


| Basic Information | |
|---|---|
| Family ID | F061743 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQPLVIL |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.47 % |
| % of genes from short scaffolds (< 2000 bps) | 80.92 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.389 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.061 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.695 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 55.73 |
| PF01434 | Peptidase_M41 | 16.79 |
| PF12704 | MacB_PCD | 16.03 |
| PF11734 | TilS_C | 1.53 |
| PF00005 | ABC_tran | 1.53 |
| PF01613 | Flavin_Reduct | 1.53 |
| PF16576 | HlyD_D23 | 1.53 |
| PF02737 | 3HCDH_N | 0.76 |
| PF06480 | FtsH_ext | 0.76 |
| PF14534 | DUF4440 | 0.76 |
| PF00156 | Pribosyltran | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 17.56 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.53 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.76 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.76 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.39 % |
| Unclassified | root | N/A | 20.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10026606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1939 | Open in IMG/M |
| 3300002908|JGI25382J43887_10408295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
| 3300002912|JGI25386J43895_10002623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4597 | Open in IMG/M |
| 3300002916|JGI25389J43894_1009552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1608 | Open in IMG/M |
| 3300005174|Ga0066680_10661321 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005180|Ga0066685_10440690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
| 3300005444|Ga0070694_100067986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans | 2447 | Open in IMG/M |
| 3300005555|Ga0066692_10527240 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005556|Ga0066707_10539819 | Not Available | 753 | Open in IMG/M |
| 3300005557|Ga0066704_10536413 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 765 | Open in IMG/M |
| 3300005575|Ga0066702_10842140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300006031|Ga0066651_10011996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3547 | Open in IMG/M |
| 3300006031|Ga0066651_10121467 | Not Available | 1341 | Open in IMG/M |
| 3300006034|Ga0066656_10185523 | Not Available | 1318 | Open in IMG/M |
| 3300006755|Ga0079222_12633553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
| 3300006794|Ga0066658_10141117 | Not Available | 1207 | Open in IMG/M |
| 3300006794|Ga0066658_10540544 | Not Available | 633 | Open in IMG/M |
| 3300006845|Ga0075421_100127612 | All Organisms → cellular organisms → Bacteria | 3190 | Open in IMG/M |
| 3300006847|Ga0075431_100587673 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300006852|Ga0075433_10155815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2032 | Open in IMG/M |
| 3300007076|Ga0075435_100701658 | Not Available | 879 | Open in IMG/M |
| 3300007255|Ga0099791_10615307 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300007265|Ga0099794_10736711 | Not Available | 526 | Open in IMG/M |
| 3300009012|Ga0066710_103818126 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009143|Ga0099792_10320102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 927 | Open in IMG/M |
| 3300009156|Ga0111538_13941747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300009162|Ga0075423_10043631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4594 | Open in IMG/M |
| 3300009609|Ga0105347_1367349 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010126|Ga0127482_1068783 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010301|Ga0134070_10012751 | Not Available | 2668 | Open in IMG/M |
| 3300010301|Ga0134070_10323056 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300010301|Ga0134070_10400280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300010304|Ga0134088_10629574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300010321|Ga0134067_10056817 | Not Available | 1271 | Open in IMG/M |
| 3300010325|Ga0134064_10098458 | Not Available | 960 | Open in IMG/M |
| 3300010329|Ga0134111_10378472 | Not Available | 603 | Open in IMG/M |
| 3300010337|Ga0134062_10011556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3257 | Open in IMG/M |
| 3300010337|Ga0134062_10113692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1174 | Open in IMG/M |
| 3300010361|Ga0126378_11213135 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300011429|Ga0137455_1122366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
| 3300011430|Ga0137423_1105539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 841 | Open in IMG/M |
| 3300012039|Ga0137421_1030670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1385 | Open in IMG/M |
| 3300012198|Ga0137364_10542761 | Not Available | 875 | Open in IMG/M |
| 3300012198|Ga0137364_11095041 | Not Available | 600 | Open in IMG/M |
| 3300012199|Ga0137383_11211025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300012200|Ga0137382_10014023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4397 | Open in IMG/M |
| 3300012200|Ga0137382_10120347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1754 | Open in IMG/M |
| 3300012200|Ga0137382_10229568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1282 | Open in IMG/M |
| 3300012200|Ga0137382_10393226 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300012201|Ga0137365_10005513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10148 | Open in IMG/M |
| 3300012203|Ga0137399_10016619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4672 | Open in IMG/M |
| 3300012203|Ga0137399_10697274 | Not Available | 855 | Open in IMG/M |
| 3300012203|Ga0137399_11569666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300012203|Ga0137399_11716012 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012208|Ga0137376_10025641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4604 | Open in IMG/M |
| 3300012208|Ga0137376_11578899 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012209|Ga0137379_10248292 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1693 | Open in IMG/M |
| 3300012285|Ga0137370_10267699 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1015 | Open in IMG/M |
| 3300012349|Ga0137387_10095181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2068 | Open in IMG/M |
| 3300012353|Ga0137367_11075084 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012357|Ga0137384_10064122 | All Organisms → cellular organisms → Bacteria | 3047 | Open in IMG/M |
| 3300012360|Ga0137375_10120703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2620 | Open in IMG/M |
| 3300012360|Ga0137375_11438013 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012395|Ga0134044_1039403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1333 | Open in IMG/M |
| 3300012410|Ga0134060_1526331 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012685|Ga0137397_10781938 | Not Available | 708 | Open in IMG/M |
| 3300012918|Ga0137396_10803532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300012922|Ga0137394_11530450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
| 3300012924|Ga0137413_11081489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
| 3300012927|Ga0137416_10015901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4673 | Open in IMG/M |
| 3300012927|Ga0137416_10098198 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300012927|Ga0137416_10397660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1167 | Open in IMG/M |
| 3300012929|Ga0137404_11710551 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012930|Ga0137407_12209785 | Not Available | 526 | Open in IMG/M |
| 3300012976|Ga0134076_10001906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6343 | Open in IMG/M |
| 3300012977|Ga0134087_10070683 | Not Available | 1414 | Open in IMG/M |
| 3300014150|Ga0134081_10136650 | Not Available | 796 | Open in IMG/M |
| 3300014166|Ga0134079_10538353 | Not Available | 570 | Open in IMG/M |
| 3300014875|Ga0180083_1012194 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300015241|Ga0137418_10294764 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300015374|Ga0132255_101458632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1035 | Open in IMG/M |
| 3300017656|Ga0134112_10057408 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300017657|Ga0134074_1204369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
| 3300017659|Ga0134083_10544717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300018056|Ga0184623_10390179 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018071|Ga0184618_10460182 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300018076|Ga0184609_10325848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300018078|Ga0184612_10218124 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300018433|Ga0066667_10877793 | Not Available | 770 | Open in IMG/M |
| 3300018468|Ga0066662_10004832 | All Organisms → cellular organisms → Bacteria | 6569 | Open in IMG/M |
| 3300018482|Ga0066669_11180916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300018482|Ga0066669_11590426 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300020199|Ga0179592_10193251 | Not Available | 924 | Open in IMG/M |
| 3300021073|Ga0210378_10391038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300022195|Ga0222625_1199589 | Not Available | 1826 | Open in IMG/M |
| 3300025324|Ga0209640_11229492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300025327|Ga0209751_10932470 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025927|Ga0207687_11812327 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025928|Ga0207700_10033922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3658 | Open in IMG/M |
| 3300026075|Ga0207708_11408000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300026122|Ga0209926_1072746 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300026298|Ga0209236_1046257 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300026306|Ga0209468_1164566 | Not Available | 565 | Open in IMG/M |
| 3300026312|Ga0209153_1007919 | Not Available | 3319 | Open in IMG/M |
| 3300026324|Ga0209470_1147627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300026324|Ga0209470_1202417 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300026324|Ga0209470_1331146 | Not Available | 551 | Open in IMG/M |
| 3300026325|Ga0209152_10484249 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026327|Ga0209266_1076508 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300026335|Ga0209804_1122793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1178 | Open in IMG/M |
| 3300026343|Ga0209159_1001995 | All Organisms → cellular organisms → Bacteria | 14725 | Open in IMG/M |
| 3300026343|Ga0209159_1057786 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300026540|Ga0209376_1053659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2301 | Open in IMG/M |
| 3300026540|Ga0209376_1307811 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
| 3300027616|Ga0209106_1094098 | Not Available | 672 | Open in IMG/M |
| 3300027643|Ga0209076_1194245 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027671|Ga0209588_1000376 | All Organisms → cellular organisms → Bacteria | 11619 | Open in IMG/M |
| 3300027875|Ga0209283_10571307 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300027903|Ga0209488_10632770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
| 3300027909|Ga0209382_10349567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1656 | Open in IMG/M |
| 3300027909|Ga0209382_10904900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 929 | Open in IMG/M |
| 3300027909|Ga0209382_11993554 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300028536|Ga0137415_10454988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1086 | Open in IMG/M |
| 3300028536|Ga0137415_11164562 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300028536|Ga0137415_11383463 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030730|Ga0307482_1021911 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300031720|Ga0307469_10425127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1142 | Open in IMG/M |
| 3300031720|Ga0307469_10656211 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031820|Ga0307473_10428901 | Not Available | 874 | Open in IMG/M |
| 3300033813|Ga0364928_0184497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 520 | Open in IMG/M |
| 3300034177|Ga0364932_0035147 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.87% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.53% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026122 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_100266063 | 3300002560 | Grasslands Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQALVVLLEEITEAE |
| JGI25382J43887_104082952 | 3300002908 | Grasslands Soil | VKVTALAAHTPEAVRAALAARGWDAEPARFAATGIQSLVVLLDDITAT |
| JGI25386J43895_100026231 | 3300002912 | Grasslands Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQALVVLLEEITE |
| JGI25389J43894_10095521 | 3300002916 | Grasslands Soil | VKLTPLAPHTPEAVRAALAARGWDTQPAWFAATGMQALVV |
| Ga0066680_106613211 | 3300005174 | Soil | VKLTALAAHTPEAVRAALAAHGWDAQPAWLAATGVQPLVVL |
| Ga0066685_104406901 | 3300005180 | Soil | MKVTALAAHTPEAVRAVLAARGWESQPAWFAATGIEPLVVLIEDITETE |
| Ga0070694_1000679861 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLTPLAAQTPEAVRAALAARGWDAQPAWFAATGMQALVVLL |
| Ga0066692_105272402 | 3300005555 | Soil | VKLTALAAHTPEAVRAALAAHGWDAQPAWLAATGVQPLVVLLEEITEPE |
| Ga0066707_105398192 | 3300005556 | Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQ |
| Ga0066704_105364131 | 3300005557 | Soil | VKLTALAAHTPEAVRAALAARGWGEQPAWLAATGVQRLLVLLDDIS |
| Ga0066702_108421401 | 3300005575 | Soil | MNVTALAAHTPEAVRAALAARGWESQPAWFAATGIEPLVLLIEDITETE |
| Ga0066651_100119961 | 3300006031 | Soil | VKLTALAAHTPEAVRAALAARGWETQPAWFAATGVQSLVVLLDEVSEPER |
| Ga0066651_101214671 | 3300006031 | Soil | VKLTALPAHAPEAVRAALVARGWDVDRAWFAATGVQFLIVLLEDISAA |
| Ga0066656_101855232 | 3300006034 | Soil | VSARPAVKVTALAAHTPDAVRAALAARGWDAQPAWFAATGV |
| Ga0079222_126335532 | 3300006755 | Agricultural Soil | VRLTALAAHTPEAVRAALAARGWDAQPAWFAANGVQPL |
| Ga0066658_101411171 | 3300006794 | Soil | VKLTPLAAHTPEAVRAALAARGWEAQHAWFAAIGMQALVVL |
| Ga0066658_105405442 | 3300006794 | Soil | VKLTALAAHTPEAVRAALAARGWDAQPAWFAAVGVQSLVVLLE |
| Ga0075421_1001276124 | 3300006845 | Populus Rhizosphere | VRVTALATHTTPPEAVRAALAARGWEAQPAWFAATGLQSLVVL |
| Ga0075431_1005876731 | 3300006847 | Populus Rhizosphere | VKITALAAHTPEAVRAALAARGWETQPAWFAATGIQPLV |
| Ga0075433_101558151 | 3300006852 | Populus Rhizosphere | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGV |
| Ga0075435_1007016581 | 3300007076 | Populus Rhizosphere | VKLTPLAAHTPEAVRAALAARGWDAQPAWFAATGM |
| Ga0099791_106153072 | 3300007255 | Vadose Zone Soil | MKVTALAAPTPEAVRAALAARGWEAQPAWFAATGI |
| Ga0099794_107367112 | 3300007265 | Vadose Zone Soil | VKLTALAVHTPEAVRAALAARGWQTQPAWFAATGMQALVVLLE |
| Ga0066710_1038181262 | 3300009012 | Grasslands Soil | VKMTALAAHTPEAVRAALAARGWEAQPAWFAATGVQALVVLL |
| Ga0099792_103201022 | 3300009143 | Vadose Zone Soil | VKVTALAAQTPEAVRAALAARGWEAQPAWFAATGIQSLVVLIED |
| Ga0111538_139417471 | 3300009156 | Populus Rhizosphere | VKVTALAAQTPEAVRAALAARGWETQPAWFAATGIQSTVLLLEDI |
| Ga0075423_100436311 | 3300009162 | Populus Rhizosphere | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGVQAV |
| Ga0105347_13673492 | 3300009609 | Soil | LKVTALAAQTPEAVRAALAARGWEAQPAWFAAVGIQPLVVL |
| Ga0127482_10687831 | 3300010126 | Grasslands Soil | MKITALAAHTPEAVRAALAARGWETQPAWFAATGIEPLVVLIEE |
| Ga0134070_100127511 | 3300010301 | Grasslands Soil | VKLTPLAAHTPEAVRAALAARGWDAQPAWFAATGVQSLVVLL |
| Ga0134070_103230563 | 3300010301 | Grasslands Soil | VKLTLLASHTPEAVRAALTARGWDAQPAWFAATGV |
| Ga0134070_104002801 | 3300010301 | Grasslands Soil | VRVTALAAHTPEAVRAALAARGWEAQPARFAATGIQPFVVL |
| Ga0134088_106295741 | 3300010304 | Grasslands Soil | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQPLVILIEDITES |
| Ga0134067_100568171 | 3300010321 | Grasslands Soil | VKLTSLAAHTPEAVRAALAARGWEAQPAWFAATGVQSLVVLLED |
| Ga0134064_100984581 | 3300010325 | Grasslands Soil | VKVTALAAHTPDAVRAALAARGWDAQPAWFAATGVQ |
| Ga0134111_103784721 | 3300010329 | Grasslands Soil | VRLTPLAAHTPEAVRAALAARGWETQPAWFAATGVQSL |
| Ga0134062_100115565 | 3300010337 | Grasslands Soil | VKVTALAAQTPEAVRAALAARGWEGQPAWFAAVGIQALVVLIE |
| Ga0134062_101136921 | 3300010337 | Grasslands Soil | VKVTALAAHTPDAVRAALAARGWDAQPAWFAATGVQT |
| Ga0126378_112131352 | 3300010361 | Tropical Forest Soil | VKVTALAAHTPQAVRAALAARGWESQPAWFAATGI |
| Ga0137455_11223662 | 3300011429 | Soil | VKVTALAAQTPEAVRAALAARGWEAQPAWFAAVGIQPLVVLI |
| Ga0137423_11055392 | 3300011430 | Soil | VKVTALAAQTPEAVRAALAARGWEAQPAWFAAVGIQPL |
| Ga0137421_10306701 | 3300012039 | Soil | VKVTALAAQTPEAVRAALAARGWEAQPAWFAAVGIQPLV |
| Ga0137364_105427612 | 3300012198 | Vadose Zone Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQALV |
| Ga0137364_110950411 | 3300012198 | Vadose Zone Soil | VTALAAHTPEAVRAALAARGWDSQPAWFAATGVQALVVLLDGVTEAE |
| Ga0137383_112110251 | 3300012199 | Vadose Zone Soil | VKLTALAAHTPEAVRAALAARGWEPQASWFAATGVHAVVVLLEDID |
| Ga0137382_100140235 | 3300012200 | Vadose Zone Soil | VKITAVAAHTPEAVRAALAARGWEAQPAWFAAIGIQPFVVL |
| Ga0137382_101203473 | 3300012200 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQPLVIL |
| Ga0137382_102295682 | 3300012200 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWETQPAWFAATGIEPLVVLIEE |
| Ga0137382_103932262 | 3300012200 | Vadose Zone Soil | MKITAVAAHTPEAVRAALAARGWEAQPAWFAAIGIQPFVVL |
| Ga0137365_1000551310 | 3300012201 | Vadose Zone Soil | VKLTALAAHTPEAVRAALAARGWDAQPAWFAATGIQSLVVLL |
| Ga0137399_100166196 | 3300012203 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWEAQPAWFAAIGIQSFVVLIE |
| Ga0137399_106972742 | 3300012203 | Vadose Zone Soil | VRVTALAAHTSPPEAVRAALAARGWEAQPAWFAATGVQSLVVLLEEITE |
| Ga0137399_115696663 | 3300012203 | Vadose Zone Soil | VTALAAHTPEAVRAALAARGWEAQPAWFAAIGIQSFVVLIED |
| Ga0137399_117160121 | 3300012203 | Vadose Zone Soil | VSARPAVKLTALAAHTPEAVRAALAARGWEAQPAWFAATGMQ |
| Ga0137376_100256411 | 3300012208 | Vadose Zone Soil | MNVTALAAHTPEAVRAALAARGWEPQPAWFAAVGIQPFVVLIE |
| Ga0137376_115788991 | 3300012208 | Vadose Zone Soil | MKITALAAHTPEAVRAALAARGWEPQPAWFAAVGIQPFVVLIE |
| Ga0137379_102482923 | 3300012209 | Vadose Zone Soil | VKVTALAAHTPEAVRAVLAARGWEAQPAWFAATGIQPLVVLLEDITA |
| Ga0137370_102676992 | 3300012285 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWETQPAWFAASGI |
| Ga0137387_100951811 | 3300012349 | Vadose Zone Soil | VRVTALAAHSPEALRAALVARGWDGQPAWLAATGVQ |
| Ga0137367_110750841 | 3300012353 | Vadose Zone Soil | LKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQPFV |
| Ga0137384_100641224 | 3300012357 | Vadose Zone Soil | VKVTALAAHTSPPEAVRAALAARGWEAQPAWFAATGVQSLVVLLEDISES |
| Ga0137375_101207034 | 3300012360 | Vadose Zone Soil | VRVTALAAHTPEAVRAALAARGWEAQPAWFAAVGIQPFVVLIE |
| Ga0137375_114380132 | 3300012360 | Vadose Zone Soil | MNVTALAAHTPEAVRAALAARGWEAQPAWFAAVGIQPFVVLIE |
| Ga0134044_10394031 | 3300012395 | Grasslands Soil | VKVTALAAQTPEAVRAALAARGWEGQPAWFAAVGIQALVVL |
| Ga0134060_15263311 | 3300012410 | Grasslands Soil | MKITALAAHTPEAVRAALAARGWETQPAWFAAVGIQPFVALIEDIS |
| Ga0137397_107819381 | 3300012685 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWEGQPAWFAATGIQPFVVLIEDITEEE |
| Ga0137396_108035321 | 3300012918 | Vadose Zone Soil | VNVTALAAHTPEAVRAALAARGWEAQPAWFAATGMQ |
| Ga0137394_115304501 | 3300012922 | Vadose Zone Soil | VRVTALAAHTPEAVRAALAARGWEGQPAWFAATGIQPFVVLIEDITE |
| Ga0137413_110814891 | 3300012924 | Vadose Zone Soil | VKVTALAAQTPEAVRAALAARGWEAQPAWFAATGI |
| Ga0137416_100159016 | 3300012927 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWEAQPAWFAAIGIQSFVVLIED |
| Ga0137416_100981981 | 3300012927 | Vadose Zone Soil | MKVTALAAHTPEAVRAALAARGWEAQPAWFAAVGIQPFV |
| Ga0137416_103976601 | 3300012927 | Vadose Zone Soil | LKVTALAAHTPEAVRAALAARGWEAQPAWFAAVGIQPFVVLIEAISEAERE |
| Ga0137404_117105512 | 3300012929 | Vadose Zone Soil | VKLTPLAPHTPEAVRAALAARGWDTQPAWFAATGMQALVVLLEEI |
| Ga0137407_122097851 | 3300012930 | Vadose Zone Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQALLVL |
| Ga0134076_100019066 | 3300012976 | Grasslands Soil | MKVTALAAHTPEAVRAVLAARGWESQPAWFAATGI* |
| Ga0134087_100706833 | 3300012977 | Grasslands Soil | VKLTALAAHTPEAVRAALAARGWDAQPAWFAAVGVQSLVVLLEDVA |
| Ga0134081_101366501 | 3300014150 | Grasslands Soil | VKLTALAAHTPEAVRAALAARGWDADPARFAAIGMQSVVLLLEGISET |
| Ga0134079_105383532 | 3300014166 | Grasslands Soil | VRLTPLAAHTPEAVRAALAARGWDAQPAWFAATGIQALVI |
| Ga0180083_10121941 | 3300014875 | Soil | VKVTALAAHTPEAVRAALAARGWEPHAAWLAASGVQFLLLLLEHISEA |
| Ga0137418_102947642 | 3300015241 | Vadose Zone Soil | VRVTALAAHTPEAVRAALAARGWEGQPAWFAATGIQPFVVLIED |
| Ga0132255_1014586322 | 3300015374 | Arabidopsis Rhizosphere | VTALAAQTPEAVRAALAARGWETQPAWFAATGIQATVL |
| Ga0134112_100574081 | 3300017656 | Grasslands Soil | VKVTALAAHTPEAVRAALAARGWDADPAWFAATGLQPLVV |
| Ga0134074_12043692 | 3300017657 | Grasslands Soil | VRVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQPFVVL |
| Ga0134083_105447172 | 3300017659 | Grasslands Soil | VRLTALAAHTPEAVRAALAARGWDAQPAWFAATGVE |
| Ga0184623_103901791 | 3300018056 | Groundwater Sediment | VKVTALAAHTPEAVRAALAARGWESDAAWFAATGLRHLVLLLEGVTE |
| Ga0184618_104601822 | 3300018071 | Groundwater Sediment | VRVTALAAPTSPPEAVRAALAARGWEAQPAWFAATGVQSLVVILEA |
| Ga0184609_103258481 | 3300018076 | Groundwater Sediment | VRVTALAAHTPEAVRAALAARGWEGQPAWFAATGIQ |
| Ga0184612_102181242 | 3300018078 | Groundwater Sediment | MKVTALAAHTPEAVRAALAARGWEGQPAWFAATGIQTF |
| Ga0066667_108777931 | 3300018433 | Grasslands Soil | VKLTPLAAHTPEAVRAALAARGWDTQPAWFAATGMQA |
| Ga0066662_100048327 | 3300018468 | Grasslands Soil | VKVTALAAHTPEAVRAALVARGWDAQPAWFAASGVRPLAVIL |
| Ga0066669_111809162 | 3300018482 | Grasslands Soil | VKLTALAAHTPEAVRAALAAHGWEAQPAWFAATGIQPFVVL |
| Ga0066669_115904262 | 3300018482 | Grasslands Soil | VKVTALAAHTPEAVRAALAARGWDAQPAWFAATGVQPLAVILE |
| Ga0179592_101932512 | 3300020199 | Vadose Zone Soil | VKLTALAVHTPEAVRAALAARGWETQPAWFAATGMQALVVLLEE |
| Ga0210378_103910382 | 3300021073 | Groundwater Sediment | VRVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQTFVVLIEDITED |
| Ga0222625_11995894 | 3300022195 | Groundwater Sediment | MKVTALAAHTPEAVRAALAARGWEAQPAWFAAVGIQPFVVLIEAI |
| Ga0209640_112294922 | 3300025324 | Soil | VRLTALAAHTPEAVRAALAVRGWEPHASGLAAAGLRGL |
| Ga0209751_109324702 | 3300025327 | Soil | VKVTALAAHTPEAVRAALAARGWEGQPAWFAAIGVRSL |
| Ga0207687_118123272 | 3300025927 | Miscanthus Rhizosphere | VKVTALAAQTPEAVRAALAARGWDTQPAWFAATGIQTTVL |
| Ga0207700_100339225 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLTALAAHTPEAVRAALAARGWDAQPAWFAATGVQSLVVLLEE |
| Ga0207708_114080001 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVTALAAPTPEAVRAALAARGWEAQPAWFAATGIQATVFLLED |
| Ga0209926_10727461 | 3300026122 | Soil | VKLTALAAHTPHAVRAALAARGWEGQPAWFAAVGLRPLVV |
| Ga0209236_10462573 | 3300026298 | Grasslands Soil | VKLTPLAPHTPEAVRAALAARGWDTQPAWFAATGMQALVVLLEEITEAE |
| Ga0209468_11645661 | 3300026306 | Soil | VKLTALAAHTPEAVRAALAARGWETQPAWFAATGVQS |
| Ga0209153_10079195 | 3300026312 | Soil | VKLTPLAAHTPEAVRAALAARGWDAQPAWFAATGVQALVVLLEDVTEP |
| Ga0209470_11476272 | 3300026324 | Soil | VKVTALAAHTPDAVRAALAARGWDAQPAWFAATGVQTLVVLLDEITE |
| Ga0209470_12024172 | 3300026324 | Soil | VKLTALAAHTPEAVRAALAAHGWDAQPAWLAATGVQPLVVLLEEI |
| Ga0209470_13311461 | 3300026324 | Soil | VKLTPLAAHTPDSVRAALAARGWDAQPAWFAATGMQALV |
| Ga0209152_104842492 | 3300026325 | Soil | VKLTPLAAHTPEAVRAALAARGWDAQPASFAATGMQALVV |
| Ga0209266_10765081 | 3300026327 | Soil | VKVTALAAQTPEAVRAALAARGWEGQPAWFAAVGIQP |
| Ga0209804_11227932 | 3300026335 | Soil | VKLTPLAAHTPEAVRAALAARGWEAQPAWFAATGVQCLVVLLEDVT |
| Ga0209159_10019951 | 3300026343 | Soil | VKVTALAAHTPEAVRAALAARGWDAQPAWFAATGVQPLAVILEDLTGAE |
| Ga0209159_10577861 | 3300026343 | Soil | VKLTALAAHTPEAVRAALAARGWDPQPARFAAIGVQP |
| Ga0209376_10536591 | 3300026540 | Soil | VKATALAAHTPEAVRAALAARGWDAQPASFAATGMQPLVV |
| Ga0209376_13078111 | 3300026540 | Soil | MKVTALAAHTPEAVRAVLAARGWESQPAWFAATGIEPLVVLIEDITE |
| Ga0209106_10940982 | 3300027616 | Forest Soil | VKLTALAAHTPEAVRAALAARGWEAQPAWFAATGMQALVVLLEEVTEAE |
| Ga0209076_11942452 | 3300027643 | Vadose Zone Soil | VRITALAAHTPEAVRAALAARGWETQPAWFAAIGIQPFVVLIDDIS |
| Ga0209588_10003761 | 3300027671 | Vadose Zone Soil | MKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIEPLV |
| Ga0209283_105713071 | 3300027875 | Vadose Zone Soil | VKLTALAAHTPEAVRAALAAHGWDAQPAWLAATGVQPL |
| Ga0209488_106327702 | 3300027903 | Vadose Zone Soil | VKVTALAAHTPEAVRAALAARGWEAQPAGFAAIGIQPFVVLI |
| Ga0209382_103495671 | 3300027909 | Populus Rhizosphere | VKITALAAHTPEAVRAALAARGWETQPAWFAATGIQPLVILI |
| Ga0209382_109049002 | 3300027909 | Populus Rhizosphere | VKVTALAAHTPEAVRAALAARGWEAQPAWFAATGIQSIVVLFEDIT |
| Ga0209382_119935542 | 3300027909 | Populus Rhizosphere | VRVTALAAPTTPPEAVRAALAARGWEAQPAWFAATGVQSLVVLLEEITEDE |
| Ga0137415_104549881 | 3300028536 | Vadose Zone Soil | LKVTALGAHTPEAVRAALAARGWEAQPAWFAAVGIQPFVVLI |
| Ga0137415_111645621 | 3300028536 | Vadose Zone Soil | VKVTALAAHTSQPEAVRAALAARGWEAQPAWFAATGIQALVVLIEA |
| Ga0137415_113834632 | 3300028536 | Vadose Zone Soil | VKLTLLASHTPEAVRAALTARGWDAQPAWFAATGVQPL |
| Ga0307482_10219111 | 3300030730 | Hardwood Forest Soil | VKLTALAAHTPEAVRAVLVAHGWDDERATLAALGLQTVP |
| Ga0307469_104251271 | 3300031720 | Hardwood Forest Soil | VKVTALAAQTPEAVRAALAARGWEGQPAWFAATGIQPFVVLIEDITE |
| Ga0307469_106562111 | 3300031720 | Hardwood Forest Soil | VKLTALAAHTPEAVRAALAARGWEPQPAWLAATGV |
| Ga0307473_104289012 | 3300031820 | Hardwood Forest Soil | VKLTALAVHTPEAVRAALAARGWDTQPAWFAATGMQALVVLL |
| Ga0364928_0184497_2_124 | 3300033813 | Sediment | VRLTALAAHTPEAVRAALAACGWDDAPARLAALGVQPLTLL |
| Ga0364932_0035147_1774_1881 | 3300034177 | Sediment | MKVTALATHTSPPEAVRAALAARGWEAQPAWFAAAG |
| ⦗Top⦘ |