


| Basic Information | |
|---|---|
| Family ID | F061898 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 97.71 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.466 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.985 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.511 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00582 | Usp | 30.53 |
| PF00571 | CBS | 6.87 |
| PF04972 | BON | 6.11 |
| PF00034 | Cytochrom_C | 3.82 |
| PF07731 | Cu-oxidase_2 | 3.82 |
| PF02525 | Flavodoxin_2 | 1.53 |
| PF00520 | Ion_trans | 1.53 |
| PF00072 | Response_reg | 0.76 |
| PF10025 | DUF2267 | 0.76 |
| PF09721 | Exosortase_EpsH | 0.76 |
| PF13549 | ATP-grasp_5 | 0.76 |
| PF12616 | DUF3775 | 0.76 |
| PF07485 | DUF1529 | 0.76 |
| PF06150 | ChaB | 0.76 |
| PF04828 | GFA | 0.76 |
| PF12760 | Zn_Tnp_IS1595 | 0.76 |
| PF01872 | RibD_C | 0.76 |
| PF00690 | Cation_ATPase_N | 0.76 |
| PF07813 | LTXXQ | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 3.82 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.05 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.76 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.76 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.76 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.76 |
| COG4572 | Cation transport regulator ChaB | Inorganic ion transport and metabolism [P] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.47 % |
| Unclassified | root | N/A | 30.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02T0SLW | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 2228664021|ICCgaii200_c0654714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100450838 | Not Available | 579 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1072625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300000955|JGI1027J12803_105833159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1850 | Open in IMG/M |
| 3300005328|Ga0070676_11090976 | Not Available | 603 | Open in IMG/M |
| 3300005332|Ga0066388_101190714 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300005332|Ga0066388_104973253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300005332|Ga0066388_105009073 | Not Available | 673 | Open in IMG/M |
| 3300005332|Ga0066388_107169923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300005332|Ga0066388_107519480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300005332|Ga0066388_108550585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300005332|Ga0066388_108727762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300005334|Ga0068869_100306025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1285 | Open in IMG/M |
| 3300005347|Ga0070668_100324738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1296 | Open in IMG/M |
| 3300005471|Ga0070698_100650007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 996 | Open in IMG/M |
| 3300005545|Ga0070695_100396166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1046 | Open in IMG/M |
| 3300005549|Ga0070704_100126641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1972 | Open in IMG/M |
| 3300005713|Ga0066905_100054953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2463 | Open in IMG/M |
| 3300005764|Ga0066903_101700807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1201 | Open in IMG/M |
| 3300005764|Ga0066903_106115847 | Not Available | 630 | Open in IMG/M |
| 3300005843|Ga0068860_102371785 | Not Available | 551 | Open in IMG/M |
| 3300006038|Ga0075365_10201433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1394 | Open in IMG/M |
| 3300006353|Ga0075370_10417711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300006845|Ga0075421_101808512 | Not Available | 657 | Open in IMG/M |
| 3300006871|Ga0075434_100078919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3288 | Open in IMG/M |
| 3300006871|Ga0075434_102006768 | Not Available | 584 | Open in IMG/M |
| 3300009011|Ga0105251_10284516 | Not Available | 748 | Open in IMG/M |
| 3300009094|Ga0111539_10470544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300010043|Ga0126380_10151825 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300010047|Ga0126382_11366253 | Not Available | 644 | Open in IMG/M |
| 3300010358|Ga0126370_10156932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1666 | Open in IMG/M |
| 3300010358|Ga0126370_10953995 | Not Available | 779 | Open in IMG/M |
| 3300010366|Ga0126379_11175436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300010373|Ga0134128_11547243 | Not Available | 730 | Open in IMG/M |
| 3300010376|Ga0126381_102818255 | Not Available | 694 | Open in IMG/M |
| 3300010379|Ga0136449_102556774 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012202|Ga0137363_11629749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300012202|Ga0137363_11666516 | Not Available | 530 | Open in IMG/M |
| 3300012353|Ga0137367_10408216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 963 | Open in IMG/M |
| 3300012500|Ga0157314_1044616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 547 | Open in IMG/M |
| 3300012532|Ga0137373_10897879 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012948|Ga0126375_11290203 | Not Available | 613 | Open in IMG/M |
| 3300012971|Ga0126369_10392790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1423 | Open in IMG/M |
| 3300012971|Ga0126369_12889979 | Not Available | 562 | Open in IMG/M |
| 3300014267|Ga0075313_1078384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 798 | Open in IMG/M |
| 3300014968|Ga0157379_10806617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
| 3300015200|Ga0173480_11162406 | Not Available | 519 | Open in IMG/M |
| 3300015371|Ga0132258_12481903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1297 | Open in IMG/M |
| 3300015373|Ga0132257_101138521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 986 | Open in IMG/M |
| 3300015374|Ga0132255_100232031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2628 | Open in IMG/M |
| 3300016294|Ga0182041_12293303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300016319|Ga0182033_10072666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2429 | Open in IMG/M |
| 3300016319|Ga0182033_10268874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300016319|Ga0182033_11000331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300016319|Ga0182033_11573489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300016371|Ga0182034_10420545 | Not Available | 1100 | Open in IMG/M |
| 3300016387|Ga0182040_10155689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1634 | Open in IMG/M |
| 3300016404|Ga0182037_11514775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300016404|Ga0182037_11757097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300016445|Ga0182038_11786071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300017933|Ga0187801_10421368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 557 | Open in IMG/M |
| 3300018073|Ga0184624_10445406 | Not Available | 569 | Open in IMG/M |
| 3300021560|Ga0126371_12425220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300025901|Ga0207688_10260869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300025910|Ga0207684_10106128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2403 | Open in IMG/M |
| 3300025919|Ga0207657_10138271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1992 | Open in IMG/M |
| 3300025922|Ga0207646_10687656 | Not Available | 915 | Open in IMG/M |
| 3300025923|Ga0207681_10254018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1374 | Open in IMG/M |
| 3300025937|Ga0207669_10272996 | Not Available | 1271 | Open in IMG/M |
| 3300025945|Ga0207679_11496837 | Not Available | 619 | Open in IMG/M |
| 3300025986|Ga0207658_10329493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1324 | Open in IMG/M |
| 3300026067|Ga0207678_11368643 | Not Available | 626 | Open in IMG/M |
| 3300027874|Ga0209465_10215780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300027874|Ga0209465_10483041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae | 619 | Open in IMG/M |
| 3300027909|Ga0209382_10900346 | Not Available | 932 | Open in IMG/M |
| 3300028608|Ga0247819_10412492 | Not Available | 782 | Open in IMG/M |
| 3300028719|Ga0307301_10271720 | Not Available | 555 | Open in IMG/M |
| 3300028768|Ga0307280_10323812 | Not Available | 565 | Open in IMG/M |
| 3300028814|Ga0307302_10498646 | Not Available | 604 | Open in IMG/M |
| 3300031231|Ga0170824_105587309 | Not Available | 683 | Open in IMG/M |
| 3300031543|Ga0318516_10266041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 991 | Open in IMG/M |
| 3300031544|Ga0318534_10590956 | Not Available | 631 | Open in IMG/M |
| 3300031545|Ga0318541_10205902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1089 | Open in IMG/M |
| 3300031545|Ga0318541_10678598 | Not Available | 576 | Open in IMG/M |
| 3300031546|Ga0318538_10201302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1063 | Open in IMG/M |
| 3300031573|Ga0310915_10272419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1193 | Open in IMG/M |
| 3300031681|Ga0318572_10078118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1834 | Open in IMG/M |
| 3300031681|Ga0318572_10305231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300031744|Ga0306918_10976579 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 658 | Open in IMG/M |
| 3300031768|Ga0318509_10257274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 975 | Open in IMG/M |
| 3300031769|Ga0318526_10418736 | Not Available | 547 | Open in IMG/M |
| 3300031770|Ga0318521_10105076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1560 | Open in IMG/M |
| 3300031777|Ga0318543_10057378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1603 | Open in IMG/M |
| 3300031778|Ga0318498_10120990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1190 | Open in IMG/M |
| 3300031780|Ga0318508_1080130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300031794|Ga0318503_10002771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3924 | Open in IMG/M |
| 3300031795|Ga0318557_10145786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1068 | Open in IMG/M |
| 3300031796|Ga0318576_10226556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300031797|Ga0318550_10051598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1851 | Open in IMG/M |
| 3300031819|Ga0318568_10829463 | Not Available | 573 | Open in IMG/M |
| 3300031835|Ga0318517_10105884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1237 | Open in IMG/M |
| 3300031845|Ga0318511_10031306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2034 | Open in IMG/M |
| 3300031879|Ga0306919_11416848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 524 | Open in IMG/M |
| 3300031890|Ga0306925_11033265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300031910|Ga0306923_11844405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300031941|Ga0310912_10930423 | Not Available | 668 | Open in IMG/M |
| 3300031942|Ga0310916_10378368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
| 3300031945|Ga0310913_10716027 | Not Available | 707 | Open in IMG/M |
| 3300031946|Ga0310910_10423367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1056 | Open in IMG/M |
| 3300031946|Ga0310910_11556709 | Not Available | 506 | Open in IMG/M |
| 3300031947|Ga0310909_10808066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300031954|Ga0306926_10019725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7725 | Open in IMG/M |
| 3300031954|Ga0306926_10167821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2722 | Open in IMG/M |
| 3300031954|Ga0306926_12621598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300031959|Ga0318530_10134002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1000 | Open in IMG/M |
| 3300032000|Ga0310903_10572477 | Not Available | 598 | Open in IMG/M |
| 3300032001|Ga0306922_10780075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1000 | Open in IMG/M |
| 3300032010|Ga0318569_10509615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300032051|Ga0318532_10000514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8805 | Open in IMG/M |
| 3300032066|Ga0318514_10024607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2771 | Open in IMG/M |
| 3300032076|Ga0306924_10671192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1166 | Open in IMG/M |
| 3300032122|Ga0310895_10296126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300032160|Ga0311301_12245450 | Not Available | 624 | Open in IMG/M |
| 3300032261|Ga0306920_100252250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2632 | Open in IMG/M |
| 3300032261|Ga0306920_100412586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2007 | Open in IMG/M |
| 3300032261|Ga0306920_104393076 | Not Available | 505 | Open in IMG/M |
| 3300033289|Ga0310914_10802460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300033289|Ga0310914_11069508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300033550|Ga0247829_11211120 | Not Available | 626 | Open in IMG/M |
| 3300034147|Ga0364925_0282243 | Not Available | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.76% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_06281810 | 2070309004 | Green-Waste Compost | TVSSVPPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| ICCgaii200_06547141 | 2228664021 | Soil | AHRDTLRDAAKALYRALDPARNDKDDLARMTPEEEVLLLHVME |
| INPhiseqgaiiFebDRAFT_1004508381 | 3300000364 | Soil | YAAKALYRALDPARNDKDDLARMTPDDEVLLLHVME* |
| AP72_2010_repI_A001DRAFT_10726251 | 3300000893 | Forest Soil | REGAKALYLALDPRSNDKADITRMTPEEEVLLLHVME* |
| JGI1027J12803_1058331591 | 3300000955 | Soil | DAAHRDELRDGAKALYQALDPRSNDRADIARMSPEEEVLLLHVME* |
| Ga0070676_110909762 | 3300005328 | Miscanthus Rhizosphere | PSDAVHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0066388_1011907144 | 3300005332 | Tropical Forest Soil | HRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0066388_1049732533 | 3300005332 | Tropical Forest Soil | PADAAHRDALREAAKALYLALDPGGNDKADIAQMTPDEEVNLLHIME* |
| Ga0066388_1050090731 | 3300005332 | Tropical Forest Soil | DAAHRDALRDAAQALYLALDPNSNDKVDLAQMTPEDEVRLLHVME* |
| Ga0066388_1071699232 | 3300005332 | Tropical Forest Soil | VPPADAAHRDVLREGAEALYLALDPRSNDRADITRMTPEEEVLLLHVME* |
| Ga0066388_1075194802 | 3300005332 | Tropical Forest Soil | SVPPADAAHRDVLREGAKALYLALDPRSNDKADITRMTPEEEVLLLHVME* |
| Ga0066388_1085505851 | 3300005332 | Tropical Forest Soil | KTVSSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAHMTPEEEVLLLHVME* |
| Ga0066388_1087277621 | 3300005332 | Tropical Forest Soil | VSSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPEDEVLLLHVME* |
| Ga0068869_1003060251 | 3300005334 | Miscanthus Rhizosphere | PPSDAVHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0070668_1003247381 | 3300005347 | Switchgrass Rhizosphere | KTVAAMPLSDAAHRDMLRDAAKALYRALDPARNDKTDLAGMTPEEEVLLLHVME* |
| Ga0070698_1006500071 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAHRDALREAAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0070695_1003961663 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDAAHRDMLRDAAKALYRALDPARNDKTDLAGMTPEEEVLLLHVME* |
| Ga0070704_1001266411 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKTVASMPPSDAAHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0066905_1000549535 | 3300005713 | Tropical Forest Soil | RDALRDGARMLYRALDPRRGDKEDLAQMSPDEEVALLHVME* |
| Ga0066903_1017008071 | 3300005764 | Tropical Forest Soil | PADSAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0066903_1061158471 | 3300005764 | Tropical Forest Soil | GAQALYRALDPRRNDKDDIPRMTPDEEVLLPHVME* |
| Ga0068860_1023717852 | 3300005843 | Switchgrass Rhizosphere | RDAAKALYRALEPARNDKTDLAGMTPEEEVLLLHVME* |
| Ga0075365_102014331 | 3300006038 | Populus Endosphere | MPPSDAAHRDMLRDAAKALYRALEPARNDKTDLAGMTPEEEVLLLHVME* |
| Ga0075370_104177113 | 3300006353 | Populus Endosphere | SQHVAVPLSDTAHRDMLRNAAKALYRALEPAGNDKADLAGMTPEQEVLLLHVME* |
| Ga0075421_1018085122 | 3300006845 | Populus Rhizosphere | REAAKALYLALDAGTNDKTDLAQMTPDEEVALLHVME* |
| Ga0075434_1000789191 | 3300006871 | Populus Rhizosphere | AVPPADAAHRDALRDAAKALYRALDPGRSDKDDLAQMTPDDEVLLLHVME* |
| Ga0075434_1020067682 | 3300006871 | Populus Rhizosphere | ASVPPSDVAHRDMLRDAAKALYRALAPARNDKADLADMTPEEEVLLLHVME* |
| Ga0105251_102845163 | 3300009011 | Switchgrass Rhizosphere | PADAAHRDALRDAAKALYRALDPGRSDKDDLAQMTPDDEVLLLHVME* |
| Ga0111539_104705443 | 3300009094 | Populus Rhizosphere | VSSMPPADAAHRDALREAAKALYLALDPRRNDKVDLAQMNPDDEVRLLHVME* |
| Ga0126380_101518254 | 3300010043 | Tropical Forest Soil | PPADAAHRDALRDGAKALYQALDPRRNDKDDIAQMTPEDEVLLLHVME* |
| Ga0126382_113662531 | 3300010047 | Tropical Forest Soil | EGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0126370_101569323 | 3300010358 | Tropical Forest Soil | VPPADAAHRDALRDGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0126370_109539951 | 3300010358 | Tropical Forest Soil | MRRTVMRLREGAKSLYQALNPRRNDKDDIAQMTPEEQVLLLHVME* |
| Ga0126379_111754361 | 3300010366 | Tropical Forest Soil | PADAAHRDELQDGAKALYQALDPRRNDKDDIAKMTPEEQVLLLHVME* |
| Ga0134128_115472431 | 3300010373 | Terrestrial Soil | MPPSDAVHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0126381_1028182551 | 3300010376 | Tropical Forest Soil | REGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0136449_1025567741 | 3300010379 | Peatlands Soil | SAIPADDASHRDALCDGAKALYQALAADPDDVAKMTPEDEVLLLHVIE* |
| Ga0137363_116297491 | 3300012202 | Vadose Zone Soil | HRDALREASKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0137363_116665161 | 3300012202 | Vadose Zone Soil | GSKALYRALNPRRNDKDDIARMTPEEEVLLLHVME* |
| Ga0137367_104082163 | 3300012353 | Vadose Zone Soil | EGARALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0157314_10446161 | 3300012500 | Arabidopsis Rhizosphere | PADAAHRDALREAAKALYLALDPRPNDKADLAQMNPDDEVMLLHVME* |
| Ga0137373_108978791 | 3300012532 | Vadose Zone Soil | LREGAKALYRALDPRRNDKEVIARMTPEEEVLLLHVME* |
| Ga0126375_112902031 | 3300012948 | Tropical Forest Soil | CLPCRRPMPHTDALREGAKALYQALNSRRNDKADIAQMTPEEEVLLLHVME* |
| Ga0126369_103927901 | 3300012971 | Tropical Forest Soil | AKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME* |
| Ga0126369_128899791 | 3300012971 | Tropical Forest Soil | DELRDGAQALYRALDPRRNDKDDIARMMPDEEVLLSHVME* |
| Ga0075313_10783842 | 3300014267 | Natural And Restored Wetlands | LIQLREGAKALSLALDAGRNDKDDLARMTPDEEVMLLHVME* |
| Ga0157379_108066171 | 3300014968 | Switchgrass Rhizosphere | SMPPSDAAHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0173480_111624061 | 3300015200 | Soil | VASVPLSDTAHRDMLRDAAKTLCRALDPARNDKADLAGMTPEEEVLLLHVME* |
| Ga0132258_124819031 | 3300015371 | Arabidopsis Rhizosphere | DALREAAKALYLALDPRPNDKADLAQMNPDDEVMLLHVME* |
| Ga0132257_1011385211 | 3300015373 | Arabidopsis Rhizosphere | ADAAHRDALREAAKALYRALDPRPNDKADLAQMNPDDEVMLLHVME* |
| Ga0132255_1002320311 | 3300015374 | Arabidopsis Rhizosphere | PADAAHRDALREAAKALYLALEPGRNDKANIAQMTPDEEVTLLHVME* |
| Ga0182041_122933032 | 3300016294 | Soil | VSSVPPTDAAHRDALREGAKALYQALNLRHNDKDDIAQMTPEEEALLPHVME |
| Ga0182033_100726666 | 3300016319 | Soil | DALREGAKALCDALLEKSDATQITPEEEVLLLHVME |
| Ga0182033_102688744 | 3300016319 | Soil | SVPPADAAHRDELREGAEALYRALDPRRNDKKDMTPKEQVPCLHVME |
| Ga0182033_110003311 | 3300016319 | Soil | KTVSSVPPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHDME |
| Ga0182033_115734891 | 3300016319 | Soil | DAAHRDALREGAKALYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0182034_104205451 | 3300016371 | Soil | RDALLDGAKALYRALNPRRNGKDDIAQMTPEEEVLLLHVME |
| Ga0182040_101556891 | 3300016387 | Soil | KTVSSVPPADAAHRDALREGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0182037_115147751 | 3300016404 | Soil | AKTVSSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPDEEVLLLHVME |
| Ga0182037_117570972 | 3300016404 | Soil | SSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0182038_117860712 | 3300016445 | Soil | VSSVPPADAAHRDALREGAKALYQALNLRHNDKDDIAQMTPEEEALLPHVME |
| Ga0187801_104213682 | 3300017933 | Freshwater Sediment | RDLAKTAAAPLVADVAHREALREAAKALYLALACEDTTDIASLTPDEEVRLLHILE |
| Ga0184624_104454062 | 3300018073 | Groundwater Sediment | AHRDTLRDAAKALYRALDPARNDKDDLARMKPEEEVLLLHVME |
| Ga0126371_124252201 | 3300021560 | Tropical Forest Soil | HRDALREGAKVLYRALNPRRNDRDDIAQMTPEEEVLLLHVME |
| Ga0207688_102608691 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RDMLRDAAKTLCRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0207684_101061281 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPADAAHRDALREAAKALYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0207657_101382715 | 3300025919 | Corn Rhizosphere | MSARSALYRALAPARNDKADLADMTPEEEVLLLHVME |
| Ga0207646_106876563 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RDALREAAKALYRALNPRGNDKDDIAQMTPEEEVLLLHVME |
| Ga0207681_102540181 | 3300025923 | Switchgrass Rhizosphere | DMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0207669_102729961 | 3300025937 | Miscanthus Rhizosphere | MLRDAAKTLCRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0207679_114968371 | 3300025945 | Corn Rhizosphere | VASVPLSDTAHRDMLRDAAKTLCRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0207658_103294933 | 3300025986 | Switchgrass Rhizosphere | AAKALYRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0207678_113686431 | 3300026067 | Corn Rhizosphere | SDTAHRDMLRDAAKTLCRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0209465_102157803 | 3300027874 | Tropical Forest Soil | DSAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0209465_104830412 | 3300027874 | Tropical Forest Soil | PADAAHRDVLREGAKALYLALDPRSNDKADITRMTPEEEVLLLHVME |
| Ga0209382_109003461 | 3300027909 | Populus Rhizosphere | LREAAKALYLALDAGTNDKTDLAQMTPDEEVALLHVME |
| Ga0247819_104124923 | 3300028608 | Soil | KTVASMPPSDAVHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0307301_102717201 | 3300028719 | Soil | RDAAKALYRALDPARNDKTDLAGMTPEEEVLLLHVME |
| Ga0307280_103238121 | 3300028768 | Soil | AAKALYRALDYARSDKDDPARMTPEGQALLLHVME |
| Ga0307302_104986462 | 3300028814 | Soil | AHRDTLRDAARALYRALDPARNDKDDLARMKPEEEVLLLHVME |
| Ga0170824_1055873092 | 3300031231 | Forest Soil | ASMPPSDAAHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0318516_102660411 | 3300031543 | Soil | HRDALRDGAKALYQALDPRRNDKNDIAQMTPEEEVLLLHVME |
| Ga0318534_105909561 | 3300031544 | Soil | LAKTVSSVPPADAAHRDALREAAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318541_102059023 | 3300031545 | Soil | TVSCVPPADAAHRDALREAAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318541_106785981 | 3300031545 | Soil | GAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318538_102013022 | 3300031546 | Soil | VPPADAAHRDALREGAKALYRALNPRRNDRDDIAQMTPEEEVLLLYVME |
| Ga0310915_102724193 | 3300031573 | Soil | RDGAKALYQALDPCRNDKNDIAHMTPEEEVLLLHVME |
| Ga0318572_100781183 | 3300031681 | Soil | ADAAHRDALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318572_103052311 | 3300031681 | Soil | ALRDGAKALYQALDPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306918_109765791 | 3300031744 | Soil | DALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318509_102572741 | 3300031768 | Soil | RDGAKALYQALDPRRNDKNDIAQMTPEEEVLLLHVME |
| Ga0318526_104187362 | 3300031769 | Soil | RDALRGGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318521_101050761 | 3300031770 | Soil | VPPADAAHRDALREGAKALYRALNPRRNDRDDIAQMTPEEEALLLYVME |
| Ga0318543_100573784 | 3300031777 | Soil | SSVPPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHDME |
| Ga0318498_101209903 | 3300031778 | Soil | VSSVPPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHDME |
| Ga0318508_10801303 | 3300031780 | Soil | HRDALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318503_100027711 | 3300031794 | Soil | AAHRDALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318557_101457861 | 3300031795 | Soil | SSVPPADAAHRDALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318576_102265561 | 3300031796 | Soil | LREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318550_100515981 | 3300031797 | Soil | ANTVSSVPPADAAHRDTLREGAKALYQALNPRRNDKDDIAQITPEEEVLLLHVME |
| Ga0318568_108294632 | 3300031819 | Soil | ALREAAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318517_101058841 | 3300031835 | Soil | PPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHDME |
| Ga0318511_100313061 | 3300031845 | Soil | RGGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306919_114168482 | 3300031879 | Soil | VSSVPPADAAHRDALREGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306925_110332651 | 3300031890 | Soil | PADAAHRDALRDGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306923_118444051 | 3300031910 | Soil | NTVSSVPPADAAHRDTLREGAKALYQALNPRRNDKDDIAQITPEEEVLLLHVME |
| Ga0310912_109304232 | 3300031941 | Soil | GAKALYQALDPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0310916_103783683 | 3300031942 | Soil | TVSSVPPADAAHRDALREGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0310913_107160272 | 3300031945 | Soil | REGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0310910_104233671 | 3300031946 | Soil | VPPADAAHRDALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0310910_115567092 | 3300031946 | Soil | KTVSSVPPADAAHRDELRDGAQALYRALDSRRNDKDDIPRMTPDEEVLFPHFME |
| Ga0310909_108080662 | 3300031947 | Soil | ADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPDEEVLLLHVME |
| Ga0306926_1001972511 | 3300031954 | Soil | DALREGAKALYDALLEKSDASQMTPEEEVLLLHVME |
| Ga0306926_101678215 | 3300031954 | Soil | TVSSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPDEEVLLLHVME |
| Ga0306926_126215982 | 3300031954 | Soil | ALRDGAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318530_101340023 | 3300031959 | Soil | AKTVSSVPPADAAHRDALREAAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0310903_105724771 | 3300032000 | Soil | HRDMLRDAAKELYRALEPARNDKTDLAGMTPEEEVLLLHVME |
| Ga0306922_107800751 | 3300032001 | Soil | ADAAHRDTLREGAKALYQALNPRRNDKDDIAQITPEEEVLLLHVME |
| Ga0318569_105096151 | 3300032010 | Soil | AAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0318532_1000051410 | 3300032051 | Soil | VPPADAAHRDALREGAKSLYQALNPRRSDKDDIAQMTPEEEVLLLHVME |
| Ga0318514_100246071 | 3300032066 | Soil | ALRDGATALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306924_106711923 | 3300032076 | Soil | PPADAAHRDALREGAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0310895_102961261 | 3300032122 | Soil | AAKALYRGLDTARNDKTDLAGMTPEEEVLLLHVME |
| Ga0311301_122454502 | 3300032160 | Peatlands Soil | SAIPADDASHRDALCDGAKALYQALAADPDDVAKMTPEDEVLLLHVIE |
| Ga0306920_1002522505 | 3300032261 | Soil | GAKALYRALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0306920_1004125865 | 3300032261 | Soil | ALREGAKALYQALNPRRNDKDDIAQMTPDEEVLLLHVME |
| Ga0306920_1043930761 | 3300032261 | Soil | LRDGAKALYQALDPCRNDKNDIAHMTPEEEVLLLHVME |
| Ga0310914_108024601 | 3300033289 | Soil | AKTVSSVPPADAAHRDALREGAKALYQALNPRRNDKDDIAQMAPEEEVLLLHLME |
| Ga0310914_110695082 | 3300033289 | Soil | GAKALYQALNPRRNDKDDIAQMTPEEEVLLLHVME |
| Ga0247829_112111201 | 3300033550 | Soil | DAAHRDMLRDAAKALYRALDPARNDKADLAGMTPEEEVLLLHVME |
| Ga0364925_0282243_444_593 | 3300034147 | Sediment | MPLSDAAHRDMLRDAAKALYRALDPARNDKTDLAGMTPEEEVLLLHVME |
| ⦗Top⦘ |