


| Basic Information | |
|---|---|
| Family ID | F062266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 47 residues |
| Representative Sequence | DDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.29 % |
| % of genes near scaffold ends (potentially truncated) | 96.95 % |
| % of genes from short scaffolds (< 2000 bps) | 92.37 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.473 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (16.794 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF03795 | YCII | 9.16 |
| PF00903 | Glyoxalase | 8.40 |
| PF00199 | Catalase | 4.58 |
| PF00144 | Beta-lactamase | 3.82 |
| PF01925 | TauE | 2.29 |
| PF13564 | DoxX_2 | 2.29 |
| PF00496 | SBP_bac_5 | 2.29 |
| PF07690 | MFS_1 | 2.29 |
| PF00072 | Response_reg | 1.53 |
| PF11066 | DUF2867 | 1.53 |
| PF00696 | AA_kinase | 1.53 |
| PF13229 | Beta_helix | 1.53 |
| PF00497 | SBP_bac_3 | 0.76 |
| PF08281 | Sigma70_r4_2 | 0.76 |
| PF02775 | TPP_enzyme_C | 0.76 |
| PF13602 | ADH_zinc_N_2 | 0.76 |
| PF06983 | 3-dmu-9_3-mt | 0.76 |
| PF01223 | Endonuclease_NS | 0.76 |
| PF00378 | ECH_1 | 0.76 |
| PF00067 | p450 | 0.76 |
| PF05988 | DUF899 | 0.76 |
| PF03358 | FMN_red | 0.76 |
| PF12681 | Glyoxalase_2 | 0.76 |
| PF13683 | rve_3 | 0.76 |
| PF11716 | MDMPI_N | 0.76 |
| PF05448 | AXE1 | 0.76 |
| PF14248 | DUF4345 | 0.76 |
| PF02012 | BNR | 0.76 |
| PF05231 | MASE1 | 0.76 |
| PF01810 | LysE | 0.76 |
| PF10041 | DUF2277 | 0.76 |
| PF00106 | adh_short | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.16 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 4.58 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.82 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.82 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.82 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.29 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.76 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.76 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.76 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.76 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.76 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.76 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.76 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.76 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.47 % |
| Unclassified | root | N/A | 1.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_100557422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300002561|JGI25384J37096_10140049 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005172|Ga0066683_10325421 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005172|Ga0066683_10833063 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005176|Ga0066679_11044780 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005177|Ga0066690_10763372 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005180|Ga0066685_10589512 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005180|Ga0066685_10837851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300005353|Ga0070669_100166616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
| 3300005438|Ga0070701_10848273 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005439|Ga0070711_100470227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300005459|Ga0068867_102036061 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005459|Ga0068867_102369701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300005467|Ga0070706_101878804 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005471|Ga0070698_100871585 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005546|Ga0070696_100332337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300005555|Ga0066692_10825512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300005557|Ga0066704_10911105 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300005559|Ga0066700_10188835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1418 | Open in IMG/M |
| 3300005568|Ga0066703_10871377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300005569|Ga0066705_10716131 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005586|Ga0066691_10636897 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005615|Ga0070702_101702974 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005617|Ga0068859_100163864 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300005617|Ga0068859_100879180 | Not Available | 981 | Open in IMG/M |
| 3300005829|Ga0074479_10778536 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005841|Ga0068863_101808008 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005843|Ga0068860_101484426 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005878|Ga0075297_1005735 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300005981|Ga0081538_10125098 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300006031|Ga0066651_10200859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1055 | Open in IMG/M |
| 3300006049|Ga0075417_10316980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 759 | Open in IMG/M |
| 3300006791|Ga0066653_10531463 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006800|Ga0066660_10420122 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1109 | Open in IMG/M |
| 3300006845|Ga0075421_101422428 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
| 3300006854|Ga0075425_100851237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1044 | Open in IMG/M |
| 3300006881|Ga0068865_101106139 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300007255|Ga0099791_10013261 | All Organisms → cellular organisms → Bacteria | 3476 | Open in IMG/M |
| 3300009038|Ga0099829_10870182 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009089|Ga0099828_11967246 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009090|Ga0099827_10319823 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300009090|Ga0099827_11696191 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009094|Ga0111539_12447111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 606 | Open in IMG/M |
| 3300009137|Ga0066709_103228733 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300009156|Ga0111538_11629326 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009157|Ga0105092_10290067 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300009813|Ga0105057_1052751 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009815|Ga0105070_1034158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300009818|Ga0105072_1131351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 518 | Open in IMG/M |
| 3300010029|Ga0105074_1106597 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010043|Ga0126380_12022841 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010047|Ga0126382_10167028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1527 | Open in IMG/M |
| 3300010102|Ga0127453_1117251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300010117|Ga0127449_1056055 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300010303|Ga0134082_10083435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1253 | Open in IMG/M |
| 3300010304|Ga0134088_10651262 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010320|Ga0134109_10078199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1129 | Open in IMG/M |
| 3300010329|Ga0134111_10093623 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010403|Ga0134123_13558781 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300011269|Ga0137392_10351113 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300011417|Ga0137326_1105870 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012200|Ga0137382_10658137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
| 3300012362|Ga0137361_11620508 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012396|Ga0134057_1188040 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300012397|Ga0134056_1069994 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012397|Ga0134056_1102946 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300012400|Ga0134048_1277470 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012403|Ga0134049_1333999 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012407|Ga0134050_1161317 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012410|Ga0134060_1015159 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012925|Ga0137419_10004273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6980 | Open in IMG/M |
| 3300012925|Ga0137419_10131543 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300012929|Ga0137404_11472123 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012930|Ga0137407_10096964 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300012931|Ga0153915_12750098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300012944|Ga0137410_11028052 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012964|Ga0153916_12739625 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012972|Ga0134077_10255425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300012975|Ga0134110_10474971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300012976|Ga0134076_10477190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300014154|Ga0134075_10325515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300014166|Ga0134079_10654181 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300014320|Ga0075342_1205694 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300015358|Ga0134089_10006256 | All Organisms → cellular organisms → Bacteria | 3651 | Open in IMG/M |
| 3300015359|Ga0134085_10536149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300016341|Ga0182035_10165858 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300016371|Ga0182034_11166776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13 | 669 | Open in IMG/M |
| 3300017657|Ga0134074_1312718 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300017659|Ga0134083_10477429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300018052|Ga0184638_1289524 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300018059|Ga0184615_10188066 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300018071|Ga0184618_10373124 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018074|Ga0184640_10475412 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018076|Ga0184609_10558855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300018078|Ga0184612_10200608 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300018431|Ga0066655_10613128 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300018468|Ga0066662_11024146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300019279|Ga0184642_1043954 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300019356|Ga0173481_10697846 | Not Available | 548 | Open in IMG/M |
| 3300019377|Ga0190264_10101183 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300020170|Ga0179594_10288754 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300020170|Ga0179594_10289272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
| 3300023266|Ga0247789_1093856 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025569|Ga0210073_1087749 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300025922|Ga0207646_11593841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 563 | Open in IMG/M |
| 3300025922|Ga0207646_11780702 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026089|Ga0207648_10267348 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300026089|Ga0207648_11976427 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300026298|Ga0209236_1175476 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300026333|Ga0209158_1006779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5999 | Open in IMG/M |
| 3300026335|Ga0209804_1338074 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026540|Ga0209376_1334744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300026552|Ga0209577_10150821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1828 | Open in IMG/M |
| 3300026557|Ga0179587_10371927 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300027324|Ga0209845_1074217 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027384|Ga0209854_1000903 | All Organisms → cellular organisms → Bacteria | 4174 | Open in IMG/M |
| 3300027862|Ga0209701_10482255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300027873|Ga0209814_10236323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
| 3300027877|Ga0209293_10766697 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027954|Ga0209859_1023292 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300028828|Ga0307312_11100220 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300028889|Ga0247827_10170163 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300031908|Ga0310900_11825330 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031944|Ga0310884_10787741 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300031965|Ga0326597_10114712 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300032180|Ga0307471_103598064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300032205|Ga0307472_102613839 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032828|Ga0335080_10127188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2828 | Open in IMG/M |
| 3300033433|Ga0326726_10076220 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300033433|Ga0326726_11443401 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300033486|Ga0316624_11460500 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 16.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.11% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.29% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.53% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1005574223 | 3300001431 | Soil | TAVLHGLDDDQLAKTGTVFTDLPPMTAEQLVMLGLLGHIDDHMGSIRRTIGG* |
| JGI25384J37096_101400491 | 3300002561 | Grasslands Soil | DQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM* |
| Ga0066683_103254213 | 3300005172 | Soil | AKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0066683_108330631 | 3300005172 | Soil | AFAVVRGLNDDQLAKSGTVFTDAPSVTAEQLIMLGLLGHIDDHMGSIRKTVGM* |
| Ga0066679_110447801 | 3300005176 | Soil | AVVRGLSDEQLAKSGTVFTDAPPMTAERLVTAGLLNHIDEHIGSIRKTVGL* |
| Ga0066690_107633722 | 3300005177 | Soil | GLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM* |
| Ga0066685_105895122 | 3300005180 | Soil | GLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0066685_108378512 | 3300005180 | Soil | LAKSVTVFADAPPMTVEQLVMAGLLNHVDEHIGSIRKTAGG* |
| Ga0070669_1001666164 | 3300005353 | Switchgrass Rhizosphere | AAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH* |
| Ga0070701_108482732 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TDEQLTKSGTVFTDAPPMTAEQLINRGLIVHIDEHVGSIRKAVGH* |
| Ga0070711_1004702271 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALHEKGVKAAAAVVRGLDDSQLDNSGTVFTGAPPMTCLQAIDGALINHIDEHMGSIHKTVGA* |
| Ga0068867_1020360612 | 3300005459 | Miscanthus Rhizosphere | DDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH* |
| Ga0068867_1023697012 | 3300005459 | Miscanthus Rhizosphere | KSGTVFTDTPPMTAEQLINLGLLSHIDEHMGSIRTTVGM* |
| Ga0070706_1018788042 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKSGTVFTGLPPMTAEQLITRGLLNHVDEHFGSIRQTVAHPTRG* |
| Ga0070698_1008715851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH* |
| Ga0070696_1003323373 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH* |
| Ga0066692_108255121 | 3300005555 | Soil | NDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIQKTVGM* |
| Ga0066704_109111051 | 3300005557 | Soil | DQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM* |
| Ga0066700_101888351 | 3300005559 | Soil | GTVFTDAPPMTAEQLVMRGLIAHIDEHVGSIRKTVGP* |
| Ga0066703_108713772 | 3300005568 | Soil | AATAFAVVRGLNDDQLAKSGTVFTDVSPMTAEQLILLGLLGHIDDHMGSIRKTIGM* |
| Ga0066705_107161312 | 3300005569 | Soil | GKAFAVVQGLSDDQLAKSGTVFTDAPRMTAEQLIMLGLVGHIDDHMGSIRKTIGM* |
| Ga0066691_106368972 | 3300005586 | Soil | GLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRRTVGM* |
| Ga0070702_1017029742 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIRGLSDDQLAQTGTVFSELPPMSAEQLVNLGLIRHIDEHIGSIRKTIGR* |
| Ga0068859_1001638641 | 3300005617 | Switchgrass Rhizosphere | AAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLITHIDEHVGSIRKAVGR* |
| Ga0068859_1008791802 | 3300005617 | Switchgrass Rhizosphere | AAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH* |
| Ga0074479_107785362 | 3300005829 | Sediment (Intertidal) | AKSGVVFTDAPPMTAERLVMLALVNHIDEHFGSIRKTVGG* |
| Ga0068863_1018080081 | 3300005841 | Switchgrass Rhizosphere | PMAAGVVRGLSDDQLAKSGAVFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK* |
| Ga0068860_1014844262 | 3300005843 | Switchgrass Rhizosphere | PTAAGVVRGLSDDQLAKSGAVFTDAPPMTAEQLIMGGLINHIDEHIGSIKKTVGK* |
| Ga0075297_10057351 | 3300005878 | Rice Paddy Soil | EQLAKSATLGPGGPTMTAEQLITRGLLNHIDEHFGSIRKTVGH* |
| Ga0081538_101250981 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AVVRGLHDDQLAEHGTVFTDAPPMTAEEVIASGLITHIDAHIGSIRKTVGS* |
| Ga0066651_102008591 | 3300006031 | Soil | KSGTVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV* |
| Ga0075417_103169804 | 3300006049 | Populus Rhizosphere | NSGTVFTGAPPMTCLQVIDGALINHIDEHMGSIHKTVGG* |
| Ga0066653_105314633 | 3300006791 | Soil | FAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0066660_104201221 | 3300006800 | Soil | TVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV* |
| Ga0075421_1014224281 | 3300006845 | Populus Rhizosphere | LATSGVVLADAPPLTAEQLIERGLIAHIDEHFGNIRRAVGPAPAG* |
| Ga0075425_1008512371 | 3300006854 | Populus Rhizosphere | TVFADVPPMSAEQLIMLGLLGHIDEHMGSIRKTAGM* |
| Ga0068865_1011061391 | 3300006881 | Miscanthus Rhizosphere | VFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK* |
| Ga0099791_100132615 | 3300007255 | Vadose Zone Soil | SKSGTVFTDVPPMTAERLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0099829_108701823 | 3300009038 | Vadose Zone Soil | AKSGTVFAGLPPMTAEQLALRALINHTDEHYGSIKKTIGA* |
| Ga0099828_119672461 | 3300009089 | Vadose Zone Soil | TVFTDAPPMTAEQLIMLGLLGHIDDHMGSIRKTIGM* |
| Ga0099827_103198231 | 3300009090 | Vadose Zone Soil | KGAPAAAAVVRGLNDDQLAKSGTVFADAPPMTAEQLIARGLINHVDEHVGSIRKTVGH* |
| Ga0099827_116961912 | 3300009090 | Vadose Zone Soil | SDEQLAKSGTVFVGMPPMTAEDMVVRALLGHLDEHYGSIRKTVGA* |
| Ga0111539_124471112 | 3300009094 | Populus Rhizosphere | TAAAAGVRGLSDDQLAKSGTVFTDAPPMTAEQLIMLALLGHIDDHMGSIRKTVGG* |
| Ga0066709_1032287331 | 3300009137 | Grasslands Soil | LNDDQLAKSGTVFTDVPPMTAERLIMLGLHSHIDEHVGSIRKTIDH* |
| Ga0111538_116293261 | 3300009156 | Populus Rhizosphere | SDDQLAKSGTVLSDAPPMTAEQVVTGILISHIDDHFGSIRKTVGH* |
| Ga0105092_102900671 | 3300009157 | Freshwater Sediment | TVRGLSDEELAKRGAVFTDAPPMSAEELVMGALIIHIDEHFGSIRRTVGL* |
| Ga0105057_10527511 | 3300009813 | Groundwater Sand | AVLRGLSDDQLAKSGIVLTDAPPMSVEQIVTGGLILHLDDHFGSIRKTLGQ* |
| Ga0105070_10341582 | 3300009815 | Groundwater Sand | VAAAAATIRGLSDDQLAKSGTVFTGMPPMTAEQLITSGLLDHTDEHFGSIRKTVGHGTGR |
| Ga0105072_11313512 | 3300009818 | Groundwater Sand | DQLAKSGTVFTGMPPMTAEQLITCGLLDHTDEHFGSIRKTVGHGTGR* |
| Ga0105074_11065971 | 3300010029 | Groundwater Sand | IVFTDAPPMAVEQLVTSGLIIHIDEHFGSIRKTVGK* |
| Ga0126380_120228411 | 3300010043 | Tropical Forest Soil | EAVIAAGLVRRLSDDDLAKSGTVLTDRPPMTAEQLITAGLIVHIDQHSGSIRKTVDHSRVKPIPE* |
| Ga0126382_101670284 | 3300010047 | Tropical Forest Soil | ATSGTVFTDAPPMTAEQLIRLGLLGHIDDHMGSIRKTVGV* |
| Ga0127453_11172512 | 3300010102 | Grasslands Soil | LNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0127449_10560552 | 3300010117 | Grasslands Soil | AFAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134082_100834351 | 3300010303 | Grasslands Soil | DQLAKSGTVFTDVSPMTAEQLILLGLLGHIDDHMGSIRKTVGV* |
| Ga0134088_106512621 | 3300010304 | Grasslands Soil | GTVFTDAPPMTAEQLIMLGLVGHIDDHMGSIRKTIGM* |
| Ga0134109_100781992 | 3300010320 | Grasslands Soil | AATAFAVVRGLNDDQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM* |
| Ga0134111_100936231 | 3300010329 | Grasslands Soil | LATSETVFTDAPPMTAEQLIMLGLVGHIDDHTGSIRKTVGM* |
| Ga0134123_135587812 | 3300010403 | Terrestrial Soil | VRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIMHIDEHVGSIRKAVGH* |
| Ga0137392_103511131 | 3300011269 | Vadose Zone Soil | EQLAKSGTVFAGLPPMTAEQLALRALINHTDEHYGSIRKTIGA* |
| Ga0137326_11058702 | 3300011417 | Soil | RGLSDEQLAKRATVLADAPPMSVEELIMGGLLGHIDDHFGSIRKTVGR* |
| Ga0137382_106581372 | 3300012200 | Vadose Zone Soil | FTDGPPMTAEQLINLGLLSHVDEHMGSIRTTVGM* |
| Ga0137361_116205081 | 3300012362 | Vadose Zone Soil | LAKSVTVFTDGPPMTAEQLIMLGLLGHIDEHVGSIRKTIDH* |
| Ga0134057_11880402 | 3300012396 | Grasslands Soil | AFAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134056_10699942 | 3300012397 | Grasslands Soil | FAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIEEHMGSIRKTVGM* |
| Ga0134056_11029462 | 3300012397 | Grasslands Soil | DDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134048_12774701 | 3300012400 | Grasslands Soil | NDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134049_13339992 | 3300012403 | Grasslands Soil | AVRAFAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134050_11613172 | 3300012407 | Grasslands Soil | VWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0134060_10151592 | 3300012410 | Grasslands Soil | GLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIEEHMGSIRKTVGM* |
| Ga0137419_100042731 | 3300012925 | Vadose Zone Soil | SVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM* |
| Ga0137419_101315431 | 3300012925 | Vadose Zone Soil | TAAATIRGLSDAELAASGTVLKGLPPMTAEQLIAGGLLGHIDEHYGSIRKTVGH* |
| Ga0137404_114721231 | 3300012929 | Vadose Zone Soil | VQSLSDDQLATSGTVFTDAPPMTAEQLTMLGLIGHIDDHVGSIRKTVGM* |
| Ga0137407_100969641 | 3300012930 | Vadose Zone Soil | QLATSGTVFTDAPPMTAEQLTMLGLIGHIDDHVGSIRKTVGM* |
| Ga0153915_127500981 | 3300012931 | Freshwater Wetlands | GAATAAAVVRGLSDDQLAKSGIVFTDAPPMTAEQLVQRGLVGHIDEHFGSIRKTVAKP* |
| Ga0137410_110280521 | 3300012944 | Vadose Zone Soil | SDDQLAKSGAVFTDAPPMTAEQLVMGGLINHIDEHIGSIQKTVGK* |
| Ga0153916_127396252 | 3300012964 | Freshwater Wetlands | AIAVAVIRGLSDDQLAKSGIVFTDAPPMTAEQLITGGLLGHIEEHFGSIRKTVGN* |
| Ga0134077_102554253 | 3300012972 | Grasslands Soil | GTVFTDAPPMTAEQLIKLGLVGHIDDHMGSIRKTVGM* |
| Ga0134110_104749711 | 3300012975 | Grasslands Soil | DDQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM* |
| Ga0134076_104771901 | 3300012976 | Grasslands Soil | LAKSGTVFADAPPMTAEQLIARGLINHVDEPVASIRKTVGH* |
| Ga0134075_103255152 | 3300014154 | Grasslands Soil | ATASAVVRGLNDDQLAKSGIVFTDAPPMTAEQLIMRGLLGHIDDHMGSIRRTVAA* |
| Ga0134079_106541811 | 3300014166 | Grasslands Soil | TVFAGAPPMTAEQLITRGLIGQIDEHFGSIRKTVGR* |
| Ga0075342_12056941 | 3300014320 | Natural And Restored Wetlands | AAVVLGLSDQELAKSGTVLTGAPPMTAEQVVTGILINHIDSHFGSIRKTVGR* |
| Ga0134089_100062561 | 3300015358 | Grasslands Soil | QLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGV* |
| Ga0134085_105361492 | 3300015359 | Grasslands Soil | LHDDQLTKSGTVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV* |
| Ga0182035_101658583 | 3300016341 | Soil | SLSDDQLAKSGAVFSDVPPITAEQLIMRGLLSHIDEHMGSIRKTVGM |
| Ga0182034_111667762 | 3300016371 | Soil | PVFTEAPPMTAEQLIQGALIHHVDEHIGSIRKTVGH |
| Ga0134074_13127181 | 3300017657 | Grasslands Soil | VVQSLSDDQLATSGTVFTDAPPMTAEQLIMLGLVGHIDDHTGSIRKTVGM |
| Ga0134083_104774292 | 3300017659 | Grasslands Soil | LSDDQLATSGTVFTDAPPMTAEQLIKLGLVGHIDDHMGSIRKTVGM |
| Ga0184638_12895241 | 3300018052 | Groundwater Sediment | VVRGLSDDQLARSGTVVRDAPPMTAEQVVTGGLFRHIDDHIGSIRKTVGK |
| Ga0184615_101880661 | 3300018059 | Groundwater Sediment | RGLSDDQMAKSGIVFTDAPAMTAEQLVQRGLVSHIDEHVGSIRKTVGR |
| Ga0184618_103731241 | 3300018071 | Groundwater Sediment | TVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG |
| Ga0184640_104754122 | 3300018074 | Groundwater Sediment | PVAAAVVRGLSDDQLAKSGAVFTDAPPMTAEQVVMGGLITHIDEHFGSIRKTVGQ |
| Ga0184609_105588551 | 3300018076 | Groundwater Sediment | SGTVMKEMPPLTAEQMVIGGLIKHVDEHVASIRGTVGA |
| Ga0184612_102006083 | 3300018078 | Groundwater Sediment | SDDQLAKSGAVFTDAPPMTAEQVVMGGLITHIDEHFGSIRKTVGG |
| Ga0066655_106131282 | 3300018431 | Grasslands Soil | AKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM |
| Ga0066662_110241463 | 3300018468 | Grasslands Soil | AKSGTVFADAPPMTAEQLIARGLINHVDEHVASIRKTVGH |
| Ga0184642_10439542 | 3300019279 | Groundwater Sediment | VRGLSDDQLAKSGTVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG |
| Ga0173481_106978461 | 3300019356 | Soil | HLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAIAH |
| Ga0190264_101011834 | 3300019377 | Soil | GLSDAELATSGTLLKGLPPMTAEQVIVNGLLVHIDEHFGSIRKTVGH |
| Ga0179594_102887541 | 3300020170 | Vadose Zone Soil | VFTDAPPMTAERLIMLGLLGHIDEHLGSIRKTVGM |
| Ga0179594_102892722 | 3300020170 | Vadose Zone Soil | GTVFTEVPPMTAEQLIVLGLLGHIDDHMGSIRKTIGM |
| Ga0247789_10938562 | 3300023266 | Soil | AAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH |
| Ga0210073_10877493 | 3300025569 | Natural And Restored Wetlands | ARTGVVFAGAPAMSSEQLIMLGLINHIDEHFGSIQKTVGG |
| Ga0207646_115938412 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DQLAKSGTVFTGLPPMTAEQLITRGLLNHVDEHFGSIRQTVGDATRG |
| Ga0207646_117807021 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH |
| Ga0207648_102673482 | 3300026089 | Miscanthus Rhizosphere | TAAAVVRGLSDEQLAKSGAVFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK |
| Ga0207648_119764271 | 3300026089 | Miscanthus Rhizosphere | DDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH |
| Ga0209236_11754761 | 3300026298 | Grasslands Soil | MRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDDHMGSIRRAVGM |
| Ga0209158_10067798 | 3300026333 | Soil | RAFAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM |
| Ga0209804_13380742 | 3300026335 | Soil | LHNQGVAAAAAVVRGLSDEQLAKSGTVFTDAPPMTAERLVTAGLLNHIDEHIGSIRKTVG |
| Ga0209376_13347441 | 3300026540 | Soil | RGLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM |
| Ga0209577_101508214 | 3300026552 | Soil | LSDDQLAKSGTVFTDAPPMTAEQLVMRGLIAHIDEHVGSIRKTVGP |
| Ga0179587_103719273 | 3300026557 | Vadose Zone Soil | AAATIRGLSDAELAASGTVLKGLPPMTAEQLIAGGLLGHIDEHYGSIRKTVGH |
| Ga0209845_10742171 | 3300027324 | Groundwater Sand | LDDDQLAKSGTVVTDAPPMTAEQVVTGGLFRHIDEHFGSIRKTVGK |
| Ga0209854_10009036 | 3300027384 | Groundwater Sand | RNLSDDQLAKSGIVLTDAPPMSVEQIVTGGLILHLDDHFGSIRKTLGQ |
| Ga0209701_104822552 | 3300027862 | Vadose Zone Soil | VRPRLYAPRGTAAAVVRGLSDEQLARSGIVFAGMPPSAEQLVMGGLINHVDEHSGSVRKTIGY |
| Ga0209814_102363234 | 3300027873 | Populus Rhizosphere | VVRGLDDSQLNNSGTVFTGAPPMTCLQVIDGALINHIDEHMGSIHKTVGG |
| Ga0209293_107666972 | 3300027877 | Wetland | IAVAVIRGLSDDQLAKSGIVFSDAPPMTAEQLITGGLLNHIDAHFGSIRKTVRNS |
| Ga0209859_10232921 | 3300027954 | Groundwater Sand | ATIRGLSDDQLAKSGTVFTGMPPMTAEQLIISGLLDHTDEHFGSIRKTVGDGTEW |
| Ga0307312_111002202 | 3300028828 | Soil | DQLAKSGTVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG |
| Ga0247827_101701631 | 3300028889 | Soil | LAKSGTVFTDAPPMTAEQLVTRGLINHIDEHVGSIRKAVGH |
| Ga0310900_118253302 | 3300031908 | Soil | SGLVFSELPPMTAEQLIMGGLLNHIDEHIGSIRTTVGR |
| Ga0310884_107877412 | 3300031944 | Soil | LSDDQLAKSGTVFSDAPPMTAEQLMMRALLSHIDEHIGSIRKTVGI |
| Ga0326597_101147122 | 3300031965 | Soil | VRDLSDEQLAKSGIVFTGMPPMTAEQLVMRGLLGHIDEHFGSIRKTIGG |
| Ga0307471_1035980641 | 3300032180 | Hardwood Forest Soil | GTVFTDVPPMTAEQLVMRGLIGHIDEHVGSIRKTVGP |
| Ga0307472_1026138391 | 3300032205 | Hardwood Forest Soil | GVVRGLNDDQLGKSGTVFTDTPPMTAEQMIMLGLLGHIDEHIGSIRKTVGR |
| Ga0335080_101271884 | 3300032828 | Soil | AATVRGLSDDQLAKTGTVFTDMPPMTAEQLIMRGLLSHIDEHIGSIRKTVGM |
| Ga0326726_100762201 | 3300033433 | Peat Soil | AATVRGLSDEQLAKRGTVFSDAPPMSAEELIMGGLILHIDEHVGSIRKTVGL |
| Ga0326726_114434012 | 3300033433 | Peat Soil | GAAIAAAVIRGLSDDQLGKSAIVIANAPPMTAEQLITGGLLGHIDEHFRSIRKTV |
| Ga0316624_114605001 | 3300033486 | Soil | SDDQLAKSGMIVPGAPPMTVEQLITGGLINHLDQHFGSIRKTVGR |
| ⦗Top⦘ |