


| Basic Information | |
|---|---|
| Family ID | F061372 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FNLQHALKTYQDAIRQRRIEEWHKNNKKLRNEPDLGDLVNIE |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.73 % |
| % of genes from short scaffolds (< 2000 bps) | 89.39 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.061 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.212 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF07733 | DNA_pol3_alpha | 12.88 |
| PF00166 | Cpn10 | 3.79 |
| PF02195 | ParBc | 3.03 |
| PF00004 | AAA | 0.76 |
| PF02915 | Rubrerythrin | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 12.88 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 12.88 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 3.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.24 % |
| Unclassified | root | N/A | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001419|JGI11705J14877_10002050 | All Organisms → cellular organisms → Bacteria | 11100 | Open in IMG/M |
| 3300001589|JGI24005J15628_10009467 | All Organisms → Viruses → Predicted Viral | 4530 | Open in IMG/M |
| 3300001936|GOS2220_1019444 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300001942|GOS2262_1020253 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
| 3300002483|JGI25132J35274_1075378 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300004461|Ga0066223_1048424 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005605|Ga0066850_10300125 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006637|Ga0075461_10119206 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006752|Ga0098048_1163391 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006868|Ga0075481_10356076 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006916|Ga0070750_10076901 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300007539|Ga0099849_1176492 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300007542|Ga0099846_1159762 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300007756|Ga0105664_1160219 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300007864|Ga0105749_1047037 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300007960|Ga0099850_1290304 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300007963|Ga0110931_1080541 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300008012|Ga0075480_10498095 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009027|Ga0102957_1356770 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009173|Ga0114996_10522887 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009173|Ga0114996_10795185 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009437|Ga0115556_1174850 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009438|Ga0115559_1174025 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300009438|Ga0115559_1184356 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300009447|Ga0115560_1401644 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009472|Ga0115554_1105381 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300009497|Ga0115569_10129774 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300009498|Ga0115568_10026999 | All Organisms → Viruses → Predicted Viral | 3217 | Open in IMG/M |
| 3300009703|Ga0114933_10449566 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300009786|Ga0114999_10453660 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300010296|Ga0129348_1174541 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010297|Ga0129345_1271922 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010316|Ga0136655_1028392 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300010318|Ga0136656_1230457 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010368|Ga0129324_10068209 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300010883|Ga0133547_10888326 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300012928|Ga0163110_10095297 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300012936|Ga0163109_10828374 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300016747|Ga0182078_10113303 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300016762|Ga0182084_1541548 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300016797|Ga0182090_1207176 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300017714|Ga0181412_1033130 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300017714|Ga0181412_1091403 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300017724|Ga0181388_1108629 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300017724|Ga0181388_1109264 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300017725|Ga0181398_1040921 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300017726|Ga0181381_1066540 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300017727|Ga0181401_1045243 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300017746|Ga0181389_1047962 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300017751|Ga0187219_1054459 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300017757|Ga0181420_1102902 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300017783|Ga0181379_1329425 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017952|Ga0181583_10043259 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300017952|Ga0181583_10370145 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300017956|Ga0181580_10793499 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017991|Ga0180434_10853264 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300018039|Ga0181579_10687380 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018417|Ga0181558_10382550 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300018418|Ga0181567_10349608 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300018426|Ga0181566_11034447 | Not Available | 552 | Open in IMG/M |
| 3300020207|Ga0181570_10340372 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300020297|Ga0211490_1044095 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300020374|Ga0211477_10008567 | All Organisms → cellular organisms → Bacteria | 5187 | Open in IMG/M |
| 3300020381|Ga0211476_10297896 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300020388|Ga0211678_10305126 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300020389|Ga0211680_10168011 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300020397|Ga0211583_10076050 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300020410|Ga0211699_10245033 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300020410|Ga0211699_10410750 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300020413|Ga0211516_10431127 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300020419|Ga0211512_10477393 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300020430|Ga0211622_10502373 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300020443|Ga0211544_10242860 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300020446|Ga0211574_10333429 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300020451|Ga0211473_10463105 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300020451|Ga0211473_10590877 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300020461|Ga0211535_10370741 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300020463|Ga0211676_10051635 | All Organisms → Viruses → Predicted Viral | 2912 | Open in IMG/M |
| 3300020465|Ga0211640_10141625 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
| 3300020469|Ga0211577_10506909 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300021442|Ga0206685_10083143 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300021791|Ga0226832_10318195 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021957|Ga0222717_10675400 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300021958|Ga0222718_10186289 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300021958|Ga0222718_10457074 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021964|Ga0222719_10085416 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300022935|Ga0255780_10080149 | All Organisms → Viruses → Predicted Viral | 1987 | Open in IMG/M |
| 3300022935|Ga0255780_10423070 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300023081|Ga0255764_10029756 | All Organisms → Viruses → Predicted Viral | 3580 | Open in IMG/M |
| 3300023116|Ga0255751_10018008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5541 | Open in IMG/M |
| 3300023178|Ga0255759_10634263 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300023231|Ga0222689_1031099 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300024428|Ga0233396_1135570 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025082|Ga0208156_1022109 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300025138|Ga0209634_1123078 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300025601|Ga0208768_1021693 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
| 3300025626|Ga0209716_1021027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2621 | Open in IMG/M |
| 3300025653|Ga0208428_1084525 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300025810|Ga0208543_1159232 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025818|Ga0208542_1206556 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025881|Ga0209309_10031765 | All Organisms → Viruses → Predicted Viral | 3377 | Open in IMG/M |
| 3300025886|Ga0209632_10021381 | All Organisms → Viruses → Predicted Viral | 4677 | Open in IMG/M |
| 3300025892|Ga0209630_10250560 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300026080|Ga0207963_1100488 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026183|Ga0209932_1059647 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300026189|Ga0208405_1021847 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300026204|Ga0208521_1122124 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300026261|Ga0208524_1008355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3671 | Open in IMG/M |
| 3300026267|Ga0208278_1111768 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027687|Ga0209710_1120165 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300027704|Ga0209816_1215795 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300027830|Ga0209359_10193656 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300027847|Ga0209402_10409705 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300027906|Ga0209404_10432506 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300028190|Ga0257108_1124698 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300028190|Ga0257108_1151213 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300028194|Ga0257106_1261329 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031594|Ga0302131_1020275 | All Organisms → Viruses → Predicted Viral | 2788 | Open in IMG/M |
| 3300031594|Ga0302131_1211799 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031605|Ga0302132_10543460 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031606|Ga0302119_10216174 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031627|Ga0302118_10225930 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031638|Ga0302125_10238968 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031655|Ga0308018_10090273 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300031676|Ga0302136_1076098 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300031757|Ga0315328_10709480 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031766|Ga0315322_10353357 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031800|Ga0310122_10373285 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031886|Ga0315318_10447421 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032011|Ga0315316_10502055 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300032130|Ga0315333_10373333 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032360|Ga0315334_10319121 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.15% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 12.12% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.33% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.58% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.82% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.30% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.03% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.03% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.52% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.52% |
| Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.76% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.76% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.76% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.76% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.76% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.76% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.76% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.76% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001936 | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 | Environmental | Open in IMG/M |
| 3300001942 | Marine microbial communities from Polynesia - GS047 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020443 | Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023231 | Saline water microbial communities from Ace Lake, Antarctica - #1231 | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025601 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026080 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300026204 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026261 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
| 3300031676 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11705J14877_100020501 | 3300001419 | Saline Water And Sediment | ARRGRNPEMLATLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDLGDLINME* |
| JGI24005J15628_1000946710 | 3300001589 | Marine | LMTYQNAVRERRIEAWHKNNKKARGEPDLGDLVNIE* |
| GOS2220_10194442 | 3300001936 | Marine | HTAHALMTYQNAVRERRIESWHKNNKKMRNEPDLGDLVNIE* |
| GOS2262_10202533 | 3300001942 | Marine | MWHTQHALLTYQNAIRERRIEAWHKNNKKLRNEPDLGDLVNIE* |
| JGI25132J35274_10753781 | 3300002483 | Marine | NPELLANLQQALLTYQDAIRQRRIESWHENRKKLRNEPDLGDLINIE* |
| Ga0066223_10484241 | 3300004461 | Marine | PDMLAQLQHALMTYQNAVRERRLEAWHKNNKKVRGEPDLGDLVNID* |
| Ga0066850_103001251 | 3300005605 | Marine | LATYQDAIRQRRLEQWHKDYKKARGEPDLGDLINIE* |
| Ga0075461_101192062 | 3300006637 | Aqueous | IARRGRNPEMLANLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0098048_11633911 | 3300006752 | Marine | ARRGRNPDMLAQLTKALMTYQDAIRQRRLEQWHKDIKKARNEPDHGDLINID* |
| Ga0075481_103560762 | 3300006868 | Aqueous | QMALNTYRNAIRERRIEAWHKNNKKLRNEPDIGDLINID* |
| Ga0070750_100769011 | 3300006916 | Aqueous | RRGRNPEMLANLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0099849_11764921 | 3300007539 | Aqueous | NLQMALNTYRNAIRERRIEAWHKNNKKLRNEPDIGDLINID* |
| Ga0099846_11597621 | 3300007542 | Aqueous | NLQLALNTYRDAIRQRRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0105664_11602193 | 3300007756 | Background Seawater | GTYQDAIRQRRLEQWHKDYKKARGEPDLGDLINIE* |
| Ga0105749_10470371 | 3300007864 | Estuary Water | LRTYQDAVRQKRIEEWHKNNKKLRGEPDLGDLVNID* |
| Ga0099850_12903041 | 3300007960 | Aqueous | RGRNPEMLMNLQHALQTYQNAIRERRIEEWHKNHKKLRNEPDLGDLINME* |
| Ga0110931_10805411 | 3300007963 | Marine | NTYRDAIRQRRIEEWHKNNKKLRNEPDLGDLVNID* |
| Ga0075480_104980951 | 3300008012 | Aqueous | TYQDAIRQRRIEEWHKNNKKLRNEPDLGDLVNID* |
| Ga0102957_13567701 | 3300009027 | Pond Water | MLANLQMALKTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0114996_105228873 | 3300009173 | Marine | ALMTYQNAIRERRLEQWHKNNKKMRNEPDLGDLVNID* |
| Ga0114996_107951852 | 3300009173 | Marine | NPEILAQLQHALATYQNAIRERRIEAWHKNNKKLRNEPDHGDLVNID* |
| Ga0115556_11748501 | 3300009437 | Pelagic Marine | AQLQHALATYQNAIRERRLEAWHENNKKLRDEPDLGDLVNID* |
| Ga0115559_11740251 | 3300009438 | Pelagic Marine | EMLAQLQHALATYQNAIRERRLEAWHENNKKLRDEPDLGDLVNID* |
| Ga0115559_11843561 | 3300009438 | Pelagic Marine | EMLAQLQHALTTYQNAIRERRLEEWHKNNKKLRNEPDLGDLVNID* |
| Ga0115560_14016442 | 3300009447 | Pelagic Marine | PEMLAQLQHALMTYQNAIRERRLEAWHENNKKLRDEPDLGDLVNID* |
| Ga0115554_11053811 | 3300009472 | Pelagic Marine | MLANLQHALRTYQDAVRQRRIEEWHKNNKKLRNEPDLGDLVNID* |
| Ga0115569_101297741 | 3300009497 | Pelagic Marine | HALMTYQNAVRERRIEAWHKNNKKIRNEPDLGDLVNIE* |
| Ga0115568_100269991 | 3300009498 | Pelagic Marine | MTYQNAVRERRIEAWHKNNKKIRNEPDLGDLVNIE* |
| Ga0114933_104495661 | 3300009703 | Deep Subsurface | ILNKLQEALGTYQNEIRNRRIEDWHKDRQKKTGEPDIGDLINIE* |
| Ga0114999_104536601 | 3300009786 | Marine | TYQNAIRERRIEAWHKNNKKLRNEPDLGDLVNME* |
| Ga0129348_11745412 | 3300010296 | Freshwater To Marine Saline Gradient | NTYRDAIRQRRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0129345_12719221 | 3300010297 | Freshwater To Marine Saline Gradient | TYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0136655_10283921 | 3300010316 | Freshwater To Marine Saline Gradient | LMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID* |
| Ga0136656_12304571 | 3300010318 | Freshwater To Marine Saline Gradient | MNLQHALQTYQNAIRERRIEEWHKNHKKLRNEPDLGDLINME* |
| Ga0129324_100682094 | 3300010368 | Freshwater To Marine Saline Gradient | QQALKTNQDAVRQRRIEEWHKNNKKLRNEPDLGDLVNID* |
| Ga0133547_108883264 | 3300010883 | Marine | TYQNAIRERRLEEWHKNNKKMRNEPDLGDLVNIE* |
| Ga0163110_100952975 | 3300012928 | Surface Seawater | ARRGRNPELLANLQQALLTYQDAIRQRRIESWHENRKKLRNEPDLGDLINIE* |
| Ga0163109_108283741 | 3300012936 | Surface Seawater | QHALATYRNAIRERRIEAWHKNNKKLRNEPDLGDLVNID* |
| Ga0182078_101133031 | 3300016747 | Salt Marsh | EMLMNIQHALQTYQNAIRERRIEEWHKNHKKLRNEPDLGDLINME |
| Ga0182084_15415482 | 3300016762 | Salt Marsh | LANLQQALMTYQNAIRERRLEEWHKNNKKLRNEPDIGDLINID |
| Ga0182090_12071763 | 3300016797 | Salt Marsh | EMLMNLQHALQTYQNAIRERRIEEWHKNNKKLRNEPDLGDLINME |
| Ga0181412_10331303 | 3300017714 | Seawater | LQNLQMALKTYQDAVRQRRIEEWHKNNKKLRGEPDLGDLVNID |
| Ga0181412_10914032 | 3300017714 | Seawater | LTKALMTYQDAIRQRRLEQWHKDIKKARNEPDLGDLINID |
| Ga0181388_11086292 | 3300017724 | Seawater | NPEMLANLQHVLNTYRNAIRERRIEEWHKNNKKLRGEPDIGELINID |
| Ga0181388_11092642 | 3300017724 | Seawater | FTYQDAIRQRRLEQWHKDVKKARNEPDLGDLINID |
| Ga0181398_10409211 | 3300017725 | Seawater | LMTYQDAIRQRRLEQWHKDIKKARNEPDLGDLINID |
| Ga0181381_10665401 | 3300017726 | Seawater | MLAQLTKALMTYQDAIRQRRLEQWHKDIKKARNEPDHGDLINID |
| Ga0181401_10452431 | 3300017727 | Seawater | HALMTYQNAVRERRIEAWHKNNKKIRNEPDLGDLVNID |
| Ga0181389_10479623 | 3300017746 | Seawater | LTKALMTYQDAIRQRRLEQWHKDIKKARNEPDHGDLINID |
| Ga0187219_10544593 | 3300017751 | Seawater | ATYRDAIRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0181420_11029023 | 3300017757 | Seawater | ARRGRNPEMLMNLQQALKTYQDAIRQKRIEEWHKNNKKLRGEPDIGELINID |
| Ga0181379_13294251 | 3300017783 | Seawater | DMLAQLTKALMTYQDAIRQRRLEQWHKDIKKARNEPDHGDLINID |
| Ga0181583_100432591 | 3300017952 | Salt Marsh | GRNPEMLANLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0181583_103701451 | 3300017952 | Salt Marsh | NPEMLANLQMALKTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0181580_107934991 | 3300017956 | Salt Marsh | NTYRDAIRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0180434_108532641 | 3300017991 | Hypersaline Lake Sediment | RRGRNPEMLMNLQQALQAYQNAIRERRIEEWHKNNKKLRNEPDLGDLINID |
| Ga0181579_106873802 | 3300018039 | Salt Marsh | EMLATLQMALKTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINME |
| Ga0181558_103825501 | 3300018417 | Salt Marsh | ALNTYREAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0181567_103496081 | 3300018418 | Salt Marsh | ELLFNLQQALRTYQDAIRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0181566_110344472 | 3300018426 | Salt Marsh | MLANLQKALLTYQDAIRQRRIESWHENRKKLRNEPDLGDLINME |
| Ga0181570_103403722 | 3300020207 | Salt Marsh | ATYRNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0211490_10440951 | 3300020297 | Marine | QKALFTYQDAIRQRRIEKWHKDIKKARGEPDLGDLINID |
| Ga0211477_1000856710 | 3300020374 | Marine | RNPEMLARLQQALQTYQDAIRQRRVEDWHKNYKKTRNEPDLGDLINME |
| Ga0211476_102978961 | 3300020381 | Marine | ALKTYQDAIRQRRIEEWHKNNKKVRNEPDIGDLINID |
| Ga0211678_103051262 | 3300020388 | Marine | THALNTYRNAIRERRIEAWHKNNKKIRGEPDLGDLVNID |
| Ga0211680_101680113 | 3300020389 | Marine | QHALVTYQDAIRQRRLEKWHKDFKKARGEPDLGDLINIE |
| Ga0211583_100760503 | 3300020397 | Marine | MLAQLQHALLTYQNAIRERRIEAWHKNNKKLRNEPDLGDLVNIE |
| Ga0211699_102450332 | 3300020410 | Marine | YALQTYQNAIRERRLEEWYKNNKKARGEPDIGDLINIE |
| Ga0211699_104107502 | 3300020410 | Marine | HALNTYRNAIRERRIEEWHKNNKKARNEPDLGDLVNID |
| Ga0211516_104311272 | 3300020413 | Marine | LRTYQDAVRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0211512_104773932 | 3300020419 | Marine | LQNLQMALRTYQDAVRQKRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0211622_105023731 | 3300020430 | Marine | FTYQDAVRQRRIEKWHKDIKKARGEPDLGDLINID |
| Ga0211544_102428601 | 3300020443 | Marine | ALQTYQTEIRNRRLEEWHKKNKKARGEPDIGDLINIE |
| Ga0211574_103334292 | 3300020446 | Marine | LTYQDAIRQRRIESWHENRKKLRNEPDLGDLINIE |
| Ga0211473_104631052 | 3300020451 | Marine | LNTYRNAIRERRLEAWHKNNKKLRNEPDLGDLVNID |
| Ga0211473_105908772 | 3300020451 | Marine | NLQKALSTYQDAIRQRRLEQWHKNYKKARGEPDLGDLINME |
| Ga0211535_103707411 | 3300020461 | Marine | GRNPEMLAQLQYALQTYQNAIRERRLEEWYKNNKKARGEPDIGDLINIE |
| Ga0211676_100516357 | 3300020463 | Marine | QALNTYRMAIRERRIEEWHKNNKKLRGEPDLGDLVNID |
| Ga0211640_101416251 | 3300020465 | Marine | NLQKALLTYQDAIRQRRLEQWHKNYKKARGEPDLGDLINME |
| Ga0211577_105069091 | 3300020469 | Marine | LFNLQHALKTYQDAIRQRRIEDWHKNNKKLRNEPDLGDLVNID |
| Ga0206685_100831431 | 3300021442 | Seawater | RNPDILAKLQEALLTYQDEIRQRRLEDWHKKFKKQRGEPDIGDLINIE |
| Ga0226832_103181952 | 3300021791 | Hydrothermal Vent Fluids | VGSARRFARNPVILNKLQEALSTYQNEIRNRRVEEWHKARQKKTGEPDIGDLINIE |
| Ga0222717_106754002 | 3300021957 | Estuarine Water | RNPDMLAQLQHALATYRNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0222718_101862893 | 3300021958 | Estuarine Water | VAIARRGRNPEMLANLQMALKTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0222718_104570742 | 3300021958 | Estuarine Water | PEMLANLQQALVTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0222719_100854161 | 3300021964 | Estuarine Water | RRGRNPEMLANLQQALFTYQNAIRERRIEEWHKNNKKLRNEPDLGDLINME |
| Ga0255780_100801495 | 3300022935 | Salt Marsh | RALQTYQNAIRERRIEEWHKNHKKLRNEPDLGDLINME |
| Ga0255780_104230701 | 3300022935 | Salt Marsh | MLANLQMALKTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0255764_100297568 | 3300023081 | Salt Marsh | KTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0255751_100180082 | 3300023116 | Salt Marsh | MLANLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0255759_106342631 | 3300023178 | Salt Marsh | ERLAQLQNALATYRNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0222689_10310992 | 3300023231 | Saline Water | QLQHALMTYQNAIRERRLEAWHENNKKLRNEPDLGDLVNID |
| Ga0233396_11355701 | 3300024428 | Seawater | NTYRDAIRQRRIEEWHKNNKKLRGEPDLGDLVNID |
| Ga0208156_10221091 | 3300025082 | Marine | NPEMLQKLQHALGTYQDAIRQRRLEQWHKDFKKARGEPDLGDLINIE |
| Ga0209634_11230781 | 3300025138 | Marine | HALRTYQDAVRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0208768_10216931 | 3300025601 | Saline Lake | DMLAQLQHALMTYQNAIRERRLEAWHENNKKLRNEPDLGDLVNID |
| Ga0209716_10210277 | 3300025626 | Pelagic Marine | KTYQEAIRQRRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0208428_10845251 | 3300025653 | Aqueous | QMALNTYRNAIRERRIEAWHKNNKKLRNEPDIGDLINID |
| Ga0208543_11592321 | 3300025810 | Aqueous | IARRGRNPEMLANLQQALMTYQNAIRERRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0208542_12065561 | 3300025818 | Aqueous | RNPEMLSNLQMALRTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0209309_100317651 | 3300025881 | Pelagic Marine | QALRTYQDAIRQRRVEEWHKNNKKLRNEPDLGDLVNID |
| Ga0209632_100213819 | 3300025886 | Pelagic Marine | FNLQHALKTYQDAIRQRRIEEWHKNNKKLRNEPDLGDLVNIE |
| Ga0209630_102505601 | 3300025892 | Pelagic Marine | HALATYQNAIRERRLEAWHKNNKKLRNEPDLGDLVNID |
| Ga0207963_11004882 | 3300026080 | Marine | ATYQDAIRQRRLEQWHKDYKKARGEPDLGDLINIE |
| Ga0209932_10596473 | 3300026183 | Pond Water | IARRGRNPEMLANLQMALRTYQDAIRQRRIEEWHKNNKKLRNEPDIGDLINID |
| Ga0208405_10218471 | 3300026189 | Marine | QLQKALFTYQDAIRQRRLEQWHKDVKKARNEPDLGDLINID |
| Ga0208521_11221242 | 3300026204 | Marine | MLQKLQHALGTYQDAIRQRRLEQWHKDFKKARGEPDLGDLINIE |
| Ga0208524_10083551 | 3300026261 | Marine | LQKLQHALGTYQDAIRQRRLEQWHKDFKKARGEPDLGDLINIE |
| Ga0208278_11117682 | 3300026267 | Marine | VAIARRGRNPEMLGKLQHALATYQDAIRQRRLEQWHKDYKKARGEPDLGDLINIE |
| Ga0209710_11201651 | 3300027687 | Marine | FGRNPEILAQLQHALMTYQNAVRERRLEEWHKNNKKMRNEPDLGDLVSID |
| Ga0209816_12157952 | 3300027704 | Marine | VARRGRNPEMLAQLTKALITYQNAIRERRLEEWHKNNKKMRNEPDLGDLINID |
| Ga0209359_101936563 | 3300027830 | Marine | MTYQDAIRQRRVESWHANRKKLRNEPDLGDLINIE |
| Ga0209402_104097051 | 3300027847 | Marine | LQQLQHALITYQNAIRERRIEAWHKNNKKLRNEPDLGDLVNME |
| Ga0209404_104325061 | 3300027906 | Marine | QKALLTYQDAIRQRRLEQWHKDIKKARNEPDLGDLINID |
| Ga0257108_11246981 | 3300028190 | Marine | NPDILYKLQEALATYQNEIRNRRIEEWHKNHQKVTGEPDIGDLINIE |
| Ga0257108_11512132 | 3300028190 | Marine | HALATYQDAIRQRRLEQWHKDYKKARGEPDLGDLINIE |
| Ga0257106_12613292 | 3300028194 | Marine | IARRGRNPEMLQNLQMALRTYQDAVRQKRIEEWHKNNKKLRNEPDLGDLVNID |
| Ga0302131_10202751 | 3300031594 | Marine | LMTYQNAVRERRLEEWHKNNKKARGEPDLGDLVNIE |
| Ga0302131_12117992 | 3300031594 | Marine | QLQHALMTYQNAVRERRLEEWHKNNKKMRNEPDLGDLVNIE |
| Ga0302132_105434601 | 3300031605 | Marine | HALMTYQNAVREKRLEDWHKANKKARGEPDLGDLVNID |
| Ga0302119_102161741 | 3300031606 | Marine | LQQLQHALMTYQNAIRERRIEAWHKNNKKLRNEPDLGDLVNID |
| Ga0302118_102259303 | 3300031627 | Marine | KLQHALGTYQDAIRQRRLEKWHKDFKKARGEPDLGDLINIE |
| Ga0302125_102389681 | 3300031638 | Marine | LQHALMAYQNAIRERRLEEWHKNNKKARGEPDLGDLVNIE |
| Ga0308018_100902731 | 3300031655 | Marine | AVARRGRNPEMLAQLTKALITYQNAIRERRLEEWHKNNKKMRNEPDLGDLINID |
| Ga0302136_10760981 | 3300031676 | Marine | LAQLQHALMTYQNAVRERRIESWHKNNKKMRNEPDLGDLVNIE |
| Ga0315328_107094802 | 3300031757 | Seawater | NPDVLQKLQHALATYQDAIRQRRLEKWHKDYKKARGEPDLGALVNIE |
| Ga0315322_103533571 | 3300031766 | Seawater | HALQTYQDAIRQRRLEQWHKDFKKARGEPDLGDLINIE |
| Ga0310122_103732851 | 3300031800 | Marine | ITYQNEIRNRRVEQWHKEHKKATGEPDIGDLINIE |
| Ga0315318_104474211 | 3300031886 | Seawater | RGRNPDMLQQLQKALFTYQDALRQRRLEEWHKKIKEARNEPDLGDLINID |
| Ga0315316_105020551 | 3300032011 | Seawater | RNPQLLAELQKVLLTYQDAIRQRRIEEWHKNHKKLRGEPDMGDLINIE |
| Ga0315333_103733332 | 3300032130 | Seawater | AKLQEALLTYQDEIRQRRLEDWHKKFKKQRGEPDIGDLINIE |
| Ga0315334_103191211 | 3300032360 | Seawater | MLAKLQHALQTYQGAISQRRLEEWHKKYKKERGEPDLGDLINIE |
| ⦗Top⦘ |