/M |
| 3300010334|Ga0136644_10806659 | Not Available | 504 | Open in IMG/M |
| 3300010370|Ga0129336_10035911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2989 | Open in IMG/M |
| 3300010885|Ga0133913_10028759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14897 | Open in IMG/M |
| 3300010885|Ga0133913_10286443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4369 | Open in IMG/M |
| 3300010885|Ga0133913_10370218 | Not Available | 3789 | Open in IMG/M |
| 3300010885|Ga0133913_10413598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3564 | Open in IMG/M |
| 3300010885|Ga0133913_10596545 | Not Available | 2900 | Open in IMG/M |
| 3300010885|Ga0133913_10730401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2588 | Open in IMG/M |
| 3300010885|Ga0133913_11163112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-6 | 1981 | Open in IMG/M |
| 3300010885|Ga0133913_11371143 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300010885|Ga0133913_11595852 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300010885|Ga0133913_11623779 | Not Available | 1630 | Open in IMG/M |
| 3300010885|Ga0133913_12187731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas | 1364 | Open in IMG/M |
| 3300010885|Ga0133913_12353219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15 | 1305 | Open in IMG/M |
| 3300010885|Ga0133913_12371071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300010885|Ga0133913_12373765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1298 | Open in IMG/M |
| 3300010885|Ga0133913_12581687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
| 3300010885|Ga0133913_12893683 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300010885|Ga0133913_13136245 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300010885|Ga0133913_13140359 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300012013|Ga0153805_1076962 | Not Available | 566 | Open in IMG/M |
| 3300013006|Ga0164294_10036116 | All Organisms → cellular organisms → Bacteria | 3923 | Open in IMG/M |
| 3300013006|Ga0164294_10049032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3286 | Open in IMG/M |
| 3300013006|Ga0164294_10061575 | Not Available | 2872 | Open in IMG/M |
| 3300013006|Ga0164294_10311067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300013006|Ga0164294_10759389 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300013286|Ga0136641_1005720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4500 | Open in IMG/M |
| 3300018815|Ga0187845_1299475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. UNK | 506 | Open in IMG/M |
| 3300018868|Ga0187844_10058366 | Not Available | 1806 | Open in IMG/M |
| 3300018868|Ga0187844_10424621 | Not Available | 543 | Open in IMG/M |
| 3300019093|Ga0187843_10052785 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300019093|Ga0187843_10074180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. MAG2 | 1571 | Open in IMG/M |
| 3300020160|Ga0211733_11238515 | Not Available | 530 | Open in IMG/M |
| 3300020164|Ga0194037_1042029 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300020164|Ga0194037_1066247 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300020167|Ga0194035_1068070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1195 | Open in IMG/M |
| 3300021079|Ga0194055_10147702 | Not Available | 992 | Open in IMG/M |
| 3300021340|Ga0194041_10196564 | Not Available | 616 | Open in IMG/M |
| 3300021519|Ga0194048_10044539 | Not Available | 1812 | Open in IMG/M |
| 3300022752|Ga0214917_10029619 | All Organisms → cellular organisms → Bacteria | 4148 | Open in IMG/M |
| 3300022752|Ga0214917_10046007 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300023174|Ga0214921_10034991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4805 | Open in IMG/M |
| 3300023174|Ga0214921_10053789 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 3498 | Open in IMG/M |
| 3300023174|Ga0214921_10157255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
| 3300023174|Ga0214921_10372433 | Not Available | 746 | Open in IMG/M |
| 3300023174|Ga0214921_10455144 | Not Available | 629 | Open in IMG/M |
| 3300023174|Ga0214921_10512966 | Not Available | 565 | Open in IMG/M |
| 3300023174|Ga0214921_10526751 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300023174|Ga0214921_10532036 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300023184|Ga0214919_10000874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 51054 | Open in IMG/M |
| 3300023184|Ga0214919_10009672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 12395 | Open in IMG/M |
| 3300023184|Ga0214919_10023977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6650 | Open in IMG/M |
| 3300023184|Ga0214919_10040349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4648 | Open in IMG/M |
| 3300023184|Ga0214919_10112354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 2279 | Open in IMG/M |
| 3300023184|Ga0214919_10140889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-6 | 1937 | Open in IMG/M |
| 3300023184|Ga0214919_10203646 | Not Available | 1482 | Open in IMG/M |
| 3300023184|Ga0214919_10249614 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300023184|Ga0214919_10525047 | Not Available | 721 | Open in IMG/M |
| 3300024311|Ga0255211_1066105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 604 | Open in IMG/M |
| 3300024501|Ga0255208_1028194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814 | 878 | Open in IMG/M |
| 3300024563|Ga0255236_1003182 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
| 3300024566|Ga0256309_1065488 | Not Available | 940 | Open in IMG/M |
| 3300027128|Ga0255099_1000136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 30566 | Open in IMG/M |
| 3300027128|Ga0255099_1007686 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300027128|Ga0255099_1010661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1906 | Open in IMG/M |
| 3300027608|Ga0208974_1003064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6073 | Open in IMG/M |
| 3300027679|Ga0209769_1210042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 601 | Open in IMG/M |
| 3300027697|Ga0209033_1002722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 9561 | Open in IMG/M |
| 3300027708|Ga0209188_1120624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. 73C-SIWE | 1024 | Open in IMG/M |
| 3300027712|Ga0209499_1098601 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300027733|Ga0209297_1347292 | Not Available | 539 | Open in IMG/M |
| 3300027746|Ga0209597_1187531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 856 | Open in IMG/M |
| 3300027749|Ga0209084_1082754 | Not Available | 1450 | Open in IMG/M |
| 3300027749|Ga0209084_1145629 | Not Available | 997 | Open in IMG/M |
| 3300027749|Ga0209084_1285233 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027754|Ga0209596_1390377 | Not Available | 525 | Open in IMG/M |
| 3300027772|Ga0209768_10322330 | Not Available | 642 | Open in IMG/M |
| 3300027892|Ga0209550_10799154 | Not Available | 529 | Open in IMG/M |
| 3300028392|Ga0304729_1080497 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031758|Ga0315907_10726605 | Not Available | 751 | Open in IMG/M |
| 3300031758|Ga0315907_10939618 | Not Available | 631 | Open in IMG/M |
| 3300031786|Ga0315908_10185416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1722 | Open in IMG/M |
| 3300031857|Ga0315909_10272643 | Not Available | 1283 | Open in IMG/M |
| 3300031857|Ga0315909_10336868 | Not Available | 1109 | Open in IMG/M |
| 3300032050|Ga0315906_11076318 | Not Available | 596 | Open in IMG/M |
| 3300033995|Ga0335003_0434321 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300034095|Ga0335022_0029738 | All Organisms → cellular organisms → Bacteria | 3617 | Open in IMG/M |
| 3300034121|Ga0335058_0658030 | Not Available | 581 | Open in IMG/M |
| 3300034121|Ga0335058_0689453 | Not Available | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 35.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.54% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.38% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 4.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.62% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.31% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.77% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.77% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002140 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024311 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024501 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M2t2FKB2_10083571 | 3300002140 | Marine | LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRP* |
| JGI25910J50241_100400112 | 3300003388 | Freshwater Lake | VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| JGI25911J50253_100423531 | 3300003411 | Freshwater Lake | VSFNLAEVFAIHRRLRLEGQKALNAKHSQPPSPQLIKVALCA* |
| JGI25912J50252_100020951 | 3300003412 | Freshwater Lake | NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRA* |
| Ga0063233_101873761 | 3300003986 | Freshwater Lake | SFSLAEVFVGHKQLRLPGQEALNAKHLQLLIHQLFKVALSA* |
| Ga0066181_101519741 | 3300004123 | Freshwater Lake | NLISFSLAEVFVGHKQLRLPGQEALNAKHLQLLIHQLFKVALSA* |
| Ga0066179_101730422 | 3300004126 | Freshwater Lake | ISFHLAEMFVIHGQLRLAGQKALNAKHSQPPALTLIKVALRA* |
| Ga0066179_102433002 | 3300004126 | Freshwater Lake | FNLAEMFVVHGQLRLAGQEVLNAKHSQPPLLQLIKVAFRA* |
| Ga0007751_114077742 | 3300004794 | Freshwater Lake | NLAEMFVGHGQLRLAGQEALDAKHSQPPSPQLIKVALRA* |
| Ga0070374_100533992 | 3300005517 | Freshwater Lake | VFLGHKLLRQLGQEYLNAKHPQPPNHQLIKVVLRP* |
| Ga0070374_104808352 | 3300005517 | Freshwater Lake | GLSVSGHKLLRQLGQEYLNAKHPQPPKHQLIKVVLRP* |
| Ga0070374_105809911 | 3300005517 | Freshwater Lake | LISFNLAEMFVVHGQLRLAGQEALNAKHSQPPSLQLLKVALRA* |
| Ga0049083_100373792 | 3300005580 | Freshwater Lentic | AEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0049083_101471541 | 3300005580 | Freshwater Lentic | VFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0049080_100250773 | 3300005582 | Freshwater Lentic | FSLAEVFVFHKQLRLPGQEALNAIHPQPPKHQLIKVALHA* |
| Ga0049080_100251692 | 3300005582 | Freshwater Lentic | LAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0049080_100776934 | 3300005582 | Freshwater Lentic | EMFVGHGQLRLAGQEALNAKHSQPPSPGLIKVALRA* |
| Ga0049080_101081602 | 3300005582 | Freshwater Lentic | VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPLNLQLIKVALRV* |
| Ga0102873_10562941 | 3300007545 | Estuarine | NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHPLFKVALRA* |
| Ga0102859_11653861 | 3300007708 | Estuarine | VFVCHMQIRLPGQEALNAINPNLSNPQLIKVALRA* |
| Ga0105747_13044801 | 3300007974 | Estuary Water | NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRT* |
| Ga0114351_12698112 | 3300008117 | Freshwater, Plankton | FVVHGQLRLAGQEALNAKHSQPPSLKLIKVALRA* |
| Ga0102864_10559733 | 3300009051 | Estuarine | FSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0114962_100313501 | 3300009151 | Freshwater Lake | EMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0114962_100494753 | 3300009151 | Freshwater Lake | HLAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVGLRA* |
| Ga0114962_100506695 | 3300009151 | Freshwater Lake | FVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA* |
| Ga0114962_100538365 | 3300009151 | Freshwater Lake | AEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0114962_100975954 | 3300009151 | Freshwater Lake | AEVFVFHKQLRLPGQEALNAIHPQPPIHQLIKVALRA* |
| Ga0114962_102321742 | 3300009151 | Freshwater Lake | FVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0114962_103556362 | 3300009151 | Freshwater Lake | AEVFVFHKQLRLPGQEALNAIHPQPPYHQLIKVALRA* |
| Ga0114962_104691901 | 3300009151 | Freshwater Lake | AEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA* |
| Ga0114962_106466472 | 3300009151 | Freshwater Lake | FVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0114978_107005682 | 3300009159 | Freshwater Lake | SFNLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0114979_105893201 | 3300009180 | Freshwater Lake | AEVFVFHKQLRLPGQEALDAIHPQPPNHQLIKVALRA* |
| Ga0114959_100114436 | 3300009182 | Freshwater Lake | VFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA* |
| Ga0114959_102878261 | 3300009182 | Freshwater Lake | LISFSLAEVFVFHKQLRLPGQEALNAIHPQPPYHQLIQVALRA* |
| Ga0114974_101918742 | 3300009183 | Freshwater Lake | SLAEMFVGHGQLRLAGQEALNAKHPQPPNHQLIKDAPQN* |
| Ga0114958_101376493 | 3300009684 | Freshwater Lake | AEVFVFHKQLRLAGQEALNAKHPQPPNHQLIKVALRA* |
| Ga0114958_102621662 | 3300009684 | Freshwater Lake | VFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA* |
| Ga0114964_100883054 | 3300010157 | Freshwater Lake | LAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0114960_102408121 | 3300010158 | Freshwater Lake | EVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA* |
| Ga0136644_108066592 | 3300010334 | Freshwater Lake | SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKDALRA* |
| Ga0129336_100359114 | 3300010370 | Freshwater To Marine Saline Gradient | ISFSLAEVFVGRKQLRLPGHEALNAKYLQPHNHQ* |
| Ga0133913_100287591 | 3300010885 | Freshwater Lake | AEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRD* |
| Ga0133913_102864431 | 3300010885 | Freshwater Lake | SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0133913_103702183 | 3300010885 | Freshwater Lake | FSLAEVFVFHKQLRLPGQEALNAIHPQLTNHQLIKVALRA* |
| Ga0133913_104135984 | 3300010885 | Freshwater Lake | FVFHKQLRLPGQEALNAIHPQPPNHQLIKVELRA* |
| Ga0133913_105965454 | 3300010885 | Freshwater Lake | EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0133913_107304014 | 3300010885 | Freshwater Lake | EMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0133913_111631123 | 3300010885 | Freshwater Lake | AEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA* |
| Ga0133913_113711433 | 3300010885 | Freshwater Lake | VNLISFSMAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKDALRA* |
| Ga0133913_115958523 | 3300010885 | Freshwater Lake | VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVPLRD* |
| Ga0133913_116237791 | 3300010885 | Freshwater Lake | SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVELSA* |
| Ga0133913_121877312 | 3300010885 | Freshwater Lake | AEVFVCHMQIRLPGQEALNAINPNLSNPQLIKVVLRA* |
| Ga0133913_123532193 | 3300010885 | Freshwater Lake | MFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA* |
| Ga0133913_123710711 | 3300010885 | Freshwater Lake | EVFVFHKQLRLPGQEDLNAMHPQPPNLQLIKLALRA* |
| Ga0133913_123737652 | 3300010885 | Freshwater Lake | FHLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKIALCA* |
| Ga0133913_125816871 | 3300010885 | Freshwater Lake | SFSLAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRV* |
| Ga0133913_128936834 | 3300010885 | Freshwater Lake | AEMFVGHGQLRLAGQEALNAKHSQPPSPGLIKVALRA* |
| Ga0133913_131362452 | 3300010885 | Freshwater Lake | EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRT* |
| Ga0133913_131403593 | 3300010885 | Freshwater Lake | EVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA* |
| Ga0153805_10769622 | 3300012013 | Surface Ice | GVNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0164294_100361164 | 3300013006 | Freshwater | MFVGDGQLRLGGQEALNAKHFQPPSPQLIKVALRA* |
| Ga0164294_100490323 | 3300013006 | Freshwater | ISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRT* |
| Ga0164294_100615754 | 3300013006 | Freshwater | LADMFIVHGQLQLTGQEALNAKHSQPSSQQLIKVALHL* |
| Ga0164294_103110671 | 3300013006 | Freshwater | ISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA* |
| Ga0164294_107593892 | 3300013006 | Freshwater | LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRT* |
| Ga0136641_10057201 | 3300013286 | Freshwater | GVDLISFNLAEMFVGHGQLRLAGQEALNAKHSQPPSPQLIKVALRT* |
| Ga0187845_12994752 | 3300018815 | Freshwater | AEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA |
| Ga0187844_100583661 | 3300018868 | Freshwater | VFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0187844_104246211 | 3300018868 | Freshwater | AEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0187843_100527851 | 3300019093 | Freshwater | LISFHLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0187843_100741801 | 3300019093 | Freshwater | FSLAEVFVGHKQLRLPGQEALNAKHPQPPNYQLFKVALRA |
| Ga0211733_112385152 | 3300020160 | Freshwater | VFVGHKQLRLPGQEALNAKHPQPSNHQLFKVALRA |
| Ga0194037_10420291 | 3300020164 | Anoxic Zone Freshwater | SLAEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA |
| Ga0194037_10662471 | 3300020164 | Anoxic Zone Freshwater | SFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALCA |
| Ga0194035_10680701 | 3300020167 | Anoxic Zone Freshwater | SNSLAEVFVFHKQLRLPGQEAFNAIHPQPPKHQLIKVALRA |
| Ga0194055_101477021 | 3300021079 | Anoxic Zone Freshwater | DLISFHLAEMFVVHRQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0194041_101965641 | 3300021340 | Anoxic Zone Freshwater | AEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0194048_100445395 | 3300021519 | Anoxic Zone Freshwater | VFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA |
| Ga0214917_100296191 | 3300022752 | Freshwater | ISFSLAEVFVGHKQLRLPGQEALNAKHPQPSNHQLFKVAIRP |
| Ga0214917_100460071 | 3300022752 | Freshwater | CLAEVFVFHKQLRLAGQEALNAKHPQPPHHQLIKVALRT |
| Ga0214921_100349916 | 3300023174 | Freshwater | LISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA |
| Ga0214921_100537893 | 3300023174 | Freshwater | FSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0214921_101572551 | 3300023174 | Freshwater | LAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA |
| Ga0214921_103724331 | 3300023174 | Freshwater | LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA |
| Ga0214921_104551441 | 3300023174 | Freshwater | VFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA |
| Ga0214921_105129663 | 3300023174 | Freshwater | AEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA |
| Ga0214921_105267511 | 3300023174 | Freshwater | LAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRA |
| Ga0214921_105320361 | 3300023174 | Freshwater | VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA |
| Ga0214919_100008741 | 3300023184 | Freshwater | GVDLISFHLAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVELCT |
| Ga0214919_1000967213 | 3300023184 | Freshwater | EVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRP |
| Ga0214919_100239771 | 3300023184 | Freshwater | LAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0214919_100403491 | 3300023184 | Freshwater | SLAEVFVFHKQLRLPGQEALNAIHPQPPIHQLIKVALRA |
| Ga0214919_101123541 | 3300023184 | Freshwater | HLAEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA |
| Ga0214919_101408891 | 3300023184 | Freshwater | EVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA |
| Ga0214919_102036461 | 3300023184 | Freshwater | SFHLTEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0214919_102496142 | 3300023184 | Freshwater | EVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA |
| Ga0214919_105250472 | 3300023184 | Freshwater | MISFHLAEMFVVHGQLRLAGQEALNAKHSQPPLPQLIKVALRA |
| Ga0255211_10661051 | 3300024311 | Freshwater | SFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHHLFKVALRA |
| Ga0255208_10281941 | 3300024501 | Freshwater | LAEVFVGHKQLRLPGQEALNAKHPQPPNHHLFKVALRA |
| Ga0255236_10031821 | 3300024563 | Freshwater | EVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA |
| Ga0256309_10654882 | 3300024566 | Freshwater | AEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA |
| Ga0255099_100013621 | 3300027128 | Freshwater | SLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA |
| Ga0255099_10076864 | 3300027128 | Freshwater | LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA |
| Ga0255099_10106614 | 3300027128 | Freshwater | VFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA |
| Ga0208974_10030648 | 3300027608 | Freshwater Lentic | SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0209769_12100422 | 3300027679 | Freshwater Lake | LAEMFVIHGQLRLAGQKALNAKHSQPPALTLIKVALRA |
| Ga0209033_100272211 | 3300027697 | Freshwater Lake | MFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA |
| Ga0209188_11206242 | 3300027708 | Freshwater Lake | SLAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRD |
| Ga0209499_10986014 | 3300027712 | Freshwater Lake | LAEVFVFHKQLRLAGQEALNAKHPQPPNHQLIKVALRA |
| Ga0209297_13472922 | 3300027733 | Freshwater Lake | LAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0209597_11875312 | 3300027746 | Freshwater Lake | VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVELRA |
| Ga0209084_10827543 | 3300027749 | Freshwater Lake | LAEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA |
| Ga0209084_11456291 | 3300027749 | Freshwater Lake | EMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVGLRA |
| Ga0209084_12852332 | 3300027749 | Freshwater Lake | EMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0209596_13903772 | 3300027754 | Freshwater Lake | LAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0209768_103223301 | 3300027772 | Freshwater Lake | EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA |
| Ga0209550_107991541 | 3300027892 | Freshwater Lake | VFVCHKQLRLAGQEALNAKHPQPPHHQLFKVALRA |
| Ga0304729_10804971 | 3300028392 | Freshwater Lake | LAEMFVIHGQLRLAGQEALNAKHSQPSSPQLIKVALRA |
| Ga0315907_107266051 | 3300031758 | Freshwater | VFKHEAQLRLAGQEALNAKHSQPPSPQLIKVALRA |
| Ga0315907_109396182 | 3300031758 | Freshwater | LAEMFVIHGQLRLAGQEALNAKHSQPPSLQLIKVALRA |
| Ga0315908_101854162 | 3300031786 | Freshwater | LAEMFVVHGQLRLAGQEALNAKHSQPPSLQLIKVALRA |
| Ga0315909_102726432 | 3300031857 | Freshwater | LISFNLAEMFVVHGQLRLAGQEALNAKHSQPPSLQLIKVALRA |
| Ga0315909_103368681 | 3300031857 | Freshwater | RVNLISFSLVEVFVGHKRLRLPGQEALNAKHPQPSNHQLFKVALRA |
| Ga0315906_110763181 | 3300032050 | Freshwater | LVEVFVGHKRLRLPGQEALNAKHPQPSNHQLFKVALRA |
| Ga0335003_0434321_15_131 | 3300033995 | Freshwater | MAEVFVGHKQLRLPGQEALNAKHPQPPDHQLFKVALRA |
| Ga0335022_0029738_1_108 | 3300034095 | Freshwater | MFIGHEQLRLPGQEALNAKHSQPPSPQLIKVALRA |
| Ga0335058_0658030_28_135 | 3300034121 | Freshwater | MLKINAQLRLTDQEALNAKHSQSSLLALIKVALFT |
| Ga0335058_0689453_2_118 | 3300034121 | Freshwater | LAEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA |
| ⦗Top⦘ |