


| Basic Information | |
|---|---|
| Family ID | F061315 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | DAPSAELRARVRDPISLALSYGSGLLLVAVLALMIWKPGA |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.03 % |
| % of genes from short scaffolds (< 2000 bps) | 2.27 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.485 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00120 | Gln-synt_C | 12.12 |
| PF10027 | DUF2269 | 2.27 |
| PF16363 | GDP_Man_Dehyd | 0.76 |
| PF03951 | Gln-synt_N | 0.76 |
| PF14693 | Ribosomal_TL5_C | 0.76 |
| PF06271 | RDD | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.76 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.48 % |
| All Organisms | root | All Organisms | 1.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100616042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300012951|Ga0164300_11148592 | Not Available | 511 | Open in IMG/M |
| 3300012960|Ga0164301_11169041 | Not Available | 616 | Open in IMG/M |
| 3300012989|Ga0164305_10054956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2352 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.76% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1006160421 | 3300000364 | Soil | GDAPSPELQARVRDPISLALSYGSGLVLVAVLALMVWKPGA* |
| JGI10214J12806_102162923 | 3300000891 | Soil | AGDAPSAELRARVHDPISLALSYGSGLLLVAVLALMIWKPGA* |
| JGI10214J12806_107732573 | 3300000891 | Soil | LAAAGDTPSQELTARLRDPVWLALSWGSGIVVLAILALMIWKPGA* |
| JGI10216J12902_1069972261 | 3300000956 | Soil | PSAELRARLRDPVTLFLSYGSALVIVAMVAIMVWKPGA* |
| JGI10216J12902_1109072861 | 3300000956 | Soil | LVASGDAPSPELRRRVRDPVSLALSYGSGLVLVALLAIMIWKPGA* |
| JGI10216J12902_1158613033 | 3300000956 | Soil | RELAAAGDAPSPELRARVRDPVSLALSYGSGLLLVTILALMIWKPGA* |
| A15PFW1_109870273 | 3300001534 | Permafrost | MAQGDAPSPELRARVRDPITLACNYGSGLILVALLAIMIWKPGA* |
| C688J35102_1182747182 | 3300002568 | Soil | AGQGDSPSLELRARLRDPLSLALSYGSGAVVIAILALMIWKPGS* |
| Ga0055455_102869821 | 3300003990 | Natural And Restored Wetlands | ERLAAEGGRPSTELQARLRDPTSLVLSYGSGVAVLAILVLMIWKPGS* |
| Ga0062591_1007529863 | 3300004643 | Soil | LAAEGDQPSPELRASLRDPITLAMSWGSGAIVIVILVLMIWKPGH* |
| Ga0062591_1021160142 | 3300004643 | Soil | LARELAAAGDAPSAELRARVHDPISLALSYGSGLLLVAVLALMIWKPGA* |
| Ga0062594_1005751073 | 3300005093 | Soil | RLAAQGDQPSPELRARLRDPLTLALSYGSGLAVLAILALMIWKPGS* |
| Ga0062594_1030367001 | 3300005093 | Soil | SEGDAPSPELRARLRDPKGLALVWTSFLLTLAILVLMIWKPGA* |
| Ga0066685_107854991 | 3300005180 | Soil | RFLAERLAAEGDEPSRELRRRLRDPLTLALSWSSGALTLAILGLMIWKPGA* |
| Ga0066676_104308221 | 3300005186 | Soil | KQVRELAERLAAEGDVPSAELSKRLRDPVWLALSWGSGLVVIAILALMIWKPGH* |
| Ga0070713_1006394851 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH* |
| Ga0070711_1018775932 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RELAASGDAPNAELKARVRDPVSLALSYGSGLVLVVILALMVWKPGA* |
| Ga0070694_1005299541 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGDAPSAELQARLRDPVSLALSYGSGLVLVIVLALMVWKPGA* |
| Ga0070707_1012028721 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEGDAPSTELRARMRDPVTLALSWGSGLVVVAILAIMIWKPGH* |
| Ga0073909_103286581 | 3300005526 | Surface Soil | QELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA* |
| Ga0070741_112786611 | 3300005529 | Surface Soil | AREGDAPSEELRSTLRDPLSYALNFGSGLVVFAVLALMIWKPGS* |
| Ga0068856_1005973961 | 3300005614 | Corn Rhizosphere | QGDAPSAELHARVRDPISLAGSYGSGLILVALLAIMIWKPGA* |
| Ga0066905_1003265514 | 3300005713 | Tropical Forest Soil | ELAEQLAAQGDQPSPELRARLRDPVTLALSWGSGVVVVVILILMIWKPGH* |
| Ga0068863_1022871141 | 3300005841 | Switchgrass Rhizosphere | ETRVLAERLASEGDAPSTELRARMRDPLTLALSWGSGVVVIAILALMIWKPGH* |
| Ga0068858_1011637483 | 3300005842 | Switchgrass Rhizosphere | ASGDAPSAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA* |
| Ga0081539_103714372 | 3300005985 | Tabebuia Heterophylla Rhizosphere | RPSDELRARLHDPVALALNAASTLALVILLALMVWKPGA* |
| Ga0070717_106369421 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH* |
| Ga0075432_102062781 | 3300006058 | Populus Rhizosphere | GDQPSPELRASLRDPITLAMSWGSGAIVVVILVLMIWKPGH* |
| Ga0070715_103385423 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RALAAAGDEPSAELRARVRDPISLALSYGSGLLLVLVLALMIWKPGA* |
| Ga0075367_108293682 | 3300006178 | Populus Endosphere | RLAAEGDQPSPELRASLRDPITLAMSWGSGAIVVVILVLMIWKPGH* |
| Ga0074048_124988551 | 3300006581 | Soil | AGDAPSAELLERVRDPVALVLNYGSGLLLVAILAIMIWKPGA* |
| Ga0074057_100450751 | 3300006605 | Soil | DRHTRALAEQLAASGDQPSTELASRLHERGTLLLSYGSGAAVIAILVLMIWKPGS* |
| Ga0075421_1015104142 | 3300006845 | Populus Rhizosphere | SPELRRRLRDPVWLALSYGSGLVLVAILAIMIWKPGA* |
| Ga0075433_116005242 | 3300006852 | Populus Rhizosphere | GGDEPSADLKRRLRDPVSLALSYGSGLVLVAILAIMIWKPGA* |
| Ga0068865_1007579061 | 3300006881 | Miscanthus Rhizosphere | APSQELSARLRDPMWLALSWGSGVVVIAILALMVWKPGA* |
| Ga0066710_1032804662 | 3300009012 | Grasslands Soil | ELAERLAAEGDVPSAELSKRLRDPVWLALSWGSGLVVIAILALMIWKPGH |
| Ga0066709_1017383441 | 3300009137 | Grasslands Soil | DAPSPELEARLPDPLTLALSYGGGVAILAILVIMIWKPGA* |
| Ga0111538_122647133 | 3300009156 | Populus Rhizosphere | AEELAAKGDAPSVALKERLRDPISLILSYFGGAAVIAALVLMVWKPGA* |
| Ga0105242_105722501 | 3300009176 | Miscanthus Rhizosphere | DTPSQELTARLRDPVWLALSWGSGIAIIAILALMIWKPGA* |
| Ga0105248_120558891 | 3300009177 | Switchgrass Rhizosphere | ELRARVRDPISLMLSYGSGLVLVAVLALMVWKPGA* |
| Ga0105238_102347061 | 3300009551 | Corn Rhizosphere | GDAPSAELTARLRDPVWLALSWGSGIVVLVILALMIWKPGT* |
| Ga0126374_104682391 | 3300009792 | Tropical Forest Soil | ARRLAAEGDAPSDELRARVHHPISLALSYGSGLLLVAVLALMIWKPGA* |
| Ga0126374_113466311 | 3300009792 | Tropical Forest Soil | DAPSAELRARVRDPISLALSYGSGLLLVAVLALMIWKPGA* |
| Ga0105058_10188181 | 3300009837 | Groundwater Sand | AERLAADGDQPSAELSERLRDPVALAMNWSSGLVAVAILGLMIWKPGA* |
| Ga0126305_108411512 | 3300010036 | Serpentine Soil | ELHAHLRDPLSLGLSWGSGVVVVVILALMIWKPGT* |
| Ga0126304_102354801 | 3300010037 | Serpentine Soil | REKETRRLAERLAAEGDAPSDELHARLRDPLSLGLSWGSGVVVVVILALMIWKPGT* |
| Ga0126312_108605962 | 3300010041 | Serpentine Soil | DTGLRVRLRDPVTLALEYSSGLAILVILVLMIWKPGQ* |
| Ga0126314_111794231 | 3300010042 | Serpentine Soil | HELAEEGDAPSAVIRRRVRDPLSLALSYGAGILMVAVLALMVWKPGA* |
| Ga0126310_100952323 | 3300010044 | Serpentine Soil | AELRARVHDPISLALSYGSGLILIVILALMTWKPGA* |
| Ga0134071_103538553 | 3300010336 | Grasslands Soil | ATGGDQPSPELQARLRDPVTLALSWGSGAVVIVILALMIWKPGA* |
| Ga0126377_113446191 | 3300010362 | Tropical Forest Soil | LRARVRDPISLTLSYGSGLLLVLVLALMIWKPGA* |
| Ga0126377_134329912 | 3300010362 | Tropical Forest Soil | LLARLRDPRTLALDYGSGVVLVVVLALMVWKPGS* |
| Ga0126379_122985092 | 3300010366 | Tropical Forest Soil | LAAEGDQPSSELRGRLRDPVTLAMSWGSGLAVIGILALMIWKPGH* |
| Ga0134128_129855972 | 3300010373 | Terrestrial Soil | SRTAELAARIASEGDEPTTELRRRLRDPLSLAYNFGSGLVVLAILGLMIWKPGS* |
| Ga0134126_116050931 | 3300010396 | Terrestrial Soil | ELTARLRDPVWLALSWCSGIVIIVILALMIWKPGA* |
| Ga0134121_110618533 | 3300010401 | Terrestrial Soil | DEPIAELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA* |
| Ga0138514_1000719562 | 3300011003 | Soil | DQPSAELRARMRDPLSLALSYGSGLAILAMLAIMIWKPGE* |
| Ga0137388_104432091 | 3300012189 | Vadose Zone Soil | DAPSRELKARLRDPATLVLSYGAGVAILGILALMIWKPGA* |
| Ga0137364_101098991 | 3300012198 | Vadose Zone Soil | LQARLRDPLTLALSWGSGTVVIVILALMIWKPGA* |
| Ga0150985_1053818011 | 3300012212 | Avena Fatua Rhizosphere | SPELRSSLRDPITLAMSWGSGAVVVVILVLMIWKPGH* |
| Ga0150985_1096210161 | 3300012212 | Avena Fatua Rhizosphere | ELQARVRDPISLAGSYGSGLILVALLAIMIWKPGA* |
| Ga0137387_101368271 | 3300012349 | Vadose Zone Soil | AAEGDAPSRELTARLRDPVWLALSWGSGIVIVAILALMIWKPGA* |
| Ga0137366_105209432 | 3300012354 | Vadose Zone Soil | MQQETRILAERLAAEGDAPSQELRARLHDRVALALSWSSGFAALAILALMIWKPGA* |
| Ga0137375_111299071 | 3300012360 | Vadose Zone Soil | RLAAQGDAPSPELRARLRDPVALALSWSSGLAALAILAMMIWKPGA* |
| Ga0137361_117153021 | 3300012362 | Vadose Zone Soil | ERKVRELAERLTAEGDLPSPELSARLRDPIWLAVSWSSGIAAIAILALMIWKPGA* |
| Ga0150984_1135388201 | 3300012469 | Avena Fatua Rhizosphere | PELRARVHDPVSLALSYGSGLVLVIVLALMIWKPGA* |
| Ga0137373_101616924 | 3300012532 | Vadose Zone Soil | SELAARVRDPVALSLNIASSLLGFAILAVMIWKPGAGG* |
| Ga0137404_106299933 | 3300012929 | Vadose Zone Soil | GREKQTRELAERLAAEGDAPSKELSSRLRDPVWLALSWGSGVVIIAILALMIWKPGT* |
| Ga0164300_104975241 | 3300012951 | Soil | ASGDAPSAELRARVHDPISLALSYGSGLVLIAVLALMVWKPGA* |
| Ga0164300_111485921 | 3300012951 | Soil | LAGSGDAPSPELRARVHDPISLALSYGSGLVLIVVLALMIWKPGA* |
| Ga0164298_104481243 | 3300012955 | Soil | VRQPPRQELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA* |
| Ga0164303_100946221 | 3300012957 | Soil | QLAERLAAEGDAPSQELSARLRDPTWLALSWGSGVVVIAILALMIWKPGA* |
| Ga0164303_107920662 | 3300012957 | Soil | LASSLDELAASGDAPSAELRARVHDPISLALSYGSGLVLIAVLALMVWRPGA* |
| Ga0164299_100585481 | 3300012958 | Soil | ELTARLRDPVWLGLSWGSGIVILVILALMIWKPGT* |
| Ga0164301_111690411 | 3300012960 | Soil | RQARVRDPISLALSYGSGLVLIAGLALMVWKPGA* |
| Ga0134077_104840462 | 3300012972 | Grasslands Soil | AELRARVRDPVALSLNIVSSLLGLAILVVMIWKPGAPG* |
| Ga0164309_101522354 | 3300012984 | Soil | LAAEGDTLSQELTARLRDPVWLALSWASGIVIVAILALMIWKPGA* |
| Ga0164308_101462261 | 3300012985 | Soil | LSARLRDPMWLALSWGSGIVVIAILALMIWKPGA* |
| Ga0164307_101243301 | 3300012987 | Soil | APSAELTARLHDPVWLALSWGSGIVILVILALMIWKPGT* |
| Ga0164307_111198211 | 3300012987 | Soil | EELAAGSNVATPELRARMRDTRTLALSYGSGLMLVAVLALMVWKPGA* |
| Ga0164305_100549561 | 3300012989 | Soil | SPELKARVHDPISLALSYGSGLVLIAVLALMVWKPGA* |
| Ga0157379_114384732 | 3300014968 | Switchgrass Rhizosphere | SAELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA* |
| Ga0132256_1036508152 | 3300015372 | Arabidopsis Rhizosphere | AERLAVEGDAPSPELHAGLRDPVTLALSWGSGLLFVVVLALMIWKPGH* |
| Ga0132257_1020222021 | 3300015373 | Arabidopsis Rhizosphere | APSAELGARLRDPTTLALEYSSGLAVLVILVLMVWKPGA* |
| Ga0187779_104161233 | 3300017959 | Tropical Peatland | GDVASEDLRARLRDPATLALSFGSGVIVFVILVLMIWKPGS |
| Ga0184610_12738461 | 3300017997 | Groundwater Sediment | RLASEGDAPSQELSARLRDPVWLALSWGSGIVIVAILALMIWKPGA |
| Ga0184621_101893562 | 3300018054 | Groundwater Sediment | APSAELQARVRDPITLACNYGSGLILVALLALMIWKPGA |
| Ga0184619_100111681 | 3300018061 | Groundwater Sediment | LAAEGDQPSTELHARLRDPLTLALSWGSGAVVIVILALMIWKPGA |
| Ga0193730_11748951 | 3300020002 | Soil | SPELRARVRDPISLTLSYGSGLLLIAVLALMIWKPGA |
| Ga0213880_101535582 | 3300021953 | Exposed Rock | GGDAPSGELKARLRDPVSLALSYGGGLAVLAIFVLMLSKPGS |
| Ga0207645_110320541 | 3300025907 | Miscanthus Rhizosphere | PELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA |
| Ga0207643_110667022 | 3300025908 | Miscanthus Rhizosphere | ELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA |
| Ga0207663_108289421 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TLSTELRARMRDPLTLALSWGSGVVVIAILALMIWKPGH |
| Ga0207687_110569031 | 3300025927 | Miscanthus Rhizosphere | LAAGSNEATPELRARMRDPRTLALSYGSGLMLVAILALMVWRPGS |
| Ga0207700_106421621 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAAEGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH |
| Ga0207686_106041493 | 3300025934 | Miscanthus Rhizosphere | QELTARLRDPVWLALSWGSGIAIIAILALMIWKPGA |
| Ga0207704_107074183 | 3300025938 | Miscanthus Rhizosphere | APSQELSARLRDPMWLALSWGSGVVVIAILALMVWKPGA |
| Ga0207704_109747322 | 3300025938 | Miscanthus Rhizosphere | QGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA |
| Ga0207711_113544032 | 3300025941 | Switchgrass Rhizosphere | ASGDAPSAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA |
| Ga0207679_110558162 | 3300025945 | Corn Rhizosphere | SGDAPSAELQARLRDPVSLALSYGSGLVLVIVLALMVWKPGA |
| Ga0207668_112130833 | 3300025972 | Switchgrass Rhizosphere | DAPSAELTARLRDPVWLALSWGSGIVVLVILALMIWKPGT |
| Ga0207640_110429412 | 3300025981 | Corn Rhizosphere | ELKARVHDPISLALSYGSGLVLIAVLALMVWKPGA |
| Ga0207683_105788311 | 3300026121 | Miscanthus Rhizosphere | VLAERLASEGDAPSTELRPRMRDPLTLALSWGSGVVVIAILALMIWKPGH |
| Ga0209160_12897541 | 3300026532 | Soil | PELKARLRDPATLVLSYGAGVAILGILALMIWKPGA |
| Ga0209577_108258162 | 3300026552 | Soil | QGDQPSAELRTRLRDPVSLALSWGSGLAVVAILALMIWKPGG |
| Ga0209842_10606242 | 3300027379 | Groundwater Sand | RLAADGDQPSAELSERVRDPVALAMSWSSGLVAVAILGLMIWKPGA |
| Ga0209811_103141142 | 3300027821 | Surface Soil | PTQELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA |
| Ga0268266_115853501 | 3300028379 | Switchgrass Rhizosphere | SAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA |
| Ga0307291_10843442 | 3300028707 | Soil | ELRARVHDPVSLALSYGSGLVLIAILALMIWKPGA |
| Ga0307293_101193093 | 3300028711 | Soil | LAAQGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA |
| Ga0307309_100951233 | 3300028714 | Soil | LALEGDAPSQELSARLRDPMWLALSWGSGVVVIAILALMIWKPGA |
| Ga0307313_100237213 | 3300028715 | Soil | DAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA |
| Ga0307311_100995733 | 3300028716 | Soil | FAEELATQGDAPSAELRSRVRDPITLACNYGSGLILIALLAIMIWKPGA |
| Ga0307319_100136414 | 3300028722 | Soil | AASGDAPSAELRGRVRDPISLALSYGSGLVLVALLAIMIWKPGA |
| Ga0307280_102175041 | 3300028768 | Soil | EDETRKLAERLAAEGDVSSGELRARLRDPVTLALEYSSGLAVVVILVLMIWKPGG |
| Ga0307306_100355641 | 3300028782 | Soil | SGDAPSQELKARVRDPISLTLSYGSGLVLIAVLALMVWKPGA |
| Ga0307323_101070153 | 3300028787 | Soil | GDAPSVALKQRLRDPISLILSYFGGVAVIAALVLMVWKPGA |
| Ga0307323_101735091 | 3300028787 | Soil | ELVAQGDAPSAELRARVRDPITLICNYGSGLILVALLAIMIWKPGA |
| Ga0265338_102174054 | 3300028800 | Rhizosphere | DVATAELRSRLRDPVALLLSWGSGGATLAVLALMIWKPGA |
| Ga0307294_102890611 | 3300028810 | Soil | GDAPSAELQARVRDPITLACNYGSGLILVALLALMIWKPGA |
| Ga0307294_103697492 | 3300028810 | Soil | TPSQELTARLRDPVWLALSWGSGIVIVAILALMIWKPGA |
| Ga0307312_101894651 | 3300028828 | Soil | PSPELKARVRDPISLTLSYGSGLVLIAVLALMVWKPGA |
| Ga0307312_106512871 | 3300028828 | Soil | AGGDAPSPELRARLRDPISLALSWGSGVVVVVILALMIWKPGA |
| Ga0307312_109387382 | 3300028828 | Soil | MAERLAREGDAPSSELRARLHNPVALALSWSSGLATLAILALMIWKPGA |
| Ga0307286_103407272 | 3300028876 | Soil | SPELRARVHDPVSLALSYGSGLVLIAILALMIWKPGA |
| Ga0307308_106182401 | 3300028884 | Soil | EKKVRELAERLTAEGDVPNADLSARLRDPVLLALSWGSGIVVIAILALMIWKPGA |
| Ga0307304_105740191 | 3300028885 | Soil | LTAEGDVPSPELSARLRDPVWLAVSWGSGIVVIAILALMIWKPGA |
| Ga0307304_106166052 | 3300028885 | Soil | GGKREDETRKLAERLAAEGDVSSGELRARLRDPVTLALEYSSGLAVVVILVLMIWKPGG |
| Ga0307499_103194382 | 3300031184 | Soil | PSAELTARLRDPVWLALSWGSGIVILVILALMIWKPGT |
| Ga0308174_115704502 | 3300031939 | Soil | APSGALRARLRDPVSLTLSYGSGLAVLLIVADMIWKPGA |
| Ga0307409_1019926262 | 3300031995 | Rhizosphere | AAGDAPSAELRARVHDPISLALSYGSGLILIVILALMTWKPGA |
| Ga0307470_118332401 | 3300032174 | Hardwood Forest Soil | TAKFAAELAAQGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA |
| ⦗Top⦘ |