


| Basic Information | |
|---|---|
| Family ID | F061608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.37 % |
| % of genes from short scaffolds (< 2000 bps) | 85.50 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.916 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.695 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 16.90% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF13223 | DUF4031 | 27.48 |
| PF00135 | COesterase | 3.05 |
| PF14247 | DUF4344 | 2.29 |
| PF07859 | Abhydrolase_3 | 1.53 |
| PF12168 | DNA_pol3_tau_4 | 0.76 |
| PF00550 | PP-binding | 0.76 |
| PF03401 | TctC | 0.76 |
| PF05711 | TylF | 0.76 |
| PF03721 | UDPG_MGDP_dh_N | 0.76 |
| PF07238 | PilZ | 0.76 |
| PF01812 | 5-FTHF_cyc-lig | 0.76 |
| PF06627 | DUF1153 | 0.76 |
| PF06147 | DUF968 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 3.05 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.53 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.76 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.76 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.76 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.92 % |
| Unclassified | root | N/A | 19.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2084038016|SPCE_L_FSFSAB201A7FLO | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig808265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 2170459002|F0B48LX02J0RI1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1064349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300000956|JGI10216J12902_121076210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300005186|Ga0066676_10042377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2546 | Open in IMG/M |
| 3300005332|Ga0066388_107143499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300005332|Ga0066388_108172169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300005436|Ga0070713_100572999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1070 | Open in IMG/M |
| 3300005467|Ga0070706_101783956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300005558|Ga0066698_10181639 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300005559|Ga0066700_10382292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 993 | Open in IMG/M |
| 3300005713|Ga0066905_100233425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1401 | Open in IMG/M |
| 3300005713|Ga0066905_100662012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300005764|Ga0066903_100614488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1888 | Open in IMG/M |
| 3300005764|Ga0066903_105453506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005764|Ga0066903_105768285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300005764|Ga0066903_105817530 | Not Available | 647 | Open in IMG/M |
| 3300006854|Ga0075425_102013952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300009012|Ga0066710_101805057 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300009090|Ga0099827_11487354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300009143|Ga0099792_10815660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300010036|Ga0126305_10839268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300010043|Ga0126380_10634845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300010043|Ga0126380_11768334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300010047|Ga0126382_11834193 | Not Available | 571 | Open in IMG/M |
| 3300010047|Ga0126382_12159554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010048|Ga0126373_12370594 | Not Available | 591 | Open in IMG/M |
| 3300010147|Ga0126319_1285620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 597 | Open in IMG/M |
| 3300010303|Ga0134082_10517718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300010333|Ga0134080_10126714 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300010360|Ga0126372_10338938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1342 | Open in IMG/M |
| 3300010360|Ga0126372_12264127 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010360|Ga0126372_12331630 | Not Available | 585 | Open in IMG/M |
| 3300010366|Ga0126379_13854321 | Not Available | 502 | Open in IMG/M |
| 3300010376|Ga0126381_101141132 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300010376|Ga0126381_103293479 | Not Available | 637 | Open in IMG/M |
| 3300011271|Ga0137393_11441004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300012200|Ga0137382_11195923 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012202|Ga0137363_11416583 | Not Available | 585 | Open in IMG/M |
| 3300012205|Ga0137362_11787427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300012210|Ga0137378_11030620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300012361|Ga0137360_11373250 | Not Available | 609 | Open in IMG/M |
| 3300012469|Ga0150984_112938066 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300012924|Ga0137413_10791099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300012948|Ga0126375_10882204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300012960|Ga0164301_11031082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300012985|Ga0164308_10547871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300012989|Ga0164305_10921112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300015373|Ga0132257_104398449 | Not Available | 513 | Open in IMG/M |
| 3300016294|Ga0182041_10177156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1675 | Open in IMG/M |
| 3300016319|Ga0182033_10837733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 812 | Open in IMG/M |
| 3300016341|Ga0182035_10220177 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300016341|Ga0182035_10436079 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300016357|Ga0182032_11163538 | Not Available | 663 | Open in IMG/M |
| 3300016371|Ga0182034_10153373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1734 | Open in IMG/M |
| 3300016371|Ga0182034_10483793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1030 | Open in IMG/M |
| 3300016371|Ga0182034_10503664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
| 3300016387|Ga0182040_10891931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 737 | Open in IMG/M |
| 3300016387|Ga0182040_11448115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300016404|Ga0182037_11559424 | Not Available | 587 | Open in IMG/M |
| 3300016422|Ga0182039_10285284 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300016422|Ga0182039_11302360 | Not Available | 658 | Open in IMG/M |
| 3300018054|Ga0184621_10301231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300019867|Ga0193704_1049509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300019878|Ga0193715_1100539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300020579|Ga0210407_10461909 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021178|Ga0210408_10698870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300021432|Ga0210384_10895695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300021560|Ga0126371_11117468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 927 | Open in IMG/M |
| 3300025915|Ga0207693_10217667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1500 | Open in IMG/M |
| 3300025916|Ga0207663_10175391 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300025916|Ga0207663_10414885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300025928|Ga0207700_11985583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300025929|Ga0207664_11711490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300026310|Ga0209239_1206610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300026499|Ga0257181_1086900 | Not Available | 545 | Open in IMG/M |
| 3300026538|Ga0209056_10025413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5696 | Open in IMG/M |
| 3300026557|Ga0179587_10554241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300027502|Ga0209622_1112013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300027681|Ga0208991_1052842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1227 | Open in IMG/M |
| 3300027909|Ga0209382_12295386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis | 507 | Open in IMG/M |
| 3300028047|Ga0209526_10774095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300028536|Ga0137415_11098505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300028793|Ga0307299_10183804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300028793|Ga0307299_10212698 | Not Available | 727 | Open in IMG/M |
| 3300028796|Ga0307287_10039851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300031469|Ga0170819_12066053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300031545|Ga0318541_10089521 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300031572|Ga0318515_10282172 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300031679|Ga0318561_10027180 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300031679|Ga0318561_10032242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2537 | Open in IMG/M |
| 3300031679|Ga0318561_10174513 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300031744|Ga0306918_10068676 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300031748|Ga0318492_10535585 | Not Available | 622 | Open in IMG/M |
| 3300031763|Ga0318537_10148290 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031765|Ga0318554_10051687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2251 | Open in IMG/M |
| 3300031768|Ga0318509_10480659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300031777|Ga0318543_10064513 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300031819|Ga0318568_10055402 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300031831|Ga0318564_10128235 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300031845|Ga0318511_10268140 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031859|Ga0318527_10315742 | Not Available | 665 | Open in IMG/M |
| 3300031880|Ga0318544_10025085 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300031890|Ga0306925_10128021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2721 | Open in IMG/M |
| 3300031893|Ga0318536_10028536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2595 | Open in IMG/M |
| 3300031893|Ga0318536_10692695 | Not Available | 508 | Open in IMG/M |
| 3300031894|Ga0318522_10391886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300031896|Ga0318551_10735573 | Not Available | 572 | Open in IMG/M |
| 3300031910|Ga0306923_10213996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2204 | Open in IMG/M |
| 3300031912|Ga0306921_10188428 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300031942|Ga0310916_10116859 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300031945|Ga0310913_10107232 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300031946|Ga0310910_10272847 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300031947|Ga0310909_10657211 | Not Available | 873 | Open in IMG/M |
| 3300031954|Ga0306926_10909904 | Not Available | 1053 | Open in IMG/M |
| 3300032001|Ga0306922_11110000 | Not Available | 810 | Open in IMG/M |
| 3300032010|Ga0318569_10298019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300032010|Ga0318569_10381403 | Not Available | 657 | Open in IMG/M |
| 3300032043|Ga0318556_10029493 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300032055|Ga0318575_10000697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8803 | Open in IMG/M |
| 3300032066|Ga0318514_10236030 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300032090|Ga0318518_10683754 | Not Available | 522 | Open in IMG/M |
| 3300032091|Ga0318577_10117284 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300032174|Ga0307470_10737098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300032180|Ga0307471_102112696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300032261|Ga0306920_100291899 | All Organisms → cellular organisms → Bacteria | 2429 | Open in IMG/M |
| 3300032261|Ga0306920_102542160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300033289|Ga0310914_10115716 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.53% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2084038016 | Soil microbial communities from Hopland, California, USA, that is PCE polluted - amended with lactate | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SPCE_L_00120950 | 2084038016 | Soil | RILTTYAINPGGSFVFDSDSKATFRPQRQGVAVKVVLACVQR |
| KansclcFeb2_02783900 | 2124908045 | Soil | AINPGGTFVFEEDNRATFRPQRQGVAVKVVVACAPK |
| E1_08537220 | 2170459002 | Grass Soil | MACEENERILNAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| AP72_2010_repI_A100DRAFT_10643491 | 3300000837 | Forest Soil | HAINPGGTFVFEDEGRATFRPSRQGVAVKVVVACAPK* |
| JGI10216J12902_1210762102 | 3300000956 | Soil | DGECRQACTVACEANERILSTHALTPGGTFVFEEDNRATFRPQRQGVAIKVMVACVPK* |
| Ga0066676_100423775 | 3300005186 | Soil | VACEANERILNSYAINPGGTFVFEEENRATFRPQRQGVTVKVMLACASK* |
| Ga0066388_1071434991 | 3300005332 | Tropical Forest Soil | CEANERILSTHAINPGGTFVFEDEGRATFRPSRQGVAVKVVVACAPK* |
| Ga0066388_1081721692 | 3300005332 | Tropical Forest Soil | CTVACEANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACVPK* |
| Ga0070713_1005729991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | CTVACEANERILNMFAIGAGGTFIFEEEARATFLPQRQGAAAKVVLACARK* |
| Ga0070706_1017839561 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0066698_101816394 | 3300005558 | Soil | RILNTYAINPGGTFVFEEDNRATFRPQRQGVTVKVMLACASK* |
| Ga0066700_103822923 | 3300005559 | Soil | LSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0066905_1002334255 | 3300005713 | Tropical Forest Soil | NTYALGAGGTFVFEDENKATFRPQRRGAAVKVVIACVPK* |
| Ga0066905_1006620121 | 3300005713 | Tropical Forest Soil | QACTVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0066903_1006144883 | 3300005764 | Tropical Forest Soil | MSPEEFIRFVDGQCGQPCTVACEANERILDTYAINPGGTFVFEDENRTTFRPEQQSVAVKVGVASVRK* |
| Ga0066903_1054535061 | 3300005764 | Tropical Forest Soil | CEDNERILNTLAINPGGTFIFDADNKVTFRPQRQGASTKVVLACVPRG* |
| Ga0066903_1057682852 | 3300005764 | Tropical Forest Soil | ILSTHALNPGGTFVFEEDNRATFRPQRQGVAIKVMVACIPK* |
| Ga0066903_1057932111 | 3300005764 | Tropical Forest Soil | ECRQACTIACEDNERILNSFAINPGGTFVFDADNKATFRPQRQGVSAKVILACVPRG* |
| Ga0066903_1058175303 | 3300005764 | Tropical Forest Soil | HAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACVPK* |
| Ga0075425_1020139521 | 3300006854 | Populus Rhizosphere | CEANERILSTHALNPGGTFIFEEDNRATFRPQRQGVAIKVMVACVPK* |
| Ga0066710_1018050571 | 3300009012 | Grasslands Soil | EDERILSSHAINPGGTFTFDADNSKATFRPQRQGVLIRVVLACVKK |
| Ga0099827_114873541 | 3300009090 | Vadose Zone Soil | APCVVACEGDERILSTYALNPGGSFMFEADNRATFRPQQQGVSTKVVLACVPR* |
| Ga0099792_108156602 | 3300009143 | Vadose Zone Soil | VACEENERILSTYAISPGGTFNFEADNKTTFRPQRQGVSVKVVLACVQK* |
| Ga0126305_108392681 | 3300010036 | Serpentine Soil | NPGGTFVFEDVNKATFRPQRRGGPAGPAVKVVIACVSK* |
| Ga0126380_106348451 | 3300010043 | Tropical Forest Soil | CRQACTVACEANERILSTHAINPGGTFFFEDEGRATFRPQRQGVAVKVVVACTPK* |
| Ga0126380_117683341 | 3300010043 | Tropical Forest Soil | NERILSTHAINPGGTFVFEEDNRATFRPTRQGAAVKVMVACVPK* |
| Ga0126382_118341931 | 3300010047 | Tropical Forest Soil | ACEANERILSTHAINPGGTFVFEDEARATFRPSRQGVAVKVVVACAPK* |
| Ga0126382_121595542 | 3300010047 | Tropical Forest Soil | LNPGGTFVFEEDNRATFRPQRQGVAIKVMVACVPK* |
| Ga0126373_123705941 | 3300010048 | Tropical Forest Soil | NPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK* |
| Ga0126319_12856201 | 3300010147 | Soil | MACEENERILNAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK* |
| Ga0134082_105177181 | 3300010303 | Grasslands Soil | DNERILSFYAINPGGTFSFDADSRKATFRPQRQGVSVKVILACAQN* |
| Ga0134080_101267141 | 3300010333 | Grasslands Soil | INPGGTFVFEEENRATFRPQRQGVTVKVMLACASK* |
| Ga0126372_103389381 | 3300010360 | Tropical Forest Soil | NPGGTFVFEDEARATFRPSRQGVAVKVVVACAPK* |
| Ga0126372_122641272 | 3300010360 | Tropical Forest Soil | VACEANERILTTHALNPGGTFVFEEDNRATFRPQRQGTTVKIVVACVPR* |
| Ga0126372_123316301 | 3300010360 | Tropical Forest Soil | NPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0126379_138543211 | 3300010366 | Tropical Forest Soil | KENECILSSYAINPGGAFTFDADNRKATFRPQLQGALVKVVEK* |
| Ga0126381_1011411323 | 3300010376 | Tropical Forest Soil | LSTHALNPGGTFVFEEDNRATFRPQRQGVAIKVMVACVPK* |
| Ga0126381_1032934791 | 3300010376 | Tropical Forest Soil | ERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVVCAPK* |
| Ga0137393_114410042 | 3300011271 | Vadose Zone Soil | ACADNERILSAYAITPGGTFIYEADNRATFRPQRPGVAVKVILACIPK* |
| Ga0137382_111959231 | 3300012200 | Vadose Zone Soil | ACEENELLLTTYAINPGGSFVFDSDSKATFQPQRQGVAVKVVLACVQR* |
| Ga0137363_114165832 | 3300012202 | Vadose Zone Soil | ACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0137362_117874271 | 3300012205 | Vadose Zone Soil | RILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACTPK* |
| Ga0137378_110306203 | 3300012210 | Vadose Zone Soil | NPGGTFVFEEENRVTFRPQRQGVAVKVVVACAPK* |
| Ga0137360_113732501 | 3300012361 | Vadose Zone Soil | CRQACTVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0150984_1129380663 | 3300012469 | Avena Fatua Rhizosphere | PGGSFVFDADNKATFRPQRQGVSVKVVLACAPKG* |
| Ga0137413_107910991 | 3300012924 | Vadose Zone Soil | LVDGECSKACVVACEDNERILSTYAINPGGTFTIESETRAIFRPQQQGVAVKVVLTCIPR |
| Ga0126375_108822042 | 3300012948 | Tropical Forest Soil | LSTHAINPGGTFVFEDEARATFRPSRQGVAVKVVVACAPK* |
| Ga0164301_110310822 | 3300012960 | Soil | MACEENERILNAYAINPGGAFTFDAENKATFRPSRQGVAVKVVLACVQK* |
| Ga0164308_105478712 | 3300012985 | Soil | MITTYAINPGGSFVFDADNKATFRPQRQGVLVKVVLACAPKG* |
| Ga0164305_109211121 | 3300012989 | Soil | ILSTYAINPGGSFVFDADNKATFRPQRQGVSVKVVLACAPKG* |
| Ga0132257_1043984491 | 3300015373 | Arabidopsis Rhizosphere | RILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK* |
| Ga0182041_101771561 | 3300016294 | Soil | RILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0182033_108377331 | 3300016319 | Soil | CRQACTVACEANERILTTHAINPGGTFVFEDESRSTFRPQRQGVAVKVVVACAPK |
| Ga0182035_102201771 | 3300016341 | Soil | QACTVACEANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0182035_104360791 | 3300016341 | Soil | RILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVVCAPK |
| Ga0182032_111635381 | 3300016357 | Soil | HAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0182034_101533731 | 3300016371 | Soil | ERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACVPK |
| Ga0182034_104837931 | 3300016371 | Soil | ERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0182034_105036643 | 3300016371 | Soil | CEANERILTTHAINPGGTFVFEDESRSTFRPQRQGVAVKVVVACAPK |
| Ga0182040_108919311 | 3300016387 | Soil | LSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0182040_114481151 | 3300016387 | Soil | VDGECRQACTVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0182037_115594242 | 3300016404 | Soil | CEANERILTTYAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0182039_102852841 | 3300016422 | Soil | HAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0182039_113023602 | 3300016422 | Soil | DGECRQACTVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0184621_103012311 | 3300018054 | Groundwater Sediment | SYAINPGGSFVFDSENKATFRPQRQGVAVKVVLACAPKG |
| Ga0193704_10495092 | 3300019867 | Soil | AYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| Ga0193715_11005391 | 3300019878 | Soil | NAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| Ga0210407_104619093 | 3300020579 | Soil | GECRQACTVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0210408_106988703 | 3300021178 | Soil | TVACEANERILSTHALNPGGTFVFEEDNRATFRPQRQGVAIKVMVACIPK |
| Ga0210384_108956951 | 3300021432 | Soil | GEANERILSTHALNPGGTFVFEEDNRATFRPQRQGVAIKVMVACIPK |
| Ga0126371_111174682 | 3300021560 | Tropical Forest Soil | MSPEEFIRFVDGQCGQPCTVACEANERILDTYAINPGGTFVFEDENRTTFRPEQQSVAVKVGVASVPK |
| Ga0207693_102176671 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | CTVACEANERILNMFAIGAGGTFIFEEEARATFLPQRQGAAAKVVLACARK |
| Ga0207663_101753915 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LNPGGTFIFEEDNRATFRPQRQGVAIKVMVACVPK |
| Ga0207663_104148852 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ECRQTCTVACEANERILNMFAIGAGGTFIFEEEARATFLPQRQGAAAKVVLACARK |
| Ga0207700_119855831 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GECRQTCTVACEANERILNMFAIGAGGTFIFEEEARATFLPQRQGAAAKVVLACARK |
| Ga0207664_117114901 | 3300025929 | Agricultural Soil | VDGECRQACTVSCEANERILSTHALNPGGTFIFEEDNRATFRPQRQGVAIKVMVACVPK |
| Ga0209239_12066103 | 3300026310 | Grasslands Soil | ACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0257181_10869002 | 3300026499 | Soil | CEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACTPK |
| Ga0209056_100254138 | 3300026538 | Soil | NSYAINPGGTFVFEEENRATFRPQRQGVTVKVMLACASK |
| Ga0179587_105542413 | 3300026557 | Vadose Zone Soil | IMACEENERILNAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| Ga0209622_11120131 | 3300027502 | Forest Soil | TYAINPGGTFVFEEDNRATFRPQRQGVTVKVMLACASK |
| Ga0208991_10528424 | 3300027681 | Forest Soil | AINPGASFSFDADNKATFRPQRQGVSIKVVLASGQK |
| Ga0209382_109789481 | 3300027909 | Populus Rhizosphere | TYAINPGGTFIFDADNKATFRPQRQGASVKVVLACVQK |
| Ga0209382_122953862 | 3300027909 | Populus Rhizosphere | RQACALSCEDDERILSAYAITPGGTITFEAEQKATFRPQRQGISVKVILACAQK |
| Ga0209526_107740951 | 3300028047 | Forest Soil | TCDANERIFNTFALTPGGTFVLEEYNRATFRPARQGVSVKVSVACAKS |
| Ga0137415_110985052 | 3300028536 | Vadose Zone Soil | CTVACEANERILSTHALNPGGTFVFEEDNRATFRPQRQGVAIKVMVACIPK |
| Ga0307299_101838041 | 3300028793 | Soil | TMNASYAINPGGSFVFDSENKATFRPQRQGVAVKVVLACAPKG |
| Ga0307299_102126981 | 3300028793 | Soil | TCEDNERILSTYAINPGGSFVFDADNKATFRPQRQGVSVKVVLACAPKG |
| Ga0307287_100398512 | 3300028796 | Soil | LRENERILNAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| Ga0170819_120660531 | 3300031469 | Forest Soil | LNAYAINPGGAFTFDAENKATFRPPRQGVAVKVVLACVQK |
| Ga0318541_100895215 | 3300031545 | Soil | GTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318515_102821723 | 3300031572 | Soil | ILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318561_100271801 | 3300031679 | Soil | ANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318561_100322421 | 3300031679 | Soil | ALNPGGTFVFEEDNRATFRPQRQGTTVKIVVACVPR |
| Ga0318561_101745133 | 3300031679 | Soil | ANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACVPK |
| Ga0306918_100686766 | 3300031744 | Soil | STHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0318492_105355851 | 3300031748 | Soil | ACEANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACVPK |
| Ga0318537_101482903 | 3300031763 | Soil | ANERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318554_100516876 | 3300031765 | Soil | LTTHALNPGGTFVFEEDNRATFRPQRQGTTVKIVVACVPR |
| Ga0318509_104806593 | 3300031768 | Soil | ANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0318543_100645131 | 3300031777 | Soil | STHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318568_100554021 | 3300031819 | Soil | ACTVACEANERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0318564_101282353 | 3300031831 | Soil | VACEANERILTTHAINPGGTFVFEDESRATFRPQRQGVAVKVVVACAPK |
| Ga0318511_102681401 | 3300031845 | Soil | HALNPGGTFVFEEDNRATFRPQRQGTTVKIVVACVPR |
| Ga0318527_103157421 | 3300031859 | Soil | VNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0318544_100250856 | 3300031880 | Soil | NERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0306925_101280211 | 3300031890 | Soil | LGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318536_100285366 | 3300031893 | Soil | ACTVACEANERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318536_106926951 | 3300031893 | Soil | HAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0318522_103918861 | 3300031894 | Soil | TVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVVCAPK |
| Ga0318551_107355731 | 3300031896 | Soil | LSIYALNPGGTVVYDSDNRATFRPSRADVTAKVMLACIPK |
| Ga0306923_102139963 | 3300031910 | Soil | MHGGVDNERILSLYAINPGGTFVYNSDSSAAFRSARVNVAVKVMLACIPK |
| Ga0306921_101884286 | 3300031912 | Soil | VNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0310916_101168591 | 3300031942 | Soil | CTVACEANERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0310913_101072326 | 3300031945 | Soil | ILTTHAINPGGTFVFEDESRATFRPQRQGVAVKVVVACAPK |
| Ga0310910_102728474 | 3300031946 | Soil | AVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0310909_106572111 | 3300031947 | Soil | ALNPGGTVVYDSDNRATFRPSRADVTAKVMLACIPK |
| Ga0306926_109099041 | 3300031954 | Soil | SIYALNPGGTVVYDSDNRATFRPSRADVTAKVMLACIPK |
| Ga0306922_111100002 | 3300032001 | Soil | YALNPGGTVVYDSDNRATFRPSRADVTAKVMLACIPK |
| Ga0318569_102980191 | 3300032010 | Soil | NERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0318569_103814032 | 3300032010 | Soil | INPGGTFVFEDEGRATFRPSRQGVAVKVVVACAPK |
| Ga0318556_100294936 | 3300032043 | Soil | ACTVACEANERILTTHAINPGGTFVFEDESRATFRPQRQGVAVKVVVACAPK |
| Ga0318575_100006971 | 3300032055 | Soil | ILTTHAINPGGTFVFEDESRSTFRPQRQGVAVKVVVACAPK |
| Ga0318514_102360303 | 3300032066 | Soil | INPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0318518_106837541 | 3300032090 | Soil | RILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0318577_101172841 | 3300032091 | Soil | TVACEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0307470_107370981 | 3300032174 | Hardwood Forest Soil | TVSCEANERILSTHALNPGGTFIFEEDNRATFRPQRQGVAIKVMVACVPK |
| Ga0307471_1021126963 | 3300032180 | Hardwood Forest Soil | CEANERILSTHAINPGGTFVFEDEGRATFRPQRQGVAVKVVVACAPK |
| Ga0306920_1002918996 | 3300032261 | Soil | STLAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAAK |
| Ga0306920_1025421601 | 3300032261 | Soil | CEANERILSTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| Ga0310914_101157166 | 3300033289 | Soil | TVACEANERILGTHAVNPGGTFVFEEDGRATFRPQRQGVAVKVVVACAPK |
| ⦗Top⦘ |