


| Basic Information | |
|---|---|
| Family ID | F062075 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LYTDSNVVDGSSYCYATTAVNTSNEESGYSNIVSNVQIPAP |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.29 % |
| % of genes near scaffold ends (potentially truncated) | 93.89 % |
| % of genes from short scaffolds (< 2000 bps) | 81.68 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.122 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.687 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.244 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.305 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.84% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF15780 | ASH | 12.21 |
| PF13439 | Glyco_transf_4 | 1.53 |
| PF01850 | PIN | 1.53 |
| PF04616 | Glyco_hydro_43 | 1.53 |
| PF13618 | Gluconate_2-dh3 | 1.53 |
| PF00723 | Glyco_hydro_15 | 1.53 |
| PF08238 | Sel1 | 0.76 |
| PF04041 | Glyco_hydro_130 | 0.76 |
| PF02604 | PhdYeFM_antitox | 0.76 |
| PF13561 | adh_short_C2 | 0.76 |
| PF04392 | ABC_sub_bind | 0.76 |
| PF13432 | TPR_16 | 0.76 |
| PF00534 | Glycos_transf_1 | 0.76 |
| PF13646 | HEAT_2 | 0.76 |
| PF07238 | PilZ | 0.76 |
| PF14384 | BrnA_antitoxin | 0.76 |
| PF00012 | HSP70 | 0.76 |
| PF02350 | Epimerase_2 | 0.76 |
| PF08308 | PEGA | 0.76 |
| PF00144 | Beta-lactamase | 0.76 |
| PF13692 | Glyco_trans_1_4 | 0.76 |
| PF01061 | ABC2_membrane | 0.76 |
| PF01261 | AP_endonuc_2 | 0.76 |
| PF07589 | PEP-CTERM | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF13424 | TPR_12 | 0.76 |
| PF02357 | NusG | 0.76 |
| PF13242 | Hydrolase_like | 0.76 |
| PF13649 | Methyltransf_25 | 0.76 |
| PF00069 | Pkinase | 0.76 |
| PF02687 | FtsX | 0.76 |
| PF00857 | Isochorismatase | 0.76 |
| PF00171 | Aldedh | 0.76 |
| PF03720 | UDPG_MGDP_dh_C | 0.76 |
| PF00733 | Asn_synthase | 0.76 |
| PF06662 | C5-epim_C | 0.76 |
| PF00085 | Thioredoxin | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.05 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.53 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.76 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.76 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.76 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.76 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.76 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.76 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.76 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.12 % |
| Unclassified | root | N/A | 35.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZTSFBX01EH6NQ | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1021180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 563 | Open in IMG/M |
| 3300000789|JGI1027J11758_12679346 | Not Available | 696 | Open in IMG/M |
| 3300000955|JGI1027J12803_103169064 | Not Available | 513 | Open in IMG/M |
| 3300001593|JGI12635J15846_10447528 | Not Available | 770 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101216889 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300004152|Ga0062386_100572296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300004152|Ga0062386_101858547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300004479|Ga0062595_100005850 | All Organisms → cellular organisms → Bacteria | 3585 | Open in IMG/M |
| 3300005186|Ga0066676_10715168 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005526|Ga0073909_10163261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300005537|Ga0070730_10938971 | Not Available | 541 | Open in IMG/M |
| 3300005542|Ga0070732_10672803 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005568|Ga0066703_10231054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300005575|Ga0066702_10237341 | Not Available | 1111 | Open in IMG/M |
| 3300005610|Ga0070763_10900342 | Not Available | 526 | Open in IMG/M |
| 3300005764|Ga0066903_105671497 | Not Available | 657 | Open in IMG/M |
| 3300005874|Ga0075288_1008767 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300005921|Ga0070766_11051476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300006052|Ga0075029_100001041 | All Organisms → cellular organisms → Bacteria | 15901 | Open in IMG/M |
| 3300006059|Ga0075017_101576745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300006086|Ga0075019_10740750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 623 | Open in IMG/M |
| 3300006162|Ga0075030_101491562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300006174|Ga0075014_100045588 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300006176|Ga0070765_100021223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4865 | Open in IMG/M |
| 3300006176|Ga0070765_101084882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300006237|Ga0097621_100786963 | Not Available | 881 | Open in IMG/M |
| 3300006755|Ga0079222_12280496 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006854|Ga0075425_103131822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geopsychrobacter → Geopsychrobacter electrodiphilus | 504 | Open in IMG/M |
| 3300006893|Ga0073928_11216705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. M18 | 507 | Open in IMG/M |
| 3300006954|Ga0079219_11059407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300007076|Ga0075435_101031614 | Not Available | 718 | Open in IMG/M |
| 3300009549|Ga0116137_1082321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 972 | Open in IMG/M |
| 3300009759|Ga0116101_1199114 | Not Available | 510 | Open in IMG/M |
| 3300009824|Ga0116219_10008700 | All Organisms → cellular organisms → Bacteria | 6804 | Open in IMG/M |
| 3300009824|Ga0116219_10809067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010048|Ga0126373_10536966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1216 | Open in IMG/M |
| 3300010048|Ga0126373_11761194 | Not Available | 683 | Open in IMG/M |
| 3300010048|Ga0126373_12735340 | Not Available | 551 | Open in IMG/M |
| 3300010341|Ga0074045_10084977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2209 | Open in IMG/M |
| 3300010358|Ga0126370_12489562 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010361|Ga0126378_10628872 | Not Available | 1187 | Open in IMG/M |
| 3300010361|Ga0126378_11418538 | Not Available | 786 | Open in IMG/M |
| 3300010366|Ga0126379_10187779 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300010366|Ga0126379_11719693 | Not Available | 732 | Open in IMG/M |
| 3300010376|Ga0126381_101234671 | Not Available | 1080 | Open in IMG/M |
| 3300010376|Ga0126381_101357567 | Not Available | 1027 | Open in IMG/M |
| 3300010376|Ga0126381_102366749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300010376|Ga0126381_103999509 | Not Available | 574 | Open in IMG/M |
| 3300010379|Ga0136449_101416144 | Not Available | 1072 | Open in IMG/M |
| 3300010398|Ga0126383_10087147 | Not Available | 2747 | Open in IMG/M |
| 3300010398|Ga0126383_10614260 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300010937|Ga0137776_1352821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300012207|Ga0137381_11356892 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012363|Ga0137390_10714928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300012961|Ga0164302_11890044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300014169|Ga0181531_10576468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300014501|Ga0182024_10367538 | Not Available | 1873 | Open in IMG/M |
| 3300014501|Ga0182024_11813121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300015371|Ga0132258_11679943 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300017938|Ga0187854_10194855 | Not Available | 898 | Open in IMG/M |
| 3300017955|Ga0187817_10484256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300017959|Ga0187779_10019964 | All Organisms → cellular organisms → Bacteria | 3818 | Open in IMG/M |
| 3300017972|Ga0187781_10000027 | All Organisms → cellular organisms → Bacteria | 92465 | Open in IMG/M |
| 3300017972|Ga0187781_10953353 | Not Available | 626 | Open in IMG/M |
| 3300017975|Ga0187782_10171164 | Not Available | 1621 | Open in IMG/M |
| 3300017975|Ga0187782_11099983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300017995|Ga0187816_10028533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2248 | Open in IMG/M |
| 3300017995|Ga0187816_10435438 | Not Available | 585 | Open in IMG/M |
| 3300017995|Ga0187816_10505924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300018006|Ga0187804_10254116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300018006|Ga0187804_10460190 | Not Available | 568 | Open in IMG/M |
| 3300018042|Ga0187871_10638519 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018047|Ga0187859_10195688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300018057|Ga0187858_10389725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300018062|Ga0187784_10077077 | All Organisms → cellular organisms → Bacteria | 2706 | Open in IMG/M |
| 3300018085|Ga0187772_10048177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2607 | Open in IMG/M |
| 3300018086|Ga0187769_10594733 | Not Available | 836 | Open in IMG/M |
| 3300018090|Ga0187770_11726780 | Not Available | 512 | Open in IMG/M |
| 3300018433|Ga0066667_12350002 | Not Available | 500 | Open in IMG/M |
| 3300020579|Ga0210407_10048186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3177 | Open in IMG/M |
| 3300020579|Ga0210407_11004624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300020581|Ga0210399_10266204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300021171|Ga0210405_10110547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2170 | Open in IMG/M |
| 3300021401|Ga0210393_11322733 | Not Available | 577 | Open in IMG/M |
| 3300021403|Ga0210397_11620032 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021406|Ga0210386_10026730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4520 | Open in IMG/M |
| 3300021406|Ga0210386_10237900 | Not Available | 1551 | Open in IMG/M |
| 3300021474|Ga0210390_11593885 | Not Available | 514 | Open in IMG/M |
| 3300021475|Ga0210392_11028092 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021477|Ga0210398_10725813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300021479|Ga0210410_11269637 | Not Available | 629 | Open in IMG/M |
| 3300025320|Ga0209171_10148071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1376 | Open in IMG/M |
| 3300025812|Ga0208457_1080976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300025898|Ga0207692_10237740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300025915|Ga0207693_10050975 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
| 3300025929|Ga0207664_10142678 | Not Available | 2028 | Open in IMG/M |
| 3300025929|Ga0207664_10689734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300025939|Ga0207665_11437863 | Not Available | 549 | Open in IMG/M |
| 3300026324|Ga0209470_1267095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300026529|Ga0209806_1285390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300027829|Ga0209773_10220290 | Not Available | 793 | Open in IMG/M |
| 3300027842|Ga0209580_10152294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300027854|Ga0209517_10006391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14594 | Open in IMG/M |
| 3300027857|Ga0209166_10542927 | Not Available | 594 | Open in IMG/M |
| 3300027879|Ga0209169_10257630 | Not Available | 915 | Open in IMG/M |
| 3300027895|Ga0209624_10349224 | Not Available | 986 | Open in IMG/M |
| 3300027905|Ga0209415_10063839 | All Organisms → cellular organisms → Bacteria | 4483 | Open in IMG/M |
| 3300027908|Ga0209006_10051954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3679 | Open in IMG/M |
| 3300027908|Ga0209006_10065330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3248 | Open in IMG/M |
| 3300027911|Ga0209698_10006138 | All Organisms → cellular organisms → Bacteria | 12829 | Open in IMG/M |
| 3300027911|Ga0209698_10302326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300028023|Ga0265357_1039794 | Not Available | 550 | Open in IMG/M |
| 3300028780|Ga0302225_10412543 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300028800|Ga0265338_10114844 | Not Available | 2159 | Open in IMG/M |
| 3300030706|Ga0310039_10092841 | Not Available | 1271 | Open in IMG/M |
| 3300030815|Ga0265746_1033375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300031718|Ga0307474_10133050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1870 | Open in IMG/M |
| 3300031823|Ga0307478_10048525 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300032174|Ga0307470_10934291 | Not Available | 684 | Open in IMG/M |
| 3300032180|Ga0307471_102233211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300032770|Ga0335085_10981991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300032783|Ga0335079_11064710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300032805|Ga0335078_10327012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2047 | Open in IMG/M |
| 3300032892|Ga0335081_11668358 | Not Available | 696 | Open in IMG/M |
| 3300032898|Ga0335072_10355704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300032898|Ga0335072_10708441 | Not Available | 983 | Open in IMG/M |
| 3300032954|Ga0335083_10202818 | Not Available | 1813 | Open in IMG/M |
| 3300033887|Ga0334790_055308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300033977|Ga0314861_0103283 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300033977|Ga0314861_0285067 | Not Available | 749 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.53% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.53% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.53% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_06993840 | 2170459024 | Grass Soil | TGTLYTDTTVANGNNYCYATTAVDSSSRESSYSNIVSNVKVPAL |
| AP72_2010_repI_A1DRAFT_10211802 | 3300000650 | Forest Soil | TDSSVKNGSSYCYATTAVDTSNDESGYSNIVSNVQIPAQ* |
| JGI1027J11758_126793462 | 3300000789 | Soil | LNTGTLYTDSSVANGSAYCFATTAVDTSNLESAYSNIVSNVKIPTQ* |
| JGI1027J12803_1031690642 | 3300000955 | Soil | YTDTTVTNGNDYCYATTAVDSSSQESTYSNIVSNVQVPAN* |
| JGI12635J15846_104475282 | 3300001593 | Forest Soil | AVVDGATYCYATTAVNTSNEESGYSNEVSNVQVPAP* |
| JGIcombinedJ26739_1012168893 | 3300002245 | Forest Soil | YTDSVVTDGTSYCYATTAVNSSNQESSYSNIASNVQIPAP* |
| Ga0062386_1005722961 | 3300004152 | Bog Forest Soil | LYVDANVADGTKYCYATTAVNTSSQESGYSNVVSNVQIPPP* |
| Ga0062386_1018585472 | 3300004152 | Bog Forest Soil | ADRQVVDGTSYCYATAAVNSSNEQSDYSNIVSDVQVPAS* |
| Ga0062595_1000058502 | 3300004479 | Soil | VLTTTTLYTDSNVVDGKSYCYAATAVNSSSQESGYSNIASNVQIPAP* |
| Ga0066676_107151682 | 3300005186 | Soil | SVLTTTTLYTDSNVVDGKSYCYAATAVNSSSQESGYSNVASNVQIPAP* |
| Ga0073909_101632613 | 3300005526 | Surface Soil | DTTVANGNNYCYATTAVDSSSQESTYSNIVSNVQVPAN* |
| Ga0070730_109389711 | 3300005537 | Surface Soil | GTLYTDAAVTDGTSYCYAATAVNTSNAESGYSNIVSNIQIPAP* |
| Ga0070732_106728032 | 3300005542 | Surface Soil | VDGTSYCYASTAVNTSNEESGYSNIVSNVQIPAP* |
| Ga0066703_102310541 | 3300005568 | Soil | YSDFSVIDGTNYCYATTAVNSSNEESGYSNIVSDVRIPAP* |
| Ga0066702_102373413 | 3300005575 | Soil | YSDNTVANATTYCYATTAVDTTNAESGDSNIVSNVAIP* |
| Ga0070763_109003422 | 3300005610 | Soil | GLLYTDSNVVDGTSYCYAATAVNTSQEESSYSNIASNVQIPAP* |
| Ga0066903_1056714971 | 3300005764 | Tropical Forest Soil | VTDGTAYCYAATAVNASNEESGYSNIVTDLQIPPP* |
| Ga0075288_10087672 | 3300005874 | Rice Paddy Soil | FKINSVPITSTSYTDSEVGSGAAYCYATTAISTSGAESGYSNIVSSVQIPAS* |
| Ga0070766_110514761 | 3300005921 | Soil | SSVTDGTNYCYATTAVNSSSEESGYSNIVSDVQIPPP* |
| Ga0075029_1000010418 | 3300006052 | Watersheds | VVLDGTSYCYITNAVNSSNEESGCSNIAYNVQIPAP* |
| Ga0075017_1015767451 | 3300006059 | Watersheds | TLYTDSVVVNGTSYCYATTAVDSSNQESGYSNIVSNVQIPAP* |
| Ga0075019_107407501 | 3300006086 | Watersheds | GTLYTDSSVKNATSYCYATTAVDTSNVESGYSNIVSNVQIPVQ* |
| Ga0075030_1014915621 | 3300006162 | Watersheds | NILDTLTTYTDSAVTDGTNYCYATTAVNSSSEESGYSNIVSDVQIPPP* |
| Ga0075014_1000455881 | 3300006174 | Watersheds | NTSTLYTDSVVVDGTSYCYATTAVNSSNEESGYSNIVSNVQIPAP* |
| Ga0070765_1000212235 | 3300006176 | Soil | SDSTVVDGASYCYAATAVNTSNEESGYSNIVSNIQIPPA* |
| Ga0070765_1010848823 | 3300006176 | Soil | MNGSTLITLTTYSDSSVTDGTHYCYATTAVNSSSEESGYSNIVSDVQIPPP* |
| Ga0097621_1007869631 | 3300006237 | Miscanthus Rhizosphere | YTDSSVANGKSYCYASTAVNTSNEESGYSNIVSNVQIPIS* |
| Ga0079222_122804962 | 3300006755 | Agricultural Soil | TTTLYTDSNVVDGKSYCYAATAVNSSSQESGYSNIASNVQIPAQ* |
| Ga0075425_1031318221 | 3300006854 | Populus Rhizosphere | TDSSVLDGTSYCFAVTAVDTSNEESTYSNVVANVQVP* |
| Ga0073928_112167051 | 3300006893 | Iron-Sulfur Acid Spring | TTYSDSSVTDGTHYCYATTAVNSSSEESGYSNIVSDVQIPPP* |
| Ga0079219_110594071 | 3300006954 | Agricultural Soil | VVDGKSYCYAATAVNSSSQESGYSNIASNVQIPAQ* |
| Ga0075435_1010316141 | 3300007076 | Populus Rhizosphere | LYTDSNVVNGKSYCYATTAVNTSNEESSYSNIVSNVQIPLQ* |
| Ga0116137_10823213 | 3300009549 | Peatland | PVTDGTNYCYATTAVNSSNEESGYSNIVSDVQIPAP* |
| Ga0116101_11991142 | 3300009759 | Peatland | YTDSAVVDSATYCYATTAVNTSNEESAYSNVVSNVQVPAP* |
| Ga0116219_100087009 | 3300009824 | Peatlands Soil | VDGTAYCYATTAVNSSNEESGYSNIVSNLQIPPP* |
| Ga0116219_108090672 | 3300009824 | Peatlands Soil | YSDSSVTDGTKYCYATTAVNSSNEESGYSNIVSDVQIPPP* |
| Ga0126373_105369663 | 3300010048 | Tropical Forest Soil | DSNVADGTSYCYATTAVNTSNEESGYSNIVSNVLVPVL* |
| Ga0126373_117611941 | 3300010048 | Tropical Forest Soil | SSLIASTVYTDSVVVDGKSYCYATTAVNSSNEESGYSNIASNVQVPAP* |
| Ga0126373_127353403 | 3300010048 | Tropical Forest Soil | TVYTDSKVTDGTAYCYAATAVNTSNEESGYSNIVSDLQIPPP* |
| Ga0074045_100849775 | 3300010341 | Bog Forest Soil | LNTSMVYDDSLVVDGASYCYATTAVNSSNEESAYSNIVSDIQVPAP* |
| Ga0126370_124895621 | 3300010358 | Tropical Forest Soil | MPIASTLYVDSEVKDGASYCYATTAIDTSDQESGYSNIVVDIQIPAS* |
| Ga0126378_106288722 | 3300010361 | Tropical Forest Soil | SNVTDGTAYCYAATAVNASNEESGYSNIVSNLPIPPP* |
| Ga0126378_114185382 | 3300010361 | Tropical Forest Soil | VYTDSVVVDGRSYCYATTAVNSSNEESSYPTIASDVQVPAP* |
| Ga0126379_101877791 | 3300010366 | Tropical Forest Soil | VVDGKSYCYATTAVDSSGQESSYSNIASNVQIPAP* |
| Ga0126379_117196932 | 3300010366 | Tropical Forest Soil | GTIYTDLSVVNGTSYCYTTTAVDSSNEESVYSNVVSNVQIP* |
| Ga0126381_1012346712 | 3300010376 | Tropical Forest Soil | LYTDFAVTDGTSYCYATTAVNSSSEESNYSNIVFDVQIPLP* |
| Ga0126381_1013575671 | 3300010376 | Tropical Forest Soil | MGTLYTDLSVTNGTSYCYASTAVNTSNEESVYSNVVSDIQV |
| Ga0126381_1023667492 | 3300010376 | Tropical Forest Soil | LNPSTVYTDSNVTDGTAYCYAATAVNASNEESGYSNIVTDLQIPPP* |
| Ga0126381_1039995091 | 3300010376 | Tropical Forest Soil | NVTDGTAYCYAATAVNASNEESGYSNIVSDLQIPPP* |
| Ga0136449_1014161443 | 3300010379 | Peatlands Soil | LYMDSAVVDGATYCYATTAVNTSNAESGYSNVVSNVQVPAP* |
| Ga0126383_100871474 | 3300010398 | Tropical Forest Soil | ANGNNYCYATTAVNTSNEESGYSNIVPNVQVPVL* |
| Ga0126383_106142601 | 3300010398 | Tropical Forest Soil | LLNTSPTFTDSNVVDGTDYCYAATAVNTSNQESGYSNIVSDVQIPAP* |
| Ga0137776_13528212 | 3300010937 | Sediment | DTLTTYTDSSVVDGTNYCYATTAVNSSNEESGYSNVVSDVQIPPP* |
| Ga0137381_113568922 | 3300012207 | Vadose Zone Soil | TVTTYSDFSVIDGTNYCYAITAVNSSNEESGYSNIVSDVRIPAP* |
| Ga0137390_107149282 | 3300012363 | Vadose Zone Soil | SSVVDGTNYCYATTAVNSSDEESAYSNIVSDVQIPAP* |
| Ga0164302_118900442 | 3300012961 | Soil | AVVDGTNYCYAATAVDSSNAESSYSNIVSNVQIPAP* |
| Ga0181531_105764682 | 3300014169 | Bog | SDGSVTDGTNYCYATTAVNSSNEESGYSNIVSNVQIPAP* |
| Ga0182024_103675382 | 3300014501 | Permafrost | ITLTTYSDSSVTDGTNYCYATTAVNSSSEESGYSNVVSDVQIPPP* |
| Ga0182024_118131211 | 3300014501 | Permafrost | VADGTNYCYATTAVNSSNEESGYSNIVTDVHIPAP* |
| Ga0132258_116799431 | 3300015371 | Arabidopsis Rhizosphere | VKNGSSYCFATTAVDTSNVESGYSNIVSNVQIPAQ* |
| Ga0187854_101948551 | 3300017938 | Peatland | GSTLDTVTTYSDSSVTDGANYCYATTAVNSSNEESGYSNVVSDVQIPSP |
| Ga0187817_104842562 | 3300017955 | Freshwater Sediment | VVDGKAYCYASTAVNTSNEESTYSNIVSNVQIPAP |
| Ga0187779_100199644 | 3300017959 | Tropical Peatland | YSDLVVTDGTSYCYATTAVNTSQEESGYSNIVSNVQIPAP |
| Ga0187781_100000271 | 3300017972 | Tropical Peatland | TDNSVTDGSSYCYAATAVNASEEESGYSNIVSNVQIPAP |
| Ga0187781_109533531 | 3300017972 | Tropical Peatland | ALNTSTVYADNTVVDGTSYCYATTAVNSSEEESGYSNIVSDVQVPAP |
| Ga0187782_101711641 | 3300017975 | Tropical Peatland | TAYTDSNVTDGTAYCYAATAVNTSNEESGYSNIVSDVQIPAP |
| Ga0187782_110999832 | 3300017975 | Tropical Peatland | GTAYTDSNVTDGTPYCYASTAVNTSNEESGYSNIVSDVQIPAP |
| Ga0187816_100285331 | 3300017995 | Freshwater Sediment | SKINSALNATTSYTDSTVATGASYCYAATAVNTSDEESGYSNIVSDFLIP |
| Ga0187816_104354382 | 3300017995 | Freshwater Sediment | GYTDSVVVDGTSYCYTTTAVNSSNQESAYSNIVSNVQIPAP |
| Ga0187816_105059241 | 3300017995 | Freshwater Sediment | VTDGTNYCYATTAVNSSNEESGYSNIVSDVQIPPP |
| Ga0187804_102541161 | 3300018006 | Freshwater Sediment | MDGTSCCYTTTAVNFSNKESGYANIVSNAQIPAPQS |
| Ga0187804_104601902 | 3300018006 | Freshwater Sediment | VYTDSNVTDGTAYCYAATAVNTSNEESGYSNIVSDVQIPPP |
| Ga0187871_106385191 | 3300018042 | Peatland | STVVDGASYCYAATAVNTSNEESGYSNIVSNIQIPPA |
| Ga0187859_101956881 | 3300018047 | Peatland | QYADSGVTGGTSYCYATTAVNASNQESGYSNIVSDLQIPSP |
| Ga0187858_103897251 | 3300018057 | Peatland | VTDGTSYCYATTAVNSSNEESGYSNVASNVQIPAP |
| Ga0187784_100770776 | 3300018062 | Tropical Peatland | PSLNAGTAYTDSNVTDGTAYCYAATAVNTSNEESGYSNIVSDVQIPAP |
| Ga0187772_100481771 | 3300018085 | Tropical Peatland | NVTDGTAYCYAATAVNTTNEESGFSNIVSDVQIPAP |
| Ga0187769_105947332 | 3300018086 | Tropical Peatland | NTGTLYTDSEVVDGTSYCYAATTVNSSNEESGYSNIVSNVQIPAS |
| Ga0187770_117267802 | 3300018090 | Tropical Peatland | STAYTDSAVAAGTSYCYATTAVNSSNEESAYSNIVINVAIPSS |
| Ga0066667_123500021 | 3300018433 | Grasslands Soil | TDSSVVNGTSYCYASTAVNSSNEESSYSNIVSNVQIPTF |
| Ga0210407_100481861 | 3300020579 | Soil | TLTTYADSSVADGTNYCYATTAVDSSKVESGYSNIVSDVQIPPP |
| Ga0210407_110046241 | 3300020579 | Soil | NTGTLYTDSAVIDGATYCYATTAVNTSKEESGYSNVVSKVQVPAP |
| Ga0210399_102662042 | 3300020581 | Soil | SSCGAYRKINGATLVSAMTYTDSAVTDGANYCYATTAVDSSNNEESGYSNVVSDVQIPPP |
| Ga0210405_101105471 | 3300021171 | Soil | TDSAVVDGAMYCYATTAINTSNEESGYSNVVSNVQVPAP |
| Ga0210393_113227331 | 3300021401 | Soil | LNTGTLFTDSVVADGSNYCYATTAVDSSNRESADSNIVLNVQIPMN |
| Ga0210397_116200322 | 3300021403 | Soil | TVVDGASYCYAATAVNTSNEESGYSNIVSNIQIPPA |
| Ga0210386_100267301 | 3300021406 | Soil | VVDGANYCYATTAVNTSNEESGYSNIASNVQVPAP |
| Ga0210386_102379001 | 3300021406 | Soil | QLNTGLLYTDSNVVDGTSYCYAATAVNTSQEESSYSNIASNVQIPAP |
| Ga0210390_115938852 | 3300021474 | Soil | PLLNTGTLFTDSAVVDGATYCYATTAVNTSNEESGYSNVVSNVQVPAP |
| Ga0210392_110280921 | 3300021475 | Soil | LNTGTLYTDPAVVDGATYCYATTAVNTSNEESAYSNVVSNVQVPAP |
| Ga0210398_107258131 | 3300021477 | Soil | WSDSSVTDGTNYCYATTAVNSSSEESGYSNIVSDVQIPPP |
| Ga0210410_112696371 | 3300021479 | Soil | SLLNTGTLYTDSAVVDGATYCYATTAVNTSNEESGYSNVVSNVQVPAP |
| Ga0209171_101480711 | 3300025320 | Iron-Sulfur Acid Spring | DSAVVDGATYCYATTAVNTSNEESGYSNVVSNVQVPAP |
| Ga0208457_10809761 | 3300025812 | Peatland | DPSVTDGTNYCYATTAVNSTNEESGYSNIVSDVQIPAP |
| Ga0207692_102377402 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AELVPGTLYTDTGTSDGMSYCYATTAVNTSAEESGYSNIVSDIRIPPP |
| Ga0207693_100509751 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLDVNTVYTDSNIADGSSYCYATTAVDSSNQESSPSNIVSNVQVPAQ |
| Ga0207664_101426781 | 3300025929 | Agricultural Soil | TDSSVANGKSYCYASTAVNTSNEESGYSNIVSNVQIPIS |
| Ga0207664_106897341 | 3300025929 | Agricultural Soil | PTATYTDSEVTNGASYCYAATAVNVSKEESGYSNIVSNVQIPPN |
| Ga0207665_114378631 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAVTDGSSYCYAATAVNTSNAESGYSNIVSNIQIPAP |
| Ga0209470_12670951 | 3300026324 | Soil | SVLTTTTLYTDSNVVDGKSYCYAATAVNSSSQESGYSNVASNVQIPAP |
| Ga0209806_12853901 | 3300026529 | Soil | TTYSDFSVIDGTNYCYATTAVNSSNEESGYSNIVSDVRIPAP |
| Ga0209773_102202901 | 3300027829 | Bog Forest Soil | YTLNASTLYTDSEVTDGASYCYAATTVNTRNEESGYSNIAIDVQIPPP |
| Ga0209580_101522941 | 3300027842 | Surface Soil | AYTDSLVTDGTNYCYATTAVDSSNVESGYSNIVINVQIPPP |
| Ga0209517_100063911 | 3300027854 | Peatlands Soil | SVVVDGTSYCYATTAVNSSSQESGYSNIVSNVQIPPP |
| Ga0209166_105429271 | 3300027857 | Surface Soil | LYTDAAVTDGTSYCYAATAVNTSNAESGYSNIVSNIQIPAP |
| Ga0209169_102576302 | 3300027879 | Soil | DSGVTDGTSYCYATTAVDSNNLESAYSNIVSNLQIPAP |
| Ga0209624_103492241 | 3300027895 | Forest Soil | AVVDRATYCYATTAVNTTNEESGYSNVVSNVQVPAP |
| Ga0209415_100638391 | 3300027905 | Peatlands Soil | SVVVDGAKYCYDTTAVNTSSEESGYSNVVSNVQVPAP |
| Ga0209006_100519544 | 3300027908 | Forest Soil | MNGSALITLTTYSDSSVTDGTNYCYATTAVNSSSEESGYSNIVSDVQIPPP |
| Ga0209006_100653303 | 3300027908 | Forest Soil | DTATTYSDSSVIDGTNYCYATTAVNSSNEESGFSNVVSDVQIPAP |
| Ga0209698_100061388 | 3300027911 | Watersheds | VVLDGTSYCYITNAVNSSNEESGCSNIAYNVQIPAP |
| Ga0209698_103023262 | 3300027911 | Watersheds | DSGVVDGTAYCYASTAVNTSNEESGYSNIVSNIQIPPP |
| Ga0265357_10397942 | 3300028023 | Rhizosphere | TYTDSSVADGTNYCYATTAVDSSKAESGYSNIVSDVQIPPP |
| Ga0302225_104125431 | 3300028780 | Palsa | GAILEVATEYNDLSVTYGTNYCYATTAVNSSNEESGYSNIVSDVQIPPP |
| Ga0265338_101148442 | 3300028800 | Rhizosphere | VVDGASYCYASTAVNTSNEESGYSNIVSNVQIPTS |
| Ga0310039_100928412 | 3300030706 | Peatlands Soil | TDSGVINSTSYCYATTAVDSTNEESGYSNIVSNIQIPVS |
| Ga0265746_10333752 | 3300030815 | Soil | TAYVDSSVADHMNYCYATTAVNSSNEESGYSNIVANVQIP |
| Ga0307474_101330501 | 3300031718 | Hardwood Forest Soil | DSVVIDGTSYCYATTAVNTDNGESGYSNIVSNVQIPAP |
| Ga0307478_100485254 | 3300031823 | Hardwood Forest Soil | VVDGATYCYATTAVNTSNEESAYSNVVSNVQVPAP |
| Ga0307470_109342911 | 3300032174 | Hardwood Forest Soil | LLDTSTLYTDSSVTNSSVYCYATTAVDTSNVESGYSNVVSNVQIPTQ |
| Ga0307471_1022332111 | 3300032180 | Hardwood Forest Soil | ALDRVTTYSDFSVIDGTNYCYATTAVNSSNEESGYSNIVSDVRIPAP |
| Ga0335085_109819911 | 3300032770 | Soil | LVVNGTSYCYATTAVDSSNQESGYSNIVSNVQIPIQ |
| Ga0335079_110647101 | 3300032783 | Soil | VVTDGDAYCYAATAVNSSNEESGYSNIVSDVQIPPP |
| Ga0335078_103270121 | 3300032805 | Soil | LYTDSNVVDGSSYCYATTAVNTSNEESGYSNIVSNVQIPAP |
| Ga0335081_116683581 | 3300032892 | Soil | DSTVANGSSYCYYATAVNTSSQESGASNIATNVQIP |
| Ga0335072_103557041 | 3300032898 | Soil | DYTDSVVTDGTSYCYYATAVNSSNQESAPSNTVPNVQIPAP |
| Ga0335072_107084411 | 3300032898 | Soil | DSTVANSTNYCYAATAVNTSNEESGYSNIVSNVQIP |
| Ga0335083_102028181 | 3300032954 | Soil | IVVDGTSYCYAATAVNSSNEESSYSNIVSNLQIPPP |
| Ga0334790_055308_1_144 | 3300033887 | Soil | MLDTLTTYTDSAVTDGTNYCYATTAVNSSNEESGYSNIVTDVQIPPP |
| Ga0314861_0103283_1313_1450 | 3300033977 | Peatland | NTSTLYTDSSVTDGTSYCYAATTVNSSQEESGYSNIVSDVQIPPP |
| Ga0314861_0285067_630_749 | 3300033977 | Peatland | TDSAVTDGDAYCYAATAVNSSDEESGYSNIVSDVQIPAP |
| ⦗Top⦘ |