


| Basic Information | |
|---|---|
| Family ID | F062062 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 29.81 % |
| % of genes near scaffold ends (potentially truncated) | 67.94 % |
| % of genes from short scaffolds (< 2000 bps) | 64.89 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.702 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.794 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.618 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.40% β-sheet: 0.00% Coil/Unstructured: 72.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF13655 | RVT_N | 32.82 |
| PF12796 | Ank_2 | 2.29 |
| PF07676 | PD40 | 1.53 |
| PF00069 | Pkinase | 1.53 |
| PF13432 | TPR_16 | 0.76 |
| PF00583 | Acetyltransf_1 | 0.76 |
| PF00107 | ADH_zinc_N | 0.76 |
| PF00732 | GMC_oxred_N | 0.76 |
| PF13620 | CarboxypepD_reg | 0.76 |
| PF08818 | DUF1801 | 0.76 |
| PF08308 | PEGA | 0.76 |
| PF02517 | Rce1-like | 0.76 |
| PF00691 | OmpA | 0.76 |
| PF12704 | MacB_PCD | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF01244 | Peptidase_M19 | 0.76 |
| PF01425 | Amidase | 0.76 |
| PF01935 | DUF87 | 0.76 |
| PF00561 | Abhydrolase_1 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.11 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.76 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.76 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.76 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.47 % |
| Unclassified | root | N/A | 30.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B02IILTL | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300000691|JGI12369J11874_100025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2337 | Open in IMG/M |
| 3300000955|JGI1027J12803_108385948 | Not Available | 1876 | Open in IMG/M |
| 3300001593|JGI12635J15846_10444920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300001661|JGI12053J15887_10049998 | Not Available | 2338 | Open in IMG/M |
| 3300002909|JGI25388J43891_1000738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6565 | Open in IMG/M |
| 3300004476|Ga0068966_1487863 | Not Available | 537 | Open in IMG/M |
| 3300005435|Ga0070714_100083047 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300005437|Ga0070710_10059652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2168 | Open in IMG/M |
| 3300005454|Ga0066687_10689111 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005542|Ga0070732_10365686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300005553|Ga0066695_10018751 | All Organisms → cellular organisms → Bacteria | 3822 | Open in IMG/M |
| 3300005554|Ga0066661_10017006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3788 | Open in IMG/M |
| 3300005554|Ga0066661_10309341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300005574|Ga0066694_10142968 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300005591|Ga0070761_10144815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1389 | Open in IMG/M |
| 3300005602|Ga0070762_10386777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300006102|Ga0075015_100021551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2858 | Open in IMG/M |
| 3300006796|Ga0066665_10802316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300006893|Ga0073928_11216303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300007255|Ga0099791_10025523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2566 | Open in IMG/M |
| 3300009038|Ga0099829_10949022 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009641|Ga0116120_1226922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300009644|Ga0116121_1010585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3038 | Open in IMG/M |
| 3300009792|Ga0126374_10361518 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300010048|Ga0126373_11393092 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010362|Ga0126377_13099398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010366|Ga0126379_12364897 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010376|Ga0126381_104937747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010398|Ga0126383_11692664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300010398|Ga0126383_12673073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300011003|Ga0138514_100138184 | Not Available | 540 | Open in IMG/M |
| 3300011078|Ga0138565_1065108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300011270|Ga0137391_10076987 | Not Available | 2871 | Open in IMG/M |
| 3300012189|Ga0137388_10073550 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300012199|Ga0137383_10310155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300012202|Ga0137363_10887980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300012205|Ga0137362_11418366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012208|Ga0137376_10486113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300012211|Ga0137377_10087914 | Not Available | 2933 | Open in IMG/M |
| 3300012582|Ga0137358_10212358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300012917|Ga0137395_10439473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300012917|Ga0137395_10652115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300012971|Ga0126369_13291059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300013770|Ga0120123_1016899 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300014052|Ga0120109_1041572 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300015054|Ga0137420_1043949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300015193|Ga0167668_1044898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300015241|Ga0137418_10142820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2115 | Open in IMG/M |
| 3300015264|Ga0137403_11272227 | Not Available | 582 | Open in IMG/M |
| 3300016422|Ga0182039_10924634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300018023|Ga0187889_10098217 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300018468|Ga0066662_12911675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300019789|Ga0137408_1197106 | Not Available | 3256 | Open in IMG/M |
| 3300020170|Ga0179594_10218883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300020579|Ga0210407_10043041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3360 | Open in IMG/M |
| 3300020581|Ga0210399_10474889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300020583|Ga0210401_10965074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300021168|Ga0210406_10579625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300021407|Ga0210383_10942451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300021476|Ga0187846_10466557 | Not Available | 517 | Open in IMG/M |
| 3300022873|Ga0224550_1071009 | Not Available | 502 | Open in IMG/M |
| 3300025916|Ga0207663_10052765 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300026316|Ga0209155_1159362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300026325|Ga0209152_10086820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300026497|Ga0257164_1040267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300026514|Ga0257168_1154776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026528|Ga0209378_1117316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300026953|Ga0207835_1035465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300027047|Ga0208730_1036630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300027172|Ga0208098_1004210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300027703|Ga0207862_1008009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3087 | Open in IMG/M |
| 3300028047|Ga0209526_10871075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300028536|Ga0137415_10639439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300028673|Ga0257175_1029838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300028906|Ga0308309_11899100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300030494|Ga0310037_10168705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300030969|Ga0075394_10032954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031057|Ga0170834_108268659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300031057|Ga0170834_108562494 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300031231|Ga0170824_108186405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300031231|Ga0170824_120724136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300031564|Ga0318573_10703871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031680|Ga0318574_10278992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 969 | Open in IMG/M |
| 3300031682|Ga0318560_10667478 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031765|Ga0318554_10333153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300031768|Ga0318509_10192850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300031770|Ga0318521_10444161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300031798|Ga0318523_10267699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300031805|Ga0318497_10751804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300031833|Ga0310917_10599746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300031945|Ga0310913_10586525 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031946|Ga0310910_10444937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300031954|Ga0306926_10486732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300031962|Ga0307479_10144618 | Not Available | 2330 | Open in IMG/M |
| 3300032001|Ga0306922_10822896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300032054|Ga0318570_10142996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
| 3300032059|Ga0318533_10795701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300032076|Ga0306924_12037246 | Not Available | 590 | Open in IMG/M |
| 3300032120|Ga0316053_112136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300032160|Ga0311301_11248828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300032205|Ga0307472_101202053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300032261|Ga0306920_100696046 | Not Available | 1498 | Open in IMG/M |
| 3300032261|Ga0306920_100965962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.05% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.53% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.53% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.76% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000691 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_02539800 | 2170459023 | Grass Soil | MLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV |
| JGI12369J11874_1000251 | 3300000691 | Tropical Forest Soil | MLADTSSPRGSDATLASVGTLSEGFERFVASPPHLVGYV |
| JGI1027J12803_1083859487 | 3300000955 | Soil | WPHGFGATLASVGTLSEGFEWSVASPLLPRRLRAMG |
| JGI12635J15846_104449201 | 3300001593 | Forest Soil | MLADIPWPHGFGATLANVGPLSEGFERSVASPLQPR |
| JGI12053J15887_100499981 | 3300001661 | Forest Soil | MLADTPWPHGFGAALASVGTLSEGVERSVASPLQPRRLRA |
| JGIcombinedJ26739_1006256341 | 3300002245 | Forest Soil | PRGSDATLAGMGTLSEGFERFVAAPLLPRRLHVMVRMV* |
| JGI25388J43891_10007388 | 3300002909 | Grasslands Soil | MLADTPSPRGSGAKFALVGTSSEGFERFVASPLCLVGYV* |
| Ga0068966_14878631 | 3300004476 | Peatlands Soil | MLADTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRA |
| Ga0066679_101186484 | 3300005176 | Soil | MRRFGSKVTASLGPLHLVLADAPSPRGSDATLAGMGTLSEGFERFVAAPLQPRRLHAMARTV* |
| Ga0066690_101672402 | 3300005177 | Soil | SQAMRRFGSKVTASLGPLHLVLADAPSPRGSDATLAGMGTLSEGFERFVAAPLQPRRRHAMARTV* |
| Ga0070714_1000830474 | 3300005435 | Agricultural Soil | MLADTPLPRGSGANLAVVGTLSEGFRRIVAAPPLPRRLRAMGRTV* |
| Ga0070710_100596524 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLSLGLLRLMLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRPMGRAV* |
| Ga0066687_106891111 | 3300005454 | Soil | HLMLADTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRAMGRTV* |
| Ga0070706_1021023892 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVDTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLPAMARRV* |
| Ga0070732_103656862 | 3300005542 | Surface Soil | MLADTPSPHGSGADLAAVGTLSEGFERSVASPLQPRR |
| Ga0066695_100187512 | 3300005553 | Soil | MLVDAPLPHGSGANLAVVGTLFEGFGRLVTSPPLPRRLRAMGRAV* |
| Ga0066661_100170067 | 3300005554 | Soil | MLADTPLPRGSGANLAVVGTLSEGFRRIVTAPPLPRRLRAMGRTV* |
| Ga0066661_103093412 | 3300005554 | Soil | MLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV* |
| Ga0066694_101429682 | 3300005574 | Soil | MLADTPSPYGSGATLASVGTLSEGFERSVASPLQPRRLRAMGRTV* |
| Ga0070761_101448152 | 3300005591 | Soil | MPLSLGLLRLMLADTPLPRGSGATLAGVGTLSEGFERSVASPLLPRRLRAMGRTV* |
| Ga0070762_103867773 | 3300005602 | Soil | MPLSLGLLRLMLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV* |
| Ga0070717_104712033 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLRVMVHMV* |
| Ga0075026_1001322832 | 3300006057 | Watersheds | PLHIVLVDTPSPHGSDATLAGMGTLSEGFERFVAAPLQPRRLRVMVHTV* |
| Ga0075017_1013867072 | 3300006059 | Watersheds | GSDATLAGMGTLSEGFERFVAAPLLPRRLRPMVRTV* |
| Ga0075015_1000215515 | 3300006102 | Watersheds | PSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLRVMVHTV* |
| Ga0075014_1008079512 | 3300006174 | Watersheds | RGSDVTLTGMGTLSEGFERFVAAPLLPRRLRPMVRTV* |
| Ga0066665_108023161 | 3300006796 | Soil | MPLSLGLLRLMLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV |
| Ga0073928_112163031 | 3300006893 | Iron-Sulfur Acid Spring | MLADTPSPRGSDATLASVGTLSEGFERSVASPLQPRRLRAM |
| Ga0099791_100255232 | 3300007255 | Vadose Zone Soil | MLADTPWPHGFGATLASVGTLSEGFERFVAWPLQPR |
| Ga0066710_1005691282 | 3300009012 | Grasslands Soil | SDATLASVGTLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0099829_109490221 | 3300009038 | Vadose Zone Soil | MLADTPFPRGCDATLASVGTLSEGFERSVASPLQPRRLRVMGRTV |
| Ga0116124_11520063 | 3300009634 | Peatland | SDATLAGMGTLSEGFERFVAAPLLPRRLPAMARRV* |
| Ga0116120_12269221 | 3300009641 | Peatland | MLADTPSPRGSGATLASVGTLSEGFERSVASPLLPRRLRAMGCAVWSIL |
| Ga0116121_10105855 | 3300009644 | Peatland | LVDAPSPRGSDATLAGMGTLSEGVERFVAAPLLPRRLRAMARTV* |
| Ga0116130_11703061 | 3300009762 | Peatland | RGSDATLAGMGTLSEGFERFVAAPLLPRRLRPMVRTV* |
| Ga0126374_103615182 | 3300009792 | Tropical Forest Soil | PHGSDATLANVGPLSEGFERSVASPLQPRRLRAMGRTV* |
| Ga0116223_105141261 | 3300009839 | Peatlands Soil | FGVILANVGTLSEGFERSVASPLQPRRLRAKGRTV* |
| Ga0126373_113930921 | 3300010048 | Tropical Forest Soil | MLADTPLPRGSGATLASVGTLSEGFERFVASPLQPR |
| Ga0126377_130993981 | 3300010362 | Tropical Forest Soil | MLADTPLPHGCDATLPSVGTLSKGFERSVASPLQP |
| Ga0126379_123648972 | 3300010366 | Tropical Forest Soil | PHGLGATLASVGPLSEGFERSVASPLQPRRLRAMGRTV* |
| Ga0126381_1013116042 | 3300010376 | Tropical Forest Soil | SPRGSDATLASMGTLSEGFERFVAFPLLPRRLRVMVGTV* |
| Ga0126381_1049377471 | 3300010376 | Tropical Forest Soil | MLADTLLPRGSGANLAVVGTLSEGFRRIVAAPPLPRRLRA |
| Ga0126383_116926641 | 3300010398 | Tropical Forest Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASPLLPRG |
| Ga0126383_126730731 | 3300010398 | Tropical Forest Soil | MLADTSFPRGCDATLARVGTLSEGFERSVASPLQP |
| Ga0138514_1001381841 | 3300011003 | Soil | MLADTPLPRGFGATLASVGTLSEGFERSVASPLQPRRLR |
| Ga0138565_10651082 | 3300011078 | Peatlands Soil | PSPRGSDATLAGMGTLSEGFERFVAAPLQPRRLRVMVHTV* |
| Ga0137391_100769872 | 3300011270 | Vadose Zone Soil | MLVDAPLPHGSGANLAVVGTLFEGFGRLVASPPLPRRLRAMGRAV* |
| Ga0137388_100735503 | 3300012189 | Vadose Zone Soil | MLADTPSPHGSGATLARVGTLSEGFERSVASPLQPRRLRAM |
| Ga0137383_103101551 | 3300012199 | Vadose Zone Soil | MLADAPSPHGSGATLASVGTLSEGFERSVASPLLPRRLRAMGCAV |
| Ga0137363_108879801 | 3300012202 | Vadose Zone Soil | LADTPWPHGFGATLASVGTLSEGFERFVAWPLQPRRLRAMGCTV* |
| Ga0137362_114183661 | 3300012205 | Vadose Zone Soil | MLADTPSPRGSGATLASVSTLSEGFERSVASPLQPRR |
| Ga0137376_104861132 | 3300012208 | Vadose Zone Soil | MLVDAPLPHGSGANLAVVGTLFEGFGRLVTSPPLPRRLRA |
| Ga0137377_100879143 | 3300012211 | Vadose Zone Soil | MLADTPLPRGSGANLAVVGTLSEGFRRIVTAPPLPRRLR |
| Ga0137360_117730292 | 3300012361 | Vadose Zone Soil | RFVLADTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLRVMVHMV* |
| Ga0137358_102123583 | 3300012582 | Vadose Zone Soil | WPHGFGATLANVGPLSEGFERSVASPLQPRRLRAMGRTV* |
| Ga0137395_100398473 | 3300012917 | Vadose Zone Soil | RFVLADTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLHVMVHMV* |
| Ga0137395_104394731 | 3300012917 | Vadose Zone Soil | MLADTPWPHGSDATLANVGPLSEGFERSVASPLQPRRLRAMGRT |
| Ga0137395_106521152 | 3300012917 | Vadose Zone Soil | MLADTPSPRGSGATLASVSTLSEGFERSVASPLQPRRLR |
| Ga0126369_132910591 | 3300012971 | Tropical Forest Soil | MLADTPSPRGSGVTLASVGTLSEGFERSVASPLQPRR |
| Ga0120123_10168991 | 3300013770 | Permafrost | MLADTPFPRGYDATLTGMGTLSEGFERSVASPLYLVGYAQW |
| Ga0120109_10415721 | 3300014052 | Permafrost | MLVDAPLPRGSGANLAVVGSLFEGFERSVASPLQPRRLRAM |
| Ga0181521_102033351 | 3300014158 | Bog | RGSDATLAGMGTLSEGFERFVAAPLLPRRLPAMARRV* |
| Ga0182018_103570182 | 3300014489 | Palsa | SLGPLHIVLVDAPSPRGSDATLAGMGTLSEGFERFVAAPLLPRGLRAMARTV* |
| Ga0182018_106457051 | 3300014489 | Palsa | SLGPLHIVLVDAPSPRGSDATLAGMGTLSEGFERFVAAPLQPRMLRAMVRTV* |
| Ga0137420_10439491 | 3300015054 | Vadose Zone Soil | MLADTPSPHGSGATLARVGTLSEGFERSVASPLQPRRLRAMGR |
| Ga0167668_10448983 | 3300015193 | Glacier Forefield Soil | SPRGSDATLAGMGTLSEGFERFVAAPLLPRRLHAMVRMV* |
| Ga0167668_10621502 | 3300015193 | Glacier Forefield Soil | PRGSDATLAGMGTLSEGFERFVAAPLLPRRLRAMARTV* |
| Ga0167668_11078641 | 3300015193 | Glacier Forefield Soil | PRGSDATLAGMGTLSEGFERFVAAPLLPRRLRVMVHMV* |
| Ga0137418_101428201 | 3300015241 | Vadose Zone Soil | LHLMLADTPWPHGFGATLASVGTLSEGFERFVAWPLQPRRLRAMGYMV* |
| Ga0137403_112722272 | 3300015264 | Vadose Zone Soil | MLADTPLPRGSGANLAVVGTLSEGFRRIVTAPPLPRRLRAMGR |
| Ga0134089_104999411 | 3300015358 | Grasslands Soil | GPLHFVLVDTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLRVMVHTV* |
| Ga0182039_109246341 | 3300016422 | Soil | DTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0187874_100663943 | 3300018019 | Peatland | GPLHIVLVDTPSPRGSDATLAGMGTLSKGFERFVAAPLLPRRLPAMARRV |
| Ga0187889_100982174 | 3300018023 | Peatland | LGPLHIVLVDTPSPRGSDATLAGMGTLSEGVERFVAAPLLPRRLRAMARTV |
| Ga0187889_102109382 | 3300018023 | Peatland | LGPLHIVLVDTPSPRGSDATLAGMGTLSKGFERFVAAPLLPRRLPAMARRV |
| Ga0187869_106361991 | 3300018030 | Peatland | HIVLVDTPSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLHVMARMV |
| Ga0187859_108084323 | 3300018047 | Peatland | GSDATLAGMGTLSEGFERFVAAPLLPRRLRAMARTV |
| Ga0066662_129116751 | 3300018468 | Grasslands Soil | LGLLRLMLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRRLRAMGRTV |
| Ga0137408_11971063 | 3300019789 | Vadose Zone Soil | MLVDAPLPHGSGANLSVVGTLFEGFGRLVTSPPLPRRLRAMGRAV |
| Ga0193751_11882761 | 3300019888 | Soil | LADTSSPRGSDATLAGMGTLSEGFERFVAAPLLPRRLHAMVRTV |
| Ga0179594_102188831 | 3300020170 | Vadose Zone Soil | MLVDAPLPHGSGANLAVVGTLFEGFGRLVTSPPLPRRLRAMGR |
| Ga0210407_100430413 | 3300020579 | Soil | HGFGATLASVGPLSEGFERSVASPLQPRRLRAMARTV |
| Ga0210399_104748891 | 3300020581 | Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASPLQPRRLRAMGR |
| Ga0210401_109650741 | 3300020583 | Soil | MLADTPLPHGSGANLAIVGTLSEGFRRIVTAPPLPV |
| Ga0210406_105796251 | 3300021168 | Soil | MLADTPSPRGSGATLASVGTLSEGFERSVASPLQP |
| Ga0210383_109424512 | 3300021407 | Soil | MLVDTPLPHGSGANFSVVGTLFEGFGRLVTSPPLPRRLRAMG |
| Ga0187846_104665571 | 3300021476 | Biofilm | LADTPLPRGFGVNLAVVGTLSEGFRRIVAAPPLPRRLHAMGRTV |
| Ga0224550_10710092 | 3300022873 | Soil | PLRIVLADTSSPRGFDVTLAGTGTLSEGFERFVAAPLLPRRLRTMVRTV |
| Ga0207663_100527651 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLADTPLPRGSGANLAVVGTLSEGFRRIVAAPPLPRRLRAMGRTV |
| Ga0209155_11593621 | 3300026316 | Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASPLYL |
| Ga0209152_100868202 | 3300026325 | Soil | MLADTPSPRGSGANFAIVGTLSEGFERSVASPLLPRRLRAMR |
| Ga0257164_10402671 | 3300026497 | Soil | MLADTPWPHGFGAALASVGTLSEGFERSVASPLQPR |
| Ga0257168_11547761 | 3300026514 | Soil | MLADTPLPRGSGATLAGVGTLSEGFERFVASPLQPRR |
| Ga0209378_11173161 | 3300026528 | Soil | PLHLMLADTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0207835_10354651 | 3300026953 | Tropical Forest Soil | MLADTPSPRGSGATLAGVGTLSEGFERSVTSPLQPRRLRPMGRTV |
| Ga0208730_10366301 | 3300027047 | Forest Soil | MLADTPSPRGSGATLASVGTLFEGFERSVASPLQPRRLRAMGC |
| Ga0208098_10042101 | 3300027172 | Forest Soil | MLADTPSPRGSGATLASVGTLFEGFERSVASPLQPRRLR |
| Ga0207862_10080094 | 3300027703 | Tropical Forest Soil | MLADTPSPRGSGATLAGVGTLSEGFERSVTSPLQPRRLRPM |
| Ga0209380_105392172 | 3300027889 | Soil | LVDAPSPRGSDATLAGMGTLSEGFERFVAAPLQPRRLRVMVRTV |
| Ga0209526_108710751 | 3300028047 | Forest Soil | MLADTPSPRGSGANFAIVDTLSEGFERSVASPLQPRRLR |
| Ga0137415_106394391 | 3300028536 | Vadose Zone Soil | MLADTPSPHGFGATLASVGTLSEGFERSVASPLLPR |
| Ga0257175_10298382 | 3300028673 | Soil | MLADTPSPRGSGATLASVGTLSEGFERFVASPLQPRRLRAMGCT |
| Ga0308309_118991001 | 3300028906 | Soil | MPLSLGLLRLMLADTPLPRGSGATLAGVGTLSEGFERSVASPLLPRRLRAMGRTV |
| Ga0310037_101687052 | 3300030494 | Peatlands Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASPLLPRRLRAMGCAV |
| Ga0075394_100329541 | 3300030969 | Soil | MLADTPSPRGSGAKFALVGTLSEGFERSVASPLLPRRL |
| Ga0170834_1082686592 | 3300031057 | Forest Soil | FGATLANVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0170834_1085624941 | 3300031057 | Forest Soil | MLADTPSPRGSGAKFALVGTLSEGFERSVASPLLPRRLRAM |
| Ga0170824_1081864051 | 3300031231 | Forest Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASPLLPRRL |
| Ga0170824_1207241362 | 3300031231 | Forest Soil | MLADTPSPRGSGATLASVGTLSEGFERSVASPLQPR |
| Ga0318573_107038711 | 3300031564 | Soil | PRGSGATLAGVGTLSEGFERSVTSPLQPRRLRPMGRTV |
| Ga0318574_102789922 | 3300031680 | Soil | MLADTPSPRGSGATLAGVGTLSEGFERSVTSPLQPRRLRPMG |
| Ga0318560_106674781 | 3300031682 | Soil | MLADTSWPHGFGATLANVGPLSEGFERSVASPLQPRRLRAM |
| Ga0318554_103331532 | 3300031765 | Soil | HLMLADTPWPHGFGAILANVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0318509_101928502 | 3300031768 | Soil | ADTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0318521_104441611 | 3300031770 | Soil | LMLADAPWPRGFGAILANVGPLSEGFERSVASPLQPRRLRAMGRTV |
| Ga0318523_102676992 | 3300031798 | Soil | MLADAPSPRGSGATLASVGTLSEGFERSVASPLLPRRLRPMGW |
| Ga0318497_107518041 | 3300031805 | Soil | MLADTPWPHGFGATLTNVGPLSEGFERSVASPLQPRRLRAMGRTDRF |
| Ga0310917_105997461 | 3300031833 | Soil | MLADTPFPRGSGATLANVGTLSGSTERFVASPLYPVGYV |
| Ga0310913_105865252 | 3300031945 | Soil | MLADTPSPRGSGAKFALVGTLSEGFERSVASPLLPRRLRAMR |
| Ga0310910_104449372 | 3300031946 | Soil | MLADTPFPRGSGATLANVGTLSGSTERFVASPLYPV |
| Ga0306926_104867323 | 3300031954 | Soil | MLADTPWPHGFGATLANVGPLSEGFERSVASPLQPRRLRAMGRR |
| Ga0307479_101446182 | 3300031962 | Hardwood Forest Soil | MLADASSPRGSDATLASVGTLSEGFERFVASPLLPRRL |
| Ga0306922_108228962 | 3300032001 | Soil | MLADTPSPRGSGATLAGVGTLSEGFERSVTSPLQPRRL |
| Ga0318570_101429962 | 3300032054 | Soil | MLADTPSPRGSDATLASVGTLSEGFERSVASPLLPRRLRPMGQ |
| Ga0318533_107957011 | 3300032059 | Soil | MLADTPSPHGSGATLASVGTLSEGFERSVASRSNL |
| Ga0306924_120372461 | 3300032076 | Soil | MLADASSPRGSGANLAIVGTLSEGFRRIVASPPYLPSGQAP |
| Ga0316053_1121361 | 3300032120 | Soil | MPLSLGLLRLMLADTPLPRGSGATFAGVGTLSEGFERFVASPLQPRRLRAMGRTV |
| Ga0311301_112488281 | 3300032160 | Peatlands Soil | MLADTPLPRGSSANLAVVGTLSEGFRRIVASPPLPRR |
| Ga0307472_1012020531 | 3300032205 | Hardwood Forest Soil | MLVDAPWPHGSGANLAVVGTLFEGFGRLVTSPPLPRRLRAMGRA |
| Ga0306920_1006960462 | 3300032261 | Soil | MLADAPSPRGSDATLANVGTLSGSTERFVASPLYPV |
| Ga0306920_1009659621 | 3300032261 | Soil | RLRLMLADTPSPRGSGATLAGVGTLSEGFERSVTSPLQPRRLRPMGRTV |
| ⦗Top⦘ |