


| Basic Information | |
|---|---|
| Family ID | F061985 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.79 % |
| % of genes near scaffold ends (potentially truncated) | 79.39 % |
| % of genes from short scaffolds (< 2000 bps) | 91.60 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.672 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.771 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.328 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 0.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF13189 | Cytidylate_kin2 | 3.82 |
| PF01042 | Ribonuc_L-PSP | 2.29 |
| PF07883 | Cupin_2 | 2.29 |
| PF12697 | Abhydrolase_6 | 2.29 |
| PF12680 | SnoaL_2 | 1.53 |
| PF00903 | Glyoxalase | 1.53 |
| PF08327 | AHSA1 | 1.53 |
| PF07690 | MFS_1 | 1.53 |
| PF03733 | YccF | 1.53 |
| PF00106 | adh_short | 0.76 |
| PF13191 | AAA_16 | 0.76 |
| PF03795 | YCII | 0.76 |
| PF04075 | F420H2_quin_red | 0.76 |
| PF02163 | Peptidase_M50 | 0.76 |
| PF00027 | cNMP_binding | 0.76 |
| PF13302 | Acetyltransf_3 | 0.76 |
| PF13385 | Laminin_G_3 | 0.76 |
| PF00211 | Guanylate_cyc | 0.76 |
| PF01936 | NYN | 0.76 |
| PF02129 | Peptidase_S15 | 0.76 |
| PF10571 | UPF0547 | 0.76 |
| PF13377 | Peripla_BP_3 | 0.76 |
| PF03069 | FmdA_AmdA | 0.76 |
| PF00144 | Beta-lactamase | 0.76 |
| PF00248 | Aldo_ket_red | 0.76 |
| PF08279 | HTH_11 | 0.76 |
| PF03631 | Virul_fac_BrkB | 0.76 |
| PF13427 | DUF4111 | 0.76 |
| PF04828 | GFA | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF13450 | NAD_binding_8 | 0.76 |
| PF13683 | rve_3 | 0.76 |
| PF01252 | Peptidase_A8 | 0.76 |
| PF06253 | MTTB | 0.76 |
| PF12840 | HTH_20 | 0.76 |
| PF00857 | Isochorismatase | 0.76 |
| PF04545 | Sigma70_r4 | 0.76 |
| PF13577 | SnoaL_4 | 0.76 |
| PF07366 | SnoaL | 0.76 |
| PF03061 | 4HBT | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.29 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.53 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 1.53 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.76 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.76 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.76 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.76 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.76 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.76 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.67 % |
| Unclassified | root | N/A | 47.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01BNINY | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 2189573004|GZGWRS401C0S6C | Not Available | 528 | Open in IMG/M |
| 2199352024|deeps_contig97391.57375 | Not Available | 549 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100273235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300000550|F24TB_10066164 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300000891|JGI10214J12806_10387618 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300000953|JGI11615J12901_10265674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300000955|JGI1027J12803_106869813 | Not Available | 614 | Open in IMG/M |
| 3300000956|JGI10216J12902_101620730 | Not Available | 1074 | Open in IMG/M |
| 3300004480|Ga0062592_101570577 | Not Available | 634 | Open in IMG/M |
| 3300005172|Ga0066683_10313303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300005327|Ga0070658_11114961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300005329|Ga0070683_101517123 | Not Available | 644 | Open in IMG/M |
| 3300005332|Ga0066388_106419075 | Not Available | 593 | Open in IMG/M |
| 3300005337|Ga0070682_100013906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4641 | Open in IMG/M |
| 3300005355|Ga0070671_100974837 | Not Available | 742 | Open in IMG/M |
| 3300005435|Ga0070714_100251555 | Not Available | 1634 | Open in IMG/M |
| 3300005455|Ga0070663_100533905 | Not Available | 978 | Open in IMG/M |
| 3300005457|Ga0070662_100771751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 816 | Open in IMG/M |
| 3300005467|Ga0070706_100742332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300005471|Ga0070698_100224524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1811 | Open in IMG/M |
| 3300005546|Ga0070696_101348160 | Not Available | 607 | Open in IMG/M |
| 3300005553|Ga0066695_10363510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300005561|Ga0066699_10274529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1195 | Open in IMG/M |
| 3300005561|Ga0066699_10722105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300005564|Ga0070664_100227685 | Not Available | 1670 | Open in IMG/M |
| 3300005764|Ga0066903_100018400 | All Organisms → cellular organisms → Bacteria | 7287 | Open in IMG/M |
| 3300005764|Ga0066903_101315777 | Not Available | 1351 | Open in IMG/M |
| 3300005764|Ga0066903_104046351 | Not Available | 786 | Open in IMG/M |
| 3300005764|Ga0066903_105038656 | Not Available | 700 | Open in IMG/M |
| 3300005764|Ga0066903_105431276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300006178|Ga0075367_10622032 | Not Available | 686 | Open in IMG/M |
| 3300006791|Ga0066653_10499006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 616 | Open in IMG/M |
| 3300006797|Ga0066659_11674813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300006806|Ga0079220_11666614 | Not Available | 556 | Open in IMG/M |
| 3300006852|Ga0075433_10003255 | All Organisms → cellular organisms → Bacteria | 12540 | Open in IMG/M |
| 3300006854|Ga0075425_102562497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300006871|Ga0075434_100632859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1088 | Open in IMG/M |
| 3300006881|Ga0068865_102171991 | Not Available | 505 | Open in IMG/M |
| 3300006903|Ga0075426_10277932 | Not Available | 1222 | Open in IMG/M |
| 3300009162|Ga0075423_10981239 | Not Available | 897 | Open in IMG/M |
| 3300009162|Ga0075423_12863965 | Not Available | 528 | Open in IMG/M |
| 3300009174|Ga0105241_12159018 | Not Available | 551 | Open in IMG/M |
| 3300009177|Ga0105248_13408218 | Not Available | 505 | Open in IMG/M |
| 3300010048|Ga0126373_12444438 | Not Available | 582 | Open in IMG/M |
| 3300010048|Ga0126373_13031531 | Not Available | 524 | Open in IMG/M |
| 3300010154|Ga0127503_11032714 | Not Available | 585 | Open in IMG/M |
| 3300010303|Ga0134082_10278587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300010366|Ga0126379_13698407 | Not Available | 512 | Open in IMG/M |
| 3300010371|Ga0134125_12860639 | Not Available | 524 | Open in IMG/M |
| 3300010396|Ga0134126_11068058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300010396|Ga0134126_11806409 | Not Available | 670 | Open in IMG/M |
| 3300010401|Ga0134121_12384961 | Not Available | 569 | Open in IMG/M |
| 3300011270|Ga0137391_10125810 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300012004|Ga0120134_1040097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300012014|Ga0120159_1090105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300012019|Ga0120139_1042168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
| 3300012200|Ga0137382_10408618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300012206|Ga0137380_10317860 | Not Available | 1393 | Open in IMG/M |
| 3300012206|Ga0137380_10641198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300012209|Ga0137379_11248981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300012882|Ga0157304_1011666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
| 3300012930|Ga0137407_12204850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300012951|Ga0164300_11155254 | Not Available | 510 | Open in IMG/M |
| 3300012960|Ga0164301_10825017 | Not Available | 712 | Open in IMG/M |
| 3300012961|Ga0164302_10008861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3839 | Open in IMG/M |
| 3300012971|Ga0126369_13534384 | Not Available | 512 | Open in IMG/M |
| 3300012976|Ga0134076_10227253 | Not Available | 790 | Open in IMG/M |
| 3300013501|Ga0120154_1108541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300013765|Ga0120172_1104668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300014058|Ga0120149_1213386 | Not Available | 540 | Open in IMG/M |
| 3300014058|Ga0120149_1230382 | Not Available | 519 | Open in IMG/M |
| 3300014154|Ga0134075_10175796 | Not Available | 918 | Open in IMG/M |
| 3300014325|Ga0163163_12033762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300014829|Ga0120104_1097545 | Not Available | 587 | Open in IMG/M |
| 3300014969|Ga0157376_11759042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300015054|Ga0137420_1407012 | Not Available | 1498 | Open in IMG/M |
| 3300015261|Ga0182006_1099959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1031 | Open in IMG/M |
| 3300015373|Ga0132257_101035533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1034 | Open in IMG/M |
| 3300015374|Ga0132255_104051325 | Not Available | 622 | Open in IMG/M |
| 3300018054|Ga0184621_10101112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1020 | Open in IMG/M |
| 3300018465|Ga0190269_10044391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2039 | Open in IMG/M |
| 3300018482|Ga0066669_12175412 | Not Available | 525 | Open in IMG/M |
| 3300019888|Ga0193751_1001861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13152 | Open in IMG/M |
| 3300022534|Ga0224452_1139557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300022915|Ga0247790_10084128 | Not Available | 769 | Open in IMG/M |
| 3300025885|Ga0207653_10187520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300025911|Ga0207654_10262891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300025914|Ga0207671_11141189 | Not Available | 611 | Open in IMG/M |
| 3300025929|Ga0207664_10744532 | Not Available | 881 | Open in IMG/M |
| 3300025931|Ga0207644_11177058 | Not Available | 644 | Open in IMG/M |
| 3300025931|Ga0207644_11300473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300025939|Ga0207665_10859549 | Not Available | 718 | Open in IMG/M |
| 3300025945|Ga0207679_11826621 | Not Available | 555 | Open in IMG/M |
| 3300026067|Ga0207678_11278298 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026116|Ga0207674_11277102 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300026121|Ga0207683_10880382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300026142|Ga0207698_11660960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300026536|Ga0209058_1048917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2427 | Open in IMG/M |
| 3300028379|Ga0268266_10868286 | Not Available | 872 | Open in IMG/M |
| 3300028707|Ga0307291_1062066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
| 3300028711|Ga0307293_10025673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1760 | Open in IMG/M |
| 3300028799|Ga0307284_10394129 | Not Available | 563 | Open in IMG/M |
| 3300028811|Ga0307292_10060786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 1430 | Open in IMG/M |
| 3300028828|Ga0307312_10033732 | Not Available | 2997 | Open in IMG/M |
| 3300028828|Ga0307312_10615642 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300028881|Ga0307277_10019307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2661 | Open in IMG/M |
| 3300028884|Ga0307308_10311275 | Not Available | 754 | Open in IMG/M |
| 3300030336|Ga0247826_10666028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300031446|Ga0170820_14048193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300031543|Ga0318516_10305896 | Not Available | 919 | Open in IMG/M |
| 3300031544|Ga0318534_10784111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300031546|Ga0318538_10575509 | Not Available | 611 | Open in IMG/M |
| 3300031572|Ga0318515_10083189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1661 | Open in IMG/M |
| 3300031681|Ga0318572_10570376 | Not Available | 674 | Open in IMG/M |
| 3300031771|Ga0318546_11168517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300031781|Ga0318547_10604847 | Not Available | 680 | Open in IMG/M |
| 3300031781|Ga0318547_10894374 | Not Available | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10288205 | Not Available | 1923 | Open in IMG/M |
| 3300031938|Ga0308175_101393222 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031962|Ga0307479_11737987 | Not Available | 577 | Open in IMG/M |
| 3300032068|Ga0318553_10071388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1739 | Open in IMG/M |
| 3300032090|Ga0318518_10193458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
| 3300032090|Ga0318518_10533491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300032174|Ga0307470_10910126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300032261|Ga0306920_100287529 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300032261|Ga0306920_100457774 | Not Available | 1896 | Open in IMG/M |
| 3300032261|Ga0306920_102940011 | Not Available | 645 | Open in IMG/M |
| 3300033158|Ga0335077_10854811 | Not Available | 921 | Open in IMG/M |
| 3300033412|Ga0310810_10497874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1213 | Open in IMG/M |
| 3300033475|Ga0310811_10519312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1237 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.53% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_03628430 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | LDVDDRRGETNGRSMVSFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| FG2_01169620 | 2189573004 | Grass Soil | FDSEEHARAAGDRVSAIAGARPDDVTLDGVEVREVVASA |
| deeps_00822100 | 2199352024 | Soil | GQLNGLAMSIFDSEENARAAGDRVSAIAAGAGGDVTLDSVEVREVVASA |
| INPhiseqgaiiFebDRAFT_1002732351 | 3300000364 | Soil | IIFDSEANARAAGERVSAIAASATDDVTLDGTEVREVVASA* |
| F24TB_100661642 | 3300000550 | Soil | LNVLAMIIFDSEENARAADDRVSANFSQLEDRDDITLDALEVREVVASA* |
| JGI10214J12806_103876181 | 3300000891 | Soil | SGGELNGLSMIIFDSEENARAAGDRISAIAANAPDDVTLDGVEVREVVASA* |
| JGI11615J12901_102656742 | 3300000953 | Soil | TWMTGGGETNGLSMIIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA* |
| JGI1027J12803_1068698131 | 3300000955 | Soil | TGGAASNGLAMMIFDSEENARAAGERIRAVANARPEDVTLDSVEVREVVASA* |
| JGI10216J12902_1016207301 | 3300000956 | Soil | EENARAAGDRVSAIAAEAGDDNVTVDSVEVREVVASA* |
| Ga0062592_1015705771 | 3300004480 | Soil | VFDSEENARTAGDRISAIAASSPDDVTLDGVEVREVVASA* |
| Ga0066683_103133033 | 3300005172 | Soil | LNGLSMIIFDSEENARAAGDRVSAIAAEASDDVTLDGVEVREVVASA* |
| Ga0070658_111149611 | 3300005327 | Corn Rhizosphere | LSMIIFDSEENARAAGDRISAIAANAPDDVTLDGVEVREVVASA* |
| Ga0070683_1015171231 | 3300005329 | Corn Rhizosphere | VERRWRVEGLSMIIFDSADNERAAGDRMSAVAANAPDDATLDSVEVREVVASA* |
| Ga0066388_1064190751 | 3300005332 | Tropical Forest Soil | SEENARAAGDRVSAGFSQLESRDDLTLDGVEVREVVASA* |
| Ga0070682_1000139063 | 3300005337 | Corn Rhizosphere | MIVFDSADNARAAGDRMSAVAANAPDDVTLDSVEVREVVASA* |
| Ga0070671_1009748372 | 3300005355 | Switchgrass Rhizosphere | SLVVFDSEENARAAGERVSAIAADAPSDVTLESVEVREVVASA* |
| Ga0070714_1002515554 | 3300005435 | Agricultural Soil | LSMIIFDSEENARAAGDRVSSIASSRPDDVTLDGVEVREVVASA* |
| Ga0070663_1005339052 | 3300005455 | Corn Rhizosphere | MIIFDSADNERAAGDRMSAVAANAPDDVTLDSVEVREVVASA* |
| Ga0070662_1007717511 | 3300005457 | Corn Rhizosphere | NGLSMVIFDSEESARAAGDRVSAIAAAARDDVTLDGVEVREVVASA* |
| Ga0070706_1007423321 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TGGGETNGLSMIIFDSEENARGAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0070698_1002245241 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IFDSEENARAAGDRVSAIAAAARDDVTLDGVEVREVVASA* |
| Ga0070696_1013481601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LSMIIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0066695_103635101 | 3300005553 | Soil | DSEENARAAGDRVSAIAAEAGGDNVTLDSVEVREVVASA* |
| Ga0066699_102745291 | 3300005561 | Soil | SEENARAAGERVSAIAAGAPDDVTLDGVEVREVVASA* |
| Ga0066699_107221051 | 3300005561 | Soil | DGGLNGLSMAIFDSEENARAVGDRVSAIAAAAGGDVTVDGVEVREVVASA* |
| Ga0070664_1002276853 | 3300005564 | Corn Rhizosphere | MIIFDSADNERAAGDRMSAVAANAPDDATLDSVEVREVVASA* |
| Ga0066903_1000184002 | 3300005764 | Tropical Forest Soil | MIVFDSEETARSAGDRIRAIAAAAPDDVTLDSVEVREVVASA* |
| Ga0066903_1013157774 | 3300005764 | Tropical Forest Soil | STGGGPLNGLSMIIFDAEENARAAGDRVSAIAATRPDDVTLDGVEVRKVVASA* |
| Ga0066903_1040463512 | 3300005764 | Tropical Forest Soil | NGLSMIIFDSEENARAAGDRISAIAAGAPDDVTLDGVEVREVVASA* |
| Ga0066903_1050386561 | 3300005764 | Tropical Forest Soil | SEENARAAGDRVSAVAASRPDDVTLDGVEVREVVASA* |
| Ga0066903_1054312762 | 3300005764 | Tropical Forest Soil | GYWTWPTGEGELNALSMIIFDSEENARAAGDRVSANFSQLEDRDDVTLDGVEVREVVASA |
| Ga0075367_106220321 | 3300006178 | Populus Endosphere | VFDSEENAQAAGERIRTIAAEAPDDVTVEGVEVREVVASA* |
| Ga0066653_104990061 | 3300006791 | Soil | EENARAAGDRVSAIAADAPDDVTLDSVEVREVVASA* |
| Ga0066659_116748132 | 3300006797 | Soil | LSMIIFDSEENARAAGERVSAIAAGAPDDVTLDGVEVREVVASA* |
| Ga0079220_116666143 | 3300006806 | Agricultural Soil | MIIFDSEENARAAGERVKAIAADAPDDVTLDGTEVREVVASA* |
| Ga0075433_100032557 | 3300006852 | Populus Rhizosphere | VADRRRGLNVLAMIIFDSEENARAAGDRVSANFSQLENRDDITLDGVEVREVVASA* |
| Ga0075425_1025624971 | 3300006854 | Populus Rhizosphere | LSMIIFDSEENARAAGDRISAIAANAGDDVTLDGTEVREVVASA* |
| Ga0075434_1006328593 | 3300006871 | Populus Rhizosphere | LNVLAMIIFDSEENARAAGDRVSANFSQLENRDDITLDGVEVREVVASA* |
| Ga0068865_1021719911 | 3300006881 | Miscanthus Rhizosphere | FDSEENARAAGDRIRAIAADAPDDVTLDGVEVREVVASA* |
| Ga0075426_102779321 | 3300006903 | Populus Rhizosphere | NARAVGDRVSSIAAEVGPDRVTLDGVEVREVVASA* |
| Ga0075423_109812392 | 3300009162 | Populus Rhizosphere | SMIIFDSEENARAAGDRVSTVAADAPDDVTLESVEVREVVASA* |
| Ga0075423_128639652 | 3300009162 | Populus Rhizosphere | IMFDSEENARAAGDRISAIAADAPDDVTLDGVEVREVVASA* |
| Ga0105241_121590182 | 3300009174 | Corn Rhizosphere | MIVFDSADNARAAGDRMSAVAANVPDDVTLDSVEVREVVASA* |
| Ga0105248_134082182 | 3300009177 | Switchgrass Rhizosphere | IFDTEENARSAGDLITALAAERPDHVTLDSVEVREVVASA* |
| Ga0126373_124444381 | 3300010048 | Tropical Forest Soil | MIIFDSEENARAAGDRVSANFSQIENRDDVTLDDVEVREVVASA* |
| Ga0126373_130315311 | 3300010048 | Tropical Forest Soil | NVLAMIIFDSEENARAAGGRVGANFSQLEDRGDVTLDGVEVREVVASA* |
| Ga0127503_110327141 | 3300010154 | Soil | MIIFDSEEDARAAGDRISAIAADAPDDVTLDGVEVREVVASA* |
| Ga0134082_102785871 | 3300010303 | Grasslands Soil | TGDGGLNGLSMAIFDSEENARAVGDRVSAIAAAAGGDVTLDGVEVREVVASA* |
| Ga0126379_136984071 | 3300010366 | Tropical Forest Soil | IFDSEENARAAGERVSAIAADVGRDDVTLDSTEVREVVASA* |
| Ga0134125_128606391 | 3300010371 | Terrestrial Soil | DNARAAGDRMSAVAANAPDDVTLDSVEVREVVASA* |
| Ga0134126_110680581 | 3300010396 | Terrestrial Soil | NGLSMVIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA* |
| Ga0134126_118064092 | 3300010396 | Terrestrial Soil | WRVEGLSMIVFDSADNARAAGDRMSAVAANVPDDVTLDSVEVREVVASA* |
| Ga0134121_123849612 | 3300010401 | Terrestrial Soil | MIIFDSADNARAAGDRMSAVAANAPDDVTLDSVEVREVVASA* |
| Ga0137391_101258105 | 3300011270 | Vadose Zone Soil | WPTGGAASNGLSMIIFDSEENARAAGDRVSAVAADAGDDVTLDSVEVREVVASA* |
| Ga0120134_10400972 | 3300012004 | Permafrost | DSEDDAREAGDRVSAIAAGAPDDVTLDGVEVREVVASA* |
| Ga0120159_10901051 | 3300012014 | Permafrost | GLSMIIFDSEENARAVGDRISAIAADARDDVTLDGVEVREVVASV* |
| Ga0120139_10421682 | 3300012019 | Permafrost | GGELNGLSIIIFDSEENARAAGDRVSAIASAAPDDVTLDGVEVREVVASA* |
| Ga0137382_104086183 | 3300012200 | Vadose Zone Soil | FDSAENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0137380_103178606 | 3300012206 | Vadose Zone Soil | LSLIIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0137380_106411982 | 3300012206 | Vadose Zone Soil | FDSEENARAAGDRVSAIASTAGDDVTLDGVEVREVVASA* |
| Ga0137379_112489811 | 3300012209 | Vadose Zone Soil | MIIFDSEENARAAGDRISAIAADAPDDVTLDGVEVREVVASA* |
| Ga0157304_10116663 | 3300012882 | Soil | FDSEENARTAGDRISAIAASSPDDVTLDGVEVREVVASA* |
| Ga0137407_122048501 | 3300012930 | Vadose Zone Soil | EARAAGDRVSAIASAATDDVTLNGVEVREVVASA* |
| Ga0164300_111552541 | 3300012951 | Soil | MVIFASEESARAAGERIKAVAESAPDDVTLDGTEVREVVASA* |
| Ga0164301_108250171 | 3300012960 | Soil | IIFESEEDARGAGDRISAIAADAPEDVTLDGVEVREVVASA* |
| Ga0164302_100088611 | 3300012961 | Soil | IIFDSEESARGAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0126369_135343841 | 3300012971 | Tropical Forest Soil | SEENARTVGDRISAIAASAADDVTLDEVEVREVVASA* |
| Ga0134076_102272531 | 3300012976 | Grasslands Soil | NGLSMIIFDSEENARAVGDRISAIAADARDDVTLDGVEVREVVASA* |
| Ga0120154_11085411 | 3300013501 | Permafrost | LSMIIFDSEENASAAGDRIRAIAGDAPDDVTLDGVEVREVVASA* |
| Ga0120172_11046681 | 3300013765 | Permafrost | GTWSTGGGESNGLSMIIFDSEENARAVGDRISAIAADARDDVTLDGVEVREVVASV* |
| Ga0120149_12133862 | 3300014058 | Permafrost | FDSEENARAVGDRISAIAADARDDVTLDGVEVREVVASV* |
| Ga0120149_12303821 | 3300014058 | Permafrost | ENARAAGDRVSAIASDAPDDVTLDGVEVREVVASA* |
| Ga0134075_101757962 | 3300014154 | Grasslands Soil | IIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0163163_120337621 | 3300014325 | Switchgrass Rhizosphere | GGGELNGLSMIIFDSEENARAAGDRVSAIAAGARDDVTLDSVEVREVVASA* |
| Ga0120104_10975451 | 3300014829 | Permafrost | LSMIIFDSEENARAGGDRVSAIAAAAPDDVTLDSVEVREVVASA* |
| Ga0157376_117590422 | 3300014969 | Miscanthus Rhizosphere | NGLSMIIFDSEESARGAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0137420_14070121 | 3300015054 | Vadose Zone Soil | MIIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA* |
| Ga0182006_10999591 | 3300015261 | Rhizosphere | MIIFDSEENARTVGDRISSIAADARDDVTLDGVEVREVVASA* |
| Ga0132257_1010355332 | 3300015373 | Arabidopsis Rhizosphere | LNVLAMIVFDSEENARAAGDRVSANFSQLESRREVTLDGVEVREVVASA* |
| Ga0132255_1040513251 | 3300015374 | Arabidopsis Rhizosphere | DSEENARAAGDRVSAIAAAAPDDVTLDGVEVREVVASA* |
| Ga0184621_101011123 | 3300018054 | Groundwater Sediment | WTWMTGGGETNGLSMIIFDSEENARAAGDRISAIAAAARDDVTLDGVEVREVVASA |
| Ga0190269_100443914 | 3300018465 | Soil | MTGGGETNGLSMVIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| Ga0066669_121754121 | 3300018482 | Grasslands Soil | MIIFDSEENARAAGDRVSAIAADAPDDVTLDSVEVREVVASA |
| Ga0193751_10018618 | 3300019888 | Soil | MIIFDSEENARAAGDRVSAIATDAPDDVTLDGVEVREVVASA |
| Ga0224452_11395571 | 3300022534 | Groundwater Sediment | TNGLSMIIFDSEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0247790_100841281 | 3300022915 | Soil | FDSEENARTAGERIKSIAADMSDDVTLDGTEVREVVASA |
| Ga0207653_101875203 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | EENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| Ga0207654_102628911 | 3300025911 | Corn Rhizosphere | SMVIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| Ga0207671_111411891 | 3300025914 | Corn Rhizosphere | MIVFDSADNARAAGDRMSAVAANAPDDVTLDSVEVREVVASA |
| Ga0207664_107445322 | 3300025929 | Agricultural Soil | EENARAAGDRVSAIAARAGDDVTLESVEVREVVASA |
| Ga0207644_111770582 | 3300025931 | Switchgrass Rhizosphere | LDGLSLVVFDSEENARAAGERVSAIAADAPSDVTLESVEVREVVASA |
| Ga0207644_113004732 | 3300025931 | Switchgrass Rhizosphere | EESARGAGDRVSAIAADAPDDVTLDGVEVREVVASA |
| Ga0207665_108595491 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVERRWRVEGLSMIVFDSADNARAAGDRMSAVAANVPDDVTLDSVEVREVVASA |
| Ga0207679_118266212 | 3300025945 | Corn Rhizosphere | MIIFDSADNERAAGDRMSAVAANAPDDATLDSVEVREVVASA |
| Ga0207678_112782981 | 3300026067 | Corn Rhizosphere | LSMVIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| Ga0207674_112771022 | 3300026116 | Corn Rhizosphere | SEENARRAGDRISAIAADAPDDVTLDGVEVREVVASA |
| Ga0207683_108803821 | 3300026121 | Miscanthus Rhizosphere | LSMIIFDSEESARGAGDRVSAIAADAPDDVTLDGVEVREVVASA |
| Ga0207698_116609603 | 3300026142 | Corn Rhizosphere | MIIFDTEENARAAGDRIRAIAAAAPDDVTLDGVEVREVVASA |
| Ga0209058_10489171 | 3300026536 | Soil | IFESEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0268266_108682862 | 3300028379 | Switchgrass Rhizosphere | ADNARAAGDRMSAVAANVPDDVTLDSVEVREVVASA |
| Ga0307291_10620663 | 3300028707 | Soil | IIFDSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| Ga0307293_100256734 | 3300028711 | Soil | GLSMIIFDSEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0307284_103941291 | 3300028799 | Soil | APNGLSMIIFDSEENARAAGDRVSAVAADAPDDVTLDSVEVREVVASA |
| Ga0307292_100607863 | 3300028811 | Soil | TWMTGGGETNGLSMVIFDSEENARAAGDRISAIAAAARDDVTLDGVEVREVVASA |
| Ga0307312_100337321 | 3300028828 | Soil | TGGAETNGLSMIIFDSEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0307312_106156422 | 3300028828 | Soil | ETNGLSMIIFDSEENARAAGDRVSAIAAAARDDVTLDGVEVREVVASA |
| Ga0307277_100193071 | 3300028881 | Soil | TWTTGGVETNGLSMIIFDSEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0307308_103112752 | 3300028884 | Soil | WTTGGVETNGLSMIIFDSEENARAAGDRISAIAADARDDVTLDGVEVREVVASA |
| Ga0247826_106660281 | 3300030336 | Soil | SGGELNGLSMIIFDSEENARAAGDRISAIAANAPDDVTLDGVEVREVVASA |
| Ga0170820_140481932 | 3300031446 | Forest Soil | LNVLAMIVFDSEENARAAGDRVGANFSQLESRDDITLDGVEVREVVASA |
| Ga0318516_103058962 | 3300031543 | Soil | MIIFDSEENARGAADRVKANFARLENRGDVTLDDVEVRLVVASA |
| Ga0318534_107841111 | 3300031544 | Soil | IIFDAVSKGRAAGFGVSASAAGARDDVTLDSVEVREVVASA |
| Ga0318538_105755092 | 3300031546 | Soil | MIIFDSEENARGAADRVKANFAQLENRDDVTLDDVEVRVVVASA |
| Ga0318515_100831895 | 3300031572 | Soil | LNALTMIIFDSEENARGAADRVKANFARLENRGDVTLDDVEVRLVVASA |
| Ga0318572_105703763 | 3300031681 | Soil | LNGLSMIVFDSEEQARAAGDRVSAIASENRDDVTLDGVEVREVVASA |
| Ga0318546_111685173 | 3300031771 | Soil | LCDWGVPARAAGVGVRAIAAGARDDVTLDSVEVREVVASA |
| Ga0318547_106048471 | 3300031781 | Soil | SMIIFDSEENARAAGDRISAIAASAPDDVTLDGVEVREVVASA |
| Ga0318547_108943742 | 3300031781 | Soil | MIVFDSEEQARAAGDRVSAIASENRDDVTLDGVEVREVVASA |
| Ga0306921_102882056 | 3300031912 | Soil | LNALTMIIFDSEENARAAGDRISAIAAERPDDVTLDDVEVRLVVASA |
| Ga0308175_1013932222 | 3300031938 | Soil | GERNGLSMAIFDSEENARAAGDRISAIAADVRDDVTVDGVEVREVVASA |
| Ga0307479_117379871 | 3300031962 | Hardwood Forest Soil | NGLSMAIFDSEENARAVGDRVSAIASAGRDDITLDGFEVREVVASA |
| Ga0318553_100713884 | 3300032068 | Soil | LTMIIFDSEENARGAADRVKANFARLENRGDVTLDDVEVRLVVASA |
| Ga0318518_101934583 | 3300032090 | Soil | MNALTMIIFDSEENARGAADRVKANFARLENRGDVTLDDVEVRLVVASA |
| Ga0318518_105334911 | 3300032090 | Soil | SMIIFNTEENARAAGERVKAIAADAGRDDVTLDSTEDREVVASA |
| Ga0307470_109101262 | 3300032174 | Hardwood Forest Soil | DSEESARGAGDRVSAIAADAPDDVTLDGVEVREVVASA |
| Ga0306920_1002875295 | 3300032261 | Soil | RGAPGGGDFNGLSLINFDSVVNARAAGDRVSAIAAGARDDVTLDSVEVREVVASA |
| Ga0306920_1004577741 | 3300032261 | Soil | TNGLSMVIFDSEENARAAAGRVRGMAAETTAAETVTIESVEVREVVASA |
| Ga0306920_1029400112 | 3300032261 | Soil | MMIFDSEENARAAGDRIRAVAASAPDDVTLDDVEVREVVASA |
| Ga0335077_108548112 | 3300033158 | Soil | MMIFGSEEDARAVGDRISAVAADAPDDVTLDSVEVREVVASA |
| Ga0310810_104978741 | 3300033412 | Soil | GETNGLSMVIFDSEENARAAGDRVSAIAADAPDDVTLDGVEVREVVASA |
| Ga0310811_105193121 | 3300033475 | Soil | DSEENARAAGDRVSAIAADARDDVTLDGVEVREVVASA |
| ⦗Top⦘ |