


| Basic Information | |
|---|---|
| Family ID | F061803 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MEIDISKQEAWKLIDAIKAYMKDYTVTGAVHKTFDNITKKLKEVVKE |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.26 % |
| % of genes near scaffold ends (potentially truncated) | 12.21 % |
| % of genes from short scaffolds (< 2000 bps) | 61.07 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.71 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.069 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (38.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.626 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.71 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.26.1.1: Long-chain cytokines | d1huwa_ | 1huw | 0.82619 |
| e.41.1.1: Adenylylcyclase toxin (the edema factor) | d1k8ta_ | 1k8t | 0.80311 |
| a.7.7.1: BAG domain | d3ldqb1 | 3ldq | 0.79089 |
| a.25.2.0: automated matches | d6wgsa_ | 6wgs | 0.78272 |
| a.25.1.3: Manganese catalase (T-catalase) | d2v8ta_ | 2v8t | 0.7697 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 18.32 |
| PF00293 | NUDIX | 7.63 |
| PF00041 | fn3 | 0.76 |
| PF01322 | Cytochrom_C_2 | 0.76 |
| PF14743 | DNA_ligase_OB_2 | 0.76 |
| PF09722 | Xre_MbcA_ParS_C | 0.76 |
| PF13392 | HNH_3 | 0.76 |
| PF00069 | Pkinase | 0.76 |
| PF02945 | Endonuclease_7 | 0.76 |
| PF04024 | PspC | 0.76 |
| PF00156 | Pribosyltran | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.05 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.07 % |
| All Organisms | root | All Organisms | 38.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10167345 | Not Available | 620 | Open in IMG/M |
| 3300001282|B570J14230_10181765 | Not Available | 587 | Open in IMG/M |
| 3300002195|metazooDRAFT_1228446 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Waddliaceae → unclassified Waddliaceae → Waddliaceae bacterium | 914 | Open in IMG/M |
| 3300002201|metazooDRAFT_1258844 | Not Available | 609 | Open in IMG/M |
| 3300002357|B570J29597_101167 | Not Available | 779 | Open in IMG/M |
| 3300002384|B570J29636_1004555 | Not Available | 904 | Open in IMG/M |
| 3300002388|B570J29596_1004943 | Not Available | 1002 | Open in IMG/M |
| 3300002389|B570J29643_100335 | Not Available | 2851 | Open in IMG/M |
| 3300002408|B570J29032_109572903 | Not Available | 888 | Open in IMG/M |
| 3300002408|B570J29032_109830893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 1524 | Open in IMG/M |
| 3300002835|B570J40625_100032400 | Not Available | 8140 | Open in IMG/M |
| 3300002835|B570J40625_100044890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 6451 | Open in IMG/M |
| 3300002835|B570J40625_100067566 | All Organisms → Viruses → Predicted Viral | 4792 | Open in IMG/M |
| 3300002835|B570J40625_100187635 | Not Available | 2268 | Open in IMG/M |
| 3300002835|B570J40625_101091802 | Not Available | 675 | Open in IMG/M |
| 3300003490|JGI25926J51410_1030317 | Not Available | 1007 | Open in IMG/M |
| 3300004461|Ga0066223_1406898 | Not Available | 672 | Open in IMG/M |
| 3300004804|Ga0007796_10180979 | Not Available | 624 | Open in IMG/M |
| 3300005581|Ga0049081_10001213 | All Organisms → cellular organisms → Bacteria | 9759 | Open in IMG/M |
| 3300005805|Ga0079957_1023557 | All Organisms → Viruses → Predicted Viral | 4228 | Open in IMG/M |
| 3300005805|Ga0079957_1045433 | Not Available | 2737 | Open in IMG/M |
| 3300005805|Ga0079957_1162849 | Not Available | 1119 | Open in IMG/M |
| 3300005805|Ga0079957_1199330 | Not Available | 967 | Open in IMG/M |
| 3300006639|Ga0079301_1000394 | All Organisms → cellular organisms → Bacteria | 20814 | Open in IMG/M |
| 3300006639|Ga0079301_1149914 | Not Available | 689 | Open in IMG/M |
| 3300006875|Ga0075473_10174556 | Not Available | 866 | Open in IMG/M |
| 3300007165|Ga0079302_1059054 | Not Available | 859 | Open in IMG/M |
| 3300008962|Ga0104242_1010499 | Not Available | 1631 | Open in IMG/M |
| 3300009068|Ga0114973_10031037 | All Organisms → Viruses → Predicted Viral | 3234 | Open in IMG/M |
| 3300009068|Ga0114973_10301006 | Not Available | 855 | Open in IMG/M |
| 3300009151|Ga0114962_10011146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 6616 | Open in IMG/M |
| 3300009151|Ga0114962_10028821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 3829 | Open in IMG/M |
| 3300009152|Ga0114980_10001491 | Not Available | 16828 | Open in IMG/M |
| 3300009152|Ga0114980_10062126 | Not Available | 2254 | Open in IMG/M |
| 3300009154|Ga0114963_10045732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 2820 | Open in IMG/M |
| 3300009154|Ga0114963_10138846 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300009154|Ga0114963_10180793 | Not Available | 1232 | Open in IMG/M |
| 3300009154|Ga0114963_10191123 | Not Available | 1190 | Open in IMG/M |
| 3300009154|Ga0114963_10252158 | Not Available | 1000 | Open in IMG/M |
| 3300009154|Ga0114963_10297622 | Not Available | 899 | Open in IMG/M |
| 3300009158|Ga0114977_10386089 | Not Available | 782 | Open in IMG/M |
| 3300009159|Ga0114978_10016694 | Not Available | 5494 | Open in IMG/M |
| 3300009159|Ga0114978_10029474 | Not Available | 3936 | Open in IMG/M |
| 3300009159|Ga0114978_10859670 | Not Available | 508 | Open in IMG/M |
| 3300009161|Ga0114966_10058121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 2718 | Open in IMG/M |
| 3300009180|Ga0114979_10284319 | Not Available | 985 | Open in IMG/M |
| 3300009183|Ga0114974_10486159 | Not Available | 694 | Open in IMG/M |
| 3300009184|Ga0114976_10257743 | Not Available | 944 | Open in IMG/M |
| 3300010334|Ga0136644_10008323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 7325 | Open in IMG/M |
| 3300010334|Ga0136644_10069676 | Not Available | 2227 | Open in IMG/M |
| 3300010334|Ga0136644_10242324 | Not Available | 1061 | Open in IMG/M |
| 3300010334|Ga0136644_10292647 | Not Available | 946 | Open in IMG/M |
| 3300010334|Ga0136644_10334462 | Not Available | 871 | Open in IMG/M |
| 3300010334|Ga0136644_10537902 | Not Available | 648 | Open in IMG/M |
| 3300010354|Ga0129333_11332337 | Not Available | 592 | Open in IMG/M |
| 3300010885|Ga0133913_11994453 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
| 3300010885|Ga0133913_12075382 | Not Available | 1408 | Open in IMG/M |
| 3300010885|Ga0133913_13205250 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300010885|Ga0133913_13305940 | Not Available | 1061 | Open in IMG/M |
| 3300013004|Ga0164293_10013704 | Not Available | 6819 | Open in IMG/M |
| 3300013004|Ga0164293_10030235 | Not Available | 4492 | Open in IMG/M |
| 3300013004|Ga0164293_10279005 | Not Available | 1167 | Open in IMG/M |
| 3300013005|Ga0164292_10844197 | Not Available | 577 | Open in IMG/M |
| 3300013006|Ga0164294_10016760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 6009 | Open in IMG/M |
| 3300014962|Ga0134315_1008288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 1687 | Open in IMG/M |
| 3300017785|Ga0181355_1241745 | Not Available | 695 | Open in IMG/M |
| 3300019784|Ga0181359_1002244 | Not Available | 5542 | Open in IMG/M |
| 3300019784|Ga0181359_1080705 | Not Available | 1219 | Open in IMG/M |
| 3300019784|Ga0181359_1156953 | Not Available | 775 | Open in IMG/M |
| 3300020157|Ga0194049_1035098 | Not Available | 1301 | Open in IMG/M |
| 3300020485|Ga0208054_114488 | Not Available | 580 | Open in IMG/M |
| 3300020487|Ga0208200_111623 | Not Available | 711 | Open in IMG/M |
| 3300020506|Ga0208091_1011933 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300020514|Ga0208202_1000529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 8621 | Open in IMG/M |
| 3300020515|Ga0208234_1000791 | Not Available | 5333 | Open in IMG/M |
| 3300020515|Ga0208234_1010473 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300020518|Ga0208721_1000838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 5820 | Open in IMG/M |
| 3300020530|Ga0208235_1035296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 595 | Open in IMG/M |
| 3300020547|Ga0208361_1023030 | Not Available | 862 | Open in IMG/M |
| 3300020549|Ga0207942_1019799 | Not Available | 862 | Open in IMG/M |
| 3300020555|Ga0208358_1049250 | Not Available | 624 | Open in IMG/M |
| 3300020564|Ga0208719_1044049 | Not Available | 820 | Open in IMG/M |
| 3300020566|Ga0208222_1014172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 1638 | Open in IMG/M |
| 3300021079|Ga0194055_10178858 | Not Available | 865 | Open in IMG/M |
| 3300022746|Ga0228701_1018970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Amoebophilaceae | 2218 | Open in IMG/M |
| 3300022752|Ga0214917_10013731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 7194 | Open in IMG/M |
| 3300022752|Ga0214917_10065655 | Not Available | 2322 | Open in IMG/M |
| 3300023179|Ga0214923_10120839 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300023179|Ga0214923_10381405 | Not Available | 730 | Open in IMG/M |
| 3300023184|Ga0214919_10062863 | Not Available | 3421 | Open in IMG/M |
| 3300025578|Ga0208864_1054131 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300025591|Ga0208496_1059735 | Not Available | 882 | Open in IMG/M |
| 3300025732|Ga0208784_1180675 | Not Available | 618 | Open in IMG/M |
| 3300027114|Ga0208009_1062394 | Not Available | 666 | Open in IMG/M |
| 3300027114|Ga0208009_1082714 | Not Available | 533 | Open in IMG/M |
| 3300027563|Ga0209552_1052896 | Not Available | 1149 | Open in IMG/M |
| 3300027708|Ga0209188_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 159358 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1006732 | All Organisms → cellular organisms → Bacteria | 12566 | Open in IMG/M |
| 3300027733|Ga0209297_1238360 | Not Available | 703 | Open in IMG/M |
| 3300027734|Ga0209087_1002362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 10674 | Open in IMG/M |
| 3300027734|Ga0209087_1020906 | Not Available | 3218 | Open in IMG/M |
| 3300027734|Ga0209087_1248424 | Not Available | 658 | Open in IMG/M |
| 3300027741|Ga0209085_1009474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 4925 | Open in IMG/M |
| 3300027741|Ga0209085_1042884 | All Organisms → Viruses → Predicted Viral | 2113 | Open in IMG/M |
| 3300027741|Ga0209085_1079968 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300027741|Ga0209085_1093736 | Not Available | 1330 | Open in IMG/M |
| 3300027741|Ga0209085_1274610 | Not Available | 651 | Open in IMG/M |
| 3300027746|Ga0209597_1034019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 2658 | Open in IMG/M |
| 3300027747|Ga0209189_1002292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 13488 | Open in IMG/M |
| 3300027747|Ga0209189_1003217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 11029 | Open in IMG/M |
| 3300027747|Ga0209189_1042250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 2262 | Open in IMG/M |
| 3300027747|Ga0209189_1118520 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300027747|Ga0209189_1176446 | Not Available | 897 | Open in IMG/M |
| 3300027759|Ga0209296_1145494 | Not Available | 1071 | Open in IMG/M |
| 3300027760|Ga0209598_10245559 | Not Available | 728 | Open in IMG/M |
| 3300027763|Ga0209088_10109204 | Not Available | 1260 | Open in IMG/M |
| 3300027973|Ga0209298_10000987 | All Organisms → cellular organisms → Bacteria | 18892 | Open in IMG/M |
| 3300028025|Ga0247723_1005479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 5718 | Open in IMG/M |
| 3300028394|Ga0304730_1000024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 199903 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1000381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105876 | Open in IMG/M |
| 3300031758|Ga0315907_10510790 | Not Available | 949 | Open in IMG/M |
| 3300031951|Ga0315904_10768711 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 798 | Open in IMG/M |
| 3300031951|Ga0315904_10979378 | Not Available | 673 | Open in IMG/M |
| 3300033816|Ga0334980_0011841 | All Organisms → cellular organisms → Bacteria | 3786 | Open in IMG/M |
| 3300033816|Ga0334980_0015870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 3242 | Open in IMG/M |
| 3300033994|Ga0334996_0344665 | Not Available | 721 | Open in IMG/M |
| 3300033996|Ga0334979_0014604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. | 5347 | Open in IMG/M |
| 3300034062|Ga0334995_0297645 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300034104|Ga0335031_0000990 | All Organisms → cellular organisms → Bacteria | 21846 | Open in IMG/M |
| 3300034280|Ga0334997_0030478 | All Organisms → Viruses → Predicted Viral | 3725 | Open in IMG/M |
| 3300034284|Ga0335013_0003824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11705 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 38.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 16.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.58% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.82% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.29% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.53% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.53% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.76% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.76% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002357 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002384 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002388 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002389 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020485 | Freshwater microbial communities from Lake Mendota, WI - 03JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020487 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025591 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_101673451 | 3300001282 | Freshwater | QKMQVDISKQEAWKLLDAIEAYKKDYSLTAPVTKMFTNITKKLKDIVSDS* |
| B570J14230_101817651 | 3300001282 | Freshwater | KQEAWKLIDAINAYMKDYTVTGAVHKTFDNITKKLKEVVKE* |
| metazooDRAFT_12284462 | 3300002195 | Lake | MNVELSKQEAWKIMDAIKAYTKDYSVSGAVSKTFHNITKKLEKIVDG* |
| metazooDRAFT_12588442 | 3300002201 | Lake | VTMQVDISKQEAWKIIDAIKAYTKDYSVSGAVNKTFHNITKKLEKVVND* |
| B570J29597_1011672 | 3300002357 | Freshwater | MQVDISKQEAWKLLDAIEAYKKDYSLTAPVTKMFTNITKKLKDIVSDS* |
| B570J29636_10045551 | 3300002384 | Freshwater | MEIDITKQEAWKLIDAIKAYMKDYTVTGAVHKTFDNITKKLKEVVKE* |
| B570J29596_10049431 | 3300002388 | Freshwater | MQIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFENVTKKLKEIVKE* |
| B570J29643_1003351 | 3300002389 | Freshwater | MXIEXSKQEAWKLIDAIVAYKKDYTVTGAVSKTFXNVTKXLKEIVKE* |
| B570J29032_1095729032 | 3300002408 | Freshwater | MQIEISKQEAWKLLDAIKAYTKDYTVTGAVEKTFHNITNKLKKVTNE* |
| B570J29032_1098308933 | 3300002408 | Freshwater | MQIDISKQEAWKLMDAISAYMKDYTVTGPVHKTFDNITKKLKEVVKE* |
| B570J40625_10003240023 | 3300002835 | Freshwater | MEIDISKQEAWKLIDAIKAYMKDYTVTGAVHKTFDNITKKLKEVVKE* |
| B570J40625_10004489014 | 3300002835 | Freshwater | MQIEISKQEAWKLLDAIKTYSKDYALNGAVQKTFENLVKKLNKVVND* |
| B570J40625_1000675669 | 3300002835 | Freshwater | MQIDINKQEAWKLMDAVKAYLKDYTLTAQANKTFDAITKKLKEVVKE* |
| B570J40625_1001876353 | 3300002835 | Freshwater | MQIEVSKQEAWKLLDAIKTYMKDYTVTAPVSKTFSNIIKKLETITNS* |
| B570J40625_1010918021 | 3300002835 | Freshwater | MEIDITKQEAWKLIDAINAYMKDYTVTGAVHKTFDNITKKLKEVVKE* |
| JGI25926J51410_10303171 | 3300003490 | Freshwater Lake | MQVDISKQEAWKLIDAVKAYMKDYTVTGPVHKTFDSITKKLKEVVKE* |
| Ga0066223_14068981 | 3300004461 | Marine | MQVEITKQEAWKILDAISAYKKDYTVTGAVSKTFDNISKKLKEIVKE* |
| Ga0007796_101809792 | 3300004804 | Freshwater | MQIDINKQEAWKLIDAIKAYMKDYTVTGPVHKTFDTITKK |
| Ga0049081_1000121325 | 3300005581 | Freshwater Lentic | VQIEVSKQEAWKLLDAIKTYMKDYTVTAPVSKTFNNIIKKLETITNS* |
| Ga0079957_10235572 | 3300005805 | Lake | VQIDISKQEAWKLLDAITAYTKDYTVSGSVSKTFDNIIKKLKVVTDN* |
| Ga0079957_10454334 | 3300005805 | Lake | MQIDISKQEAWKLLDAIKAYSKDYSLTGAVTKTFDNLSKKLQKIAKS* |
| Ga0079957_11628492 | 3300005805 | Lake | MQVDISKQEAWKLLDAIKAYSKDYSLTGAVTKTFDNLSKKLEKIAKA* |
| Ga0079957_11993302 | 3300005805 | Lake | MQIDISKQEAWKLLDAIKAYSKDYSLTGPVTKTFHSLTKKLEQVTKE* |
| Ga0079301_10003941 | 3300006639 | Deep Subsurface | MEIDITKQEAWKLMDAISAYMKDYTVTGPVHKTFDSITKKLKQVVKEQ* |
| Ga0079301_11499143 | 3300006639 | Deep Subsurface | MEIDITKQEAWKLMDAISAYMKDYTVTGPVHKTFDNITKKLKEVVKE* |
| Ga0075473_101745564 | 3300006875 | Aqueous | MQIDISKQEAWKLLDAIKAYSKDYSLTGAVNKTFANLTKKLEKVTKHD* |
| Ga0079302_10590543 | 3300007165 | Deep Subsurface | MEIDISKQEAWKILDALVAYKKDYTVTGPVSKIFDNVTKKLKEIVKE* |
| Ga0104242_10104992 | 3300008962 | Freshwater | MQIDISKQEAWKILDAIKAYKKDYTVTGAVNKIFDGLTKKLTSLVNADK* |
| Ga0114973_100310371 | 3300009068 | Freshwater Lake | MEIDITKQEAWKLIDAIKAYMKDYTVTGPVHKTFDSITKKLKEVVKE* |
| Ga0114973_103010062 | 3300009068 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVTKE* |
| Ga0114962_100111464 | 3300009151 | Freshwater Lake | MEIDINKQEAWKLLDALDAYKKDYTLTGPVNKIFDNITKKLKMVLKD* |
| Ga0114962_100288215 | 3300009151 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVLQEK* |
| Ga0114980_1000149124 | 3300009152 | Freshwater Lake | MEVELSKQEAWKILDAISAYKEDYTVTGAVSKTYDNITKKLKEVVKE* |
| Ga0114980_100621264 | 3300009152 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDTITKKLKGVVQEK* |
| Ga0114963_100457325 | 3300009154 | Freshwater Lake | MQIDISKQEAWKLIDAIKAYMKDYTVTGPVHKTFDSISKKLKEVVKE* |
| Ga0114963_101388463 | 3300009154 | Freshwater Lake | MEIDITKQEAWKLIDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE* |
| Ga0114963_101807933 | 3300009154 | Freshwater Lake | MEVELSKQEAWKLLDAISAYKKDYTVTGSVSKTFDNITKKLKEVIKE* |
| Ga0114963_101911231 | 3300009154 | Freshwater Lake | MQIDISKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSITKKLKEVVKE* |
| Ga0114963_102521583 | 3300009154 | Freshwater Lake | MEIDISKQEAWKLLDALVAYKKDYTLTGPVNKIFDNITKKLKGVIKDR* |
| Ga0114963_102976222 | 3300009154 | Freshwater Lake | MEIDISKQEAWKILDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE* |
| Ga0114977_103860891 | 3300009158 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVVQEK* |
| Ga0114978_1001669415 | 3300009159 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVVKE* |
| Ga0114978_100294745 | 3300009159 | Freshwater Lake | MNVDITKQEAWKILDAIKAYTKDYSLSGAVNKTFQNIVAKLEKITNE* |
| Ga0114978_108596702 | 3300009159 | Freshwater Lake | MNVDISKQEAWKIIDAIKAYTKDYSVSGAVSKTFTNITKKLEKIVND* |
| Ga0114966_100581216 | 3300009161 | Freshwater Lake | MQIDITKQEAWKLMDAIKAYMSDYTVTGPVHKTFDTITKKLKEVVKE* |
| Ga0114979_102843193 | 3300009180 | Freshwater Lake | EAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVVQEK* |
| Ga0114974_104861593 | 3300009183 | Freshwater Lake | MQIDISKQEAWKILDAIKAYTKDYTVTGAVEKTFHNITNKLKK |
| Ga0114976_102577433 | 3300009184 | Freshwater Lake | MEIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFDSVTKKLKEIVKE* |
| Ga0136644_1000832318 | 3300010334 | Freshwater Lake | MEIDITKQEAWKLMDALDAYKKDYTLTGPVNKIFDNITKKLKMVLKD* |
| Ga0136644_100696762 | 3300010334 | Freshwater Lake | MEIEFSKQEAWKILDAISAYKKDYTVTGAVSKTFDNITKKLKKVVKE* |
| Ga0136644_102423243 | 3300010334 | Freshwater Lake | QEAWKLIDAISAYKKDYTVTGAVSKTFDNITKKLKGIVKD* |
| Ga0136644_102926471 | 3300010334 | Freshwater Lake | MEIDISKQEAWKLLDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE* |
| Ga0136644_103344622 | 3300010334 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTLTGPVNKIFDNITKKLKEIVKE* |
| Ga0136644_105379021 | 3300010334 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDV |
| Ga0129333_113323372 | 3300010354 | Freshwater To Marine Saline Gradient | MQIEISKQEAWKLLDAIKAYSKDYSLTGAVNKTFHNLTKKLEKVTKDS* |
| Ga0133913_119944533 | 3300010885 | Freshwater Lake | LILGIFKETKMQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVVKE* |
| Ga0133913_120753824 | 3300010885 | Freshwater Lake | VQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVTKE* |
| Ga0133913_132052501 | 3300010885 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSIIKKLKDVTKE* |
| Ga0133913_133059401 | 3300010885 | Freshwater Lake | DITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVLQEK* |
| Ga0164293_100137043 | 3300013004 | Freshwater | MQIDINKQEAWKLIDAVKAYLKDYTLTGQVHKTFDSITKKLKEVVKE* |
| Ga0164293_100302352 | 3300013004 | Freshwater | MQIDINKQEAWKLMDAVQAYLKDYTLTAQANKTFDTITKKLKEVVKE* |
| Ga0164293_102790052 | 3300013004 | Freshwater | MQIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFDNVTKKLKEIVKE* |
| Ga0164292_108441972 | 3300013005 | Freshwater | KLIDVIVAYKKDYTVTGAVSKTFENVTKKLKEIVKE* |
| Ga0164294_100167602 | 3300013006 | Freshwater | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDTITKKLKGVLQEKQ* |
| Ga0134315_10082881 | 3300014962 | Surface Water | MPIEISKQEAWKLLDAIKAYTKDYAVNVSVKKTFNNLVKKLETITKA* |
| Ga0181355_12417452 | 3300017785 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDSVIKKLKTVVKE |
| Ga0181359_10022442 | 3300019784 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKTVVKE |
| Ga0181359_10807052 | 3300019784 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDSITKKLKEVVKE |
| Ga0181359_11569531 | 3300019784 | Freshwater Lake | MQVDISKQEAWKLIDAVKAYMKDYTVTGPVHKTFDSITKKLKEVVKE |
| Ga0194049_10350982 | 3300020157 | Anoxic Zone Freshwater | MEIDINKQEAWKLMDAVSSYLKDYTLTEQANKTFDAITKKLKKIVKES |
| Ga0208054_1144882 | 3300020485 | Freshwater | MEIELSKQEAWKLIDAIVAYKKDYTVTGAVSKTFDNVTKKLKEIVKE |
| Ga0208200_1116231 | 3300020487 | Freshwater | MQIDINKQEAWKLMDAVKAYLKDYTLTAQANKTFDAITKKLKEVVKE |
| Ga0208091_10119331 | 3300020506 | Freshwater | MQIDISKQEAWKLMDAISAYMKDYTVTGPVHKTFDNITKKLKEVVKE |
| Ga0208202_100052913 | 3300020514 | Freshwater | MEIDITKQEAWKLIDAINAYMKDYTVTGAVHKTFDNITKKLKEVVKE |
| Ga0208234_100079114 | 3300020515 | Freshwater | MEIDISKQEAWKLIDAIKAYMKDYTVTGAVHKTFDNITKKLKEVVKE |
| Ga0208234_10104732 | 3300020515 | Freshwater | MEIDITKQEAWKLIDAIKAYMKDYTVTGAVHKTFDNITKKLKEVVKE |
| Ga0208721_10008384 | 3300020518 | Freshwater | MQVDISKQEAWKLLDAIEAYKKDYSLTAPVTKMFTNITKKLKDIVSDS |
| Ga0208235_10352963 | 3300020530 | Freshwater | MQIEISKQEAWKLLDAIKAYTKDYTVTGAVEKTFHNITNKLKKVTNE |
| Ga0208361_10230303 | 3300020547 | Freshwater | MQIEVSKQEAWKLLDAIKTYMKDYTVTAPVSKTFSNIIKKLETITNS |
| Ga0207942_10197992 | 3300020549 | Freshwater | MELLNFMQIDISKQEAWKLMDAISAYMKDYTVTGPVHKTFDNITKKLKEVVKE |
| Ga0208358_10492501 | 3300020555 | Freshwater | MEIDITKQEAWKLIDAIKAYMKDYTVTGAVHKTFDSVTKKLKEVVKE |
| Ga0208719_10440493 | 3300020564 | Freshwater | MQIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFDNVTKKLKEIVKE |
| Ga0208222_10141722 | 3300020566 | Freshwater | MQIDISKQEAWKLLDAIKNYVSDYTVAKPVTKLLDSVTKKLEKIVHE |
| Ga0194055_101788582 | 3300021079 | Anoxic Zone Freshwater | MEIDINKQEAWKLLDALVAYKKDYTLTGPVNKIFDNITKKLKEVVKE |
| Ga0228701_10189706 | 3300022746 | Freshwater | MQIDISKQEAWKLLDAIKAYCNDYTMTGAVGKTFDNLTKKLQKIAKG |
| Ga0214917_100137317 | 3300022752 | Freshwater | MQIDISKQEAWKILDAIKAYKKDYTVTGAVNKIFDGLTKKLTSLVNADK |
| Ga0214917_100656553 | 3300022752 | Freshwater | MEIDITKQEAWKLMDAIQAYMKDYTVTGAVHKTFDNITKKLKEVVKEQ |
| Ga0214923_101208391 | 3300023179 | Freshwater | MEELKRMQIEITKQEAWKILDAIETYSKDYAVNGAVSKTFAGVVKKLK |
| Ga0214923_103814051 | 3300023179 | Freshwater | MQIEITKQEAWKILDAIETYSKDYAVNGAVSKTFAGVVKKLK |
| Ga0214919_100628632 | 3300023184 | Freshwater | MQIEVSKQEAWKLLDAIKTYIKDYTVTAPVSKTFNNIIKKLETITNS |
| Ga0208864_10541314 | 3300025578 | Freshwater | MEIDISKQEAWKILDALVAYKKDYTLTGPVNKIFDNISKKLKKIVED |
| Ga0208496_10597351 | 3300025591 | Freshwater | MEIDISKQEAWKLLDALVAYKKDYTLTGSVNKIFDNITKKLKEIVKEXLYFSG |
| Ga0208784_11806752 | 3300025732 | Aqueous | MQIDISKQEAWKLLDAIKAYSKDYSLTGAVNKTFANLTKKLEKVTKHD |
| Ga0208009_10623941 | 3300027114 | Deep Subsurface | MEIDITKQEAWKLMDAISAYMKDYTVTGPVHKTFDNITKKLKEVVKE |
| Ga0208009_10827142 | 3300027114 | Deep Subsurface | MEIDITKQEAWKLMDAISAYMKDYTVTGPVHKTFDSITKKLKQVVKEQ |
| Ga0209552_10528961 | 3300027563 | Freshwater Lake | MQVDISKQEAWKLIDAVKAYMKDYTVTGPVHKTFDSITKKLKEVVK |
| Ga0209188_1000030156 | 3300027708 | Freshwater Lake | MEIDINKQEAWKLLDALDAYKKDYTLTGPVNKIFDNITKKLKMVLKD |
| (restricted) Ga0247836_100673236 | 3300027728 | Freshwater | MSTIDLTKQEAWKILDAIKAYSKDYTVSDSVTKVFNSITKKLQGVVNGK |
| Ga0209297_12383602 | 3300027733 | Freshwater Lake | DITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVVKE |
| Ga0209087_100236213 | 3300027734 | Freshwater Lake | MQVDITKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSVIKKLKDVVKE |
| Ga0209087_10209067 | 3300027734 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVVQEK |
| Ga0209087_12484242 | 3300027734 | Freshwater Lake | MEIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFDSVTKKLKEIVKE |
| Ga0209085_10094748 | 3300027741 | Freshwater Lake | MEVELSKQEAWKLLDAISAYKKDYTVTGSVSKTFDNITKKLKEVIKE |
| Ga0209085_10428841 | 3300027741 | Freshwater Lake | MQIDISKQEAWKLIDAIKAYMSDYTVTGPVHKTFDSITKKLKEVVKE |
| Ga0209085_10799683 | 3300027741 | Freshwater Lake | MEIDITKQEAWKLIDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE |
| Ga0209085_10937362 | 3300027741 | Freshwater Lake | MEIDISKQEAWKILDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE |
| Ga0209085_12746102 | 3300027741 | Freshwater Lake | MEIDISKQEAWKLLDALVAYKKDYTLTGPVNKIFDNITKKLKGVIKDR |
| Ga0209597_10340191 | 3300027746 | Freshwater Lake | MEIDITKQEAWKLIDAIKAYMKDYTVTGPVHKTFDSITKKLKEVVKE |
| Ga0209189_100229239 | 3300027747 | Freshwater Lake | MEIEFSKQEAWKILDAISAYKKDYTVTGAVSKTFDNITKKLKKVVKE |
| Ga0209189_10032178 | 3300027747 | Freshwater Lake | MEIDITKQEAWKLMDALDAYKKDYTLTGPVNKIFDNITKKLKMVLKD |
| Ga0209189_10422504 | 3300027747 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDAITKKLKGVLQEK |
| Ga0209189_11185205 | 3300027747 | Freshwater Lake | MEIDISKQEAWKLLDAISAYKKDYTVTGAVSKTFDNITKKLKEVVKE |
| Ga0209189_11764462 | 3300027747 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTLTGPVNKIFDNITKKLKEIVKE |
| Ga0209296_11454944 | 3300027759 | Freshwater Lake | MNVDITKQEAWKILDAIKAYTKDYSLSGAVNKTFQNIVAKLEKITNE |
| Ga0209598_102455591 | 3300027760 | Freshwater Lake | DITKQEAWKLIDAIKAYMKDYTVTGPVHKTFDSITKKLKEVVKE |
| Ga0209088_101092043 | 3300027763 | Freshwater Lake | MEIDITKQEAWKLIDAIQAYMKDYTVTGPVHKTFDTITKKLKGVVQEK |
| Ga0209298_100009873 | 3300027973 | Freshwater Lake | MEVELSKQEAWKILDAISAYKEDYTVTGAVSKTYDNITKKLKEVVKE |
| Ga0247723_100547914 | 3300028025 | Deep Subsurface Sediment | MEIDITKQEAWKLMDALVAYKKDYTVTKPVIKIFDTITKKLKGVLQEK |
| Ga0304730_1000024140 | 3300028394 | Freshwater Lake | MQIDITKQEAWKLMDAIKAYMSDYTVTGPVHKTFDTITKKLKEVVKE |
| (restricted) Ga0247843_100038115 | 3300028569 | Freshwater | MEIDITKQEAWKLIDAVKAYMKDYTVTGTVHKTFDSISKKLKEVIKGE |
| Ga0315907_105107902 | 3300031758 | Freshwater | VQIDISKQEAWKLLDAITAYTKDYTVSGSVSKTFDNIIKKLKVVTDN |
| Ga0315904_107687113 | 3300031951 | Freshwater | MQIELSKQEAWKLLDAIKSYTSDYVVTAPVKKTLDNVTKKLKAITND |
| Ga0315904_109793781 | 3300031951 | Freshwater | MNIEITKQEAWKLLDAIEAYKKDYSLTPPVTKMFVNVAKKLKEIIND |
| Ga0334980_0011841_254_397 | 3300033816 | Freshwater | MEIDITKQEAWKLIDAVNAYLKDYTLTGAVHKTFDNITKKLKDVVKE |
| Ga0334980_0015870_346_489 | 3300033816 | Freshwater | MQIEISKQEAWKLLDAIKTYSKDYALNGAVQKTFENLVKKLNKVVND |
| Ga0334996_0344665_475_618 | 3300033994 | Freshwater | MQIEISKQEAWKLIDAIVAYKKDYTVTGAVSKTFENVTKKLKEIVKE |
| Ga0334979_0014604_4142_4285 | 3300033996 | Freshwater | MQIDINKQEAWKLMDAVQAYLKDYTLTAQANKTFDTITKKLKEVVKE |
| Ga0334995_0297645_522_665 | 3300034062 | Freshwater | MEIELSKQEAWKLIDAIVAYKKDYTVTGAVSKTFENVTKKLKEIVKE |
| Ga0335031_0000990_14782_14946 | 3300034104 | Freshwater | LIIQGGKVQIEITKSEAHKILDAIKAYSNDYVVTGAVSKTFDNITIKMKSIINS |
| Ga0334997_0030478_853_1014 | 3300034280 | Freshwater | MELLNFMQIDINKQEAWKLMDAVKAYLKDYTLTAQANKTFDAITKKLKEVVKE |
| Ga0335013_0003824_6066_6209 | 3300034284 | Freshwater | MQIDINKQEAWKLIDAVKAYLKDYTLTGQVHKTFDSITKKLKEVVKE |
| ⦗Top⦘ |